G4VLK9_SCHMA Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB , UniProt , Accession G4VLK9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 79 aa.

						>G4VLK9_SCHMA|G4VLK9
MMDDEMSEYLNKMQIKETSELYVRCSTVCFDRCVSNFTSRKLNDKETECVDKCTEKFAKMNQRLTLRLFELNREELVKQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	64.6	Low	88.6	Confident	193 Å²	193	121.5 Å²	121.5	95%	0.951	61%	0.606	S	S	*	*				0	-67.6	0	-82.2	-158.5	-78.3	0	0	111.9	D4 E5	M1-D4 PolarHBondContact N-OD2 3.17Å; M1-E5 PolarHBondContact O-N 3.12Å
2	M	74.1	Confident	89.2	Confident	163 Å²	163	121.6 Å²	121.6	80%	0.803	60%	0.6	S	S	*	*	H	α-helix	trans	-65.9	-37.4	175.8	-76.1	-164.3	-73.1	0	0	113.5	M6	M2-M6 WeakPolarHBondContact O-CB 3.33Å; M2-M6 PolarHBondContact O-N 2.8Å
3	D	87.4	Confident	89.8	Confident	138 Å²	138	118.1 Å²	118.1	74%	0.738	58%	0.582	S	S	*	*	H	α-helix	trans	-67.5	-37.6	179.8	-59.4	-30.1	0	0	0	112.7	S7	D3-S7 WeakPolarHBondContact O-CB 3.49Å; D3-S7 PolarHBondContact O-N 3.38Å
4	D	91.5	Very high	90.1	Very high	112 Å²	112	118 Å²	118	60%	0.599	58%	0.58	S	S	*	*	H	α-helix	trans	-67.7	-44.8	179.3	-52.5	-59.5	0	0	0	111	M1 S7 E8	M1-D4 PolarHBondContact N-OD2 3.17Å; D4-S7 PolarHBondContact O-N 3.31Å; D4-E8 PolarHBondContact O-N 3.43Å
5	E	92.4	Very high	90.5	Very high	142 Å²	142	117.8 Å²	117.8	66%	0.664	58%	0.581	S	S	*	*	H	α-helix	trans	-65.1	-41.2	178.2	-168.8	175	-175	0	0	111.3	M1 E8 Y9	M1-E5 PolarHBondContact O-N 3.12Å; E5-E8 PolarHBondContact O-N 3.47Å; E5-Y9 WeakPolarHBondContact O-CB 3.43Å; E5-Y9 PolarHBondContact O-N 3.37Å
6	M	92.6	Very high	90.9	Very high	109 Å²	109	118.8 Å²	118.8	54%	0.537	58%	0.581	S	S	.	*	H	α-helix	trans	-63.9	-42.8	174.8	-173.3	57.2	60.7	0	0	111.8	M2 Y9 L10	M2-M6 WeakPolarHBondContact O-CB 3.33Å; M2-M6 PolarHBondContact O-N 2.8Å; M6-Y9 PolarHBondContact O-N 3.34Å; M6-Y9 HydrophobicContact SD-CD1 4.42Å; M6-L10 HydrophobicContact CG-CD1 4.25Å; M6-L10 VanDerWaalsContact O-CG 3.31Å; M6-L10 WeakPolarHBondContact O-CG 3.38Å; M6-L10 PolarHBondContact O-N 3.5Å; M6-L10 HydrophobicContact SD-CG 4.47Å
7	S	92.8	Very high	91.2	Very high	61 Å²	61	117.9 Å²	117.9	43%	0.427	58%	0.575	S	S	.	*	H	α-helix	trans	-61.3	-44.2	176.3	-176.7	0	0	0	0	111.8	D3 D4 Y9 L10 N11	D3-S7 WeakPolarHBondContact O-CB 3.49Å; D3-S7 PolarHBondContact O-N 3.38Å; D4-S7 PolarHBondContact O-N 3.31Å; S7-Y9 VanDerWaalsContact C-N 3.34Å; S7-Y9 PolarHBondContact O-N 3.5Å; S7-L10 PolarHBondContact O-N 2.91Å; S7-N11 WeakPolarHBondContact O-CB 3.3Å; S7-N11 VanDerWaalsContact O-CG 3.26Å; S7-N11 PolarHBondContact O-N 3.38Å; S7-N11 PolarHBondContact O-ND2 3.47Å; S7-N11 VanDerWaalsContact O-ND2 3.14Å
8	E	95.2	Very high	91.4	Very high	105 Å²	105	115.8 Å²	115.8	49%	0.491	57%	0.57	S	S	.	*	H	α-helix	trans	-61.9	-42.5	175.9	-168.7	-176.2	156.7	0	0	111.7	D4 E5 N11 K12	D4-E8 PolarHBondContact O-N 3.43Å; E5-E8 PolarHBondContact O-N 3.47Å; E8-N11 PolarHBondContact O-N 2.95Å; E8-K12 WeakPolarHBondContact O-CG 3.46Å; E8-K12 PolarHBondContact O-N 3.27Å; E8-K12 WeakPolarHBondContact OE1-CE 3.46Å; E8-K12 IonicContact OE1-NZ 2.8Å; E8-K12 PolarHBondContact OE1-NZ 3.01Å
9	Y	94.1	Very high	91.6	Very high	147 Å²	147	113.1 Å²	113.1	58%	0.576	56%	0.564	S	S	*	*	H	α-helix	trans	-60.9	-47.7	176	179.1	-97.6	0	0	0	112	E5 M6 S7 N11 K12 M13	E5-Y9 WeakPolarHBondContact O-CB 3.43Å; E5-Y9 PolarHBondContact O-N 3.37Å; M6-Y9 PolarHBondContact O-N 3.34Å; M6-Y9 HydrophobicContact SD-CD1 4.42Å; S7-Y9 VanDerWaalsContact C-N 3.34Å; S7-Y9 PolarHBondContact O-N 3.5Å; Y9-N11 VanDerWaalsContact C-N 3.34Å; Y9-N11 PolarHBondContact O-N 3.45Å; Y9-K12 PolarHBondContact O-N 3.41Å; Y9-M13 PolarHBondContact O-N 2.97Å
10	L	95.2	Very high	91.9	Very high	87 Å²	87	113.1 Å²	113.1	46%	0.455	56%	0.562	S	S	.	*	H	α-helix	trans	-60.8	-42	177.4	-71	173	0	0	0	111.9	M6 S7 M13 Q14	M6-L10 HydrophobicContact CG-CD1 4.25Å; M6-L10 VanDerWaalsContact O-CG 3.31Å; M6-L10 WeakPolarHBondContact O-CG 3.38Å; M6-L10 PolarHBondContact O-N 3.5Å; M6-L10 HydrophobicContact SD-CG 4.47Å; S7-L10 PolarHBondContact O-N 2.91Å; L10-M13 HydrophobicContact CD2-CE 3.99Å; L10-M13 PolarHBondContact O-N 3.21Å; L10-Q14 WeakPolarHBondContact O-CB 3.34Å; L10-Q14 PolarHBondContact O-N 3.29Å
11	N	95.1	Very high	92.2	Very high	79 Å²	79	111.2 Å²	111.2	42%	0.422	55%	0.554	S	S	.	*	H	α-helix	trans	-62.4	-44	176.7	-74.1	-32.9	0	0	0	112	S7 E8 Y9 M13 Q14 I15	S7-N11 WeakPolarHBondContact O-CB 3.3Å; S7-N11 VanDerWaalsContact O-CG 3.26Å; S7-N11 PolarHBondContact O-N 3.38Å; S7-N11 PolarHBondContact O-ND2 3.47Å; S7-N11 VanDerWaalsContact O-ND2 3.14Å; E8-N11 PolarHBondContact O-N 2.95Å; Y9-N11 VanDerWaalsContact C-N 3.34Å; Y9-N11 PolarHBondContact O-N 3.45Å; N11-M13 VanDerWaalsContact C-N 3.3Å; N11-M13 PolarHBondContact O-N 3.05Å; N11-Q14 PolarHBondContact O-N 2.98Å; N11-I15 WeakPolarHBondContact O-CG1 3.48Å; N11-I15 PolarHBondContact O-N 3.03Å
12	K	96	Very high	93.7	Very high	123 Å²	123	110.3 Å²	110.3	54%	0.535	54%	0.541	S	S	.	.	H	α-helix	trans	-60.3	-42.6	176	-76.2	175.3	-176.3	164.4	0	111.5	E8 Y9 K16	E8-K12 WeakPolarHBondContact O-CG 3.46Å; E8-K12 PolarHBondContact O-N 3.27Å; E8-K12 WeakPolarHBondContact OE1-CE 3.46Å; E8-K12 IonicContact OE1-NZ 2.8Å; E8-K12 PolarHBondContact OE1-NZ 3.01Å; Y9-K12 PolarHBondContact O-N 3.41Å; K12-K16 PolarHBondContact O-N 3.4Å; K12-K16 VanDerWaalsContact O-N 3.17Å
13	M	96.1	Very high	94.8	Very high	76 Å²	76	106.7 Å²	106.7	37%	0.374	53%	0.528	S	S	.	.	H	α-helix	trans	-63	-47	177.2	-168.8	174.3	69.8	0	0	111.3	Y9 L10 N11 I15 K16 E17	Y9-M13 PolarHBondContact O-N 2.97Å; L10-M13 HydrophobicContact CD2-CE 3.99Å; L10-M13 PolarHBondContact O-N 3.21Å; N11-M13 VanDerWaalsContact C-N 3.3Å; N11-M13 PolarHBondContact O-N 3.05Å; M13-I15 PolarHBondContact O-N 3.28Å; M13-K16 WeakPolarHBondContact O-CB 3.22Å; M13-K16 PolarHBondContact O-N 2.84Å; M13-E17 WeakPolarHBondContact O-CG 3.46Å; M13-E17 PolarHBondContact O-N 3.45Å
14	Q	94.9	Very high	95.3	Very high	117 Å²	117	108.3 Å²	108.3	55%	0.547	52%	0.524	S	S	.	.	H	α-helix	trans	-60.7	-42.2	179	-173.4	-175.7	-1.4	0	0	112.5	L10 N11 K16 E17 T18	L10-Q14 WeakPolarHBondContact O-CB 3.34Å; L10-Q14 PolarHBondContact O-N 3.29Å; N11-Q14 PolarHBondContact O-N 2.98Å; Q14-K16 VanDerWaalsContact C-N 3.31Å; Q14-K16 PolarHBondContact O-N 2.99Å; Q14-E17 PolarHBondContact O-N 3.43Å; Q14-T18 VanDerWaalsContact O-CB 3.31Å; Q14-T18 WeakPolarHBondContact O-CB 3.39Å; Q14-T18 PolarHBondContact O-N 2.94Å; Q14-T18 PolarHBondContact O-OG1 3.33Å
15	I	95.8	Very high	95.6	Very high	115 Å²	115	104 Å²	104	59%	0.59	50%	0.502	S	S	*	.	H	α-helix	trans	-62.2	-42.2	177.5	-70.2	168.4	0	0	0	110.6	N11 M13 T18 S19	N11-I15 WeakPolarHBondContact O-CG1 3.48Å; N11-I15 PolarHBondContact O-N 3.03Å; M13-I15 PolarHBondContact O-N 3.28Å; I15-T18 PolarHBondContact O-N 3.4Å; I15-S19 WeakPolarHBondContact O-CB 3.43Å; I15-S19 PolarHBondContact O-N 3.28Å; I15-S19 PolarHBondContact O-OG 3.5Å
16	K	97.3	Very high	95.9	Very high	134 Å²	134	99.9 Å²	99.9	58%	0.583	49%	0.489	S	S	*	.	H	α-helix	trans	-61.6	-51.7	177.5	-176.5	-174.1	172.9	-170	0	111.1	K12 M13 Q14 T18 S19 E20	K12-K16 PolarHBondContact O-N 3.4Å; K12-K16 VanDerWaalsContact O-N 3.17Å; M13-K16 WeakPolarHBondContact O-CB 3.22Å; M13-K16 PolarHBondContact O-N 2.84Å; Q14-K16 VanDerWaalsContact C-N 3.31Å; Q14-K16 PolarHBondContact O-N 2.99Å; K16-T18 VanDerWaalsContact C-N 3.31Å; K16-T18 PolarHBondContact O-N 3.18Å; K16-S19 WeakPolarHBondContact O-CB 3.48Å; K16-S19 PolarHBondContact O-N 3.02Å; K16-S19 VanDerWaalsContact O-N 3.12Å; K16-E20 WeakPolarHBondContact CE-OE1 3.35Å; K16-E20 PolarHBondContact O-N 2.84Å
17	E	95.2	Very high	96.2	Very high	103 Å²	103	98 Å²	98	48%	0.481	48%	0.484	S	S	.	.	H	α-helix	trans	-61.1	-40.7	179.6	-69.4	179.1	165.2	0	0	112	M13 Q14 S19 E20 L21	M13-E17 WeakPolarHBondContact O-CG 3.46Å; M13-E17 PolarHBondContact O-N 3.45Å; Q14-E17 PolarHBondContact O-N 3.43Å; E17-S19 VanDerWaalsContact C-N 3.3Å; E17-S19 PolarHBondContact O-N 2.91Å; E17-E20 PolarHBondContact O-N 3.27Å; E17-L21 WeakPolarHBondContact O-CG 3.15Å; E17-L21 PolarHBondContact O-N 3.23Å
18	T	94.5	Very high	96.4	Very high	80 Å²	80	97.2 Å²	97.2	49%	0.491	48%	0.476	S	S	.	.	H	α-helix	trans	-63.4	-38.6	176.6	-57.5	0	0	0	0	111.4	Q14 I15 K16 L21 Y22	Q14-T18 VanDerWaalsContact O-CB 3.31Å; Q14-T18 WeakPolarHBondContact O-CB 3.39Å; Q14-T18 PolarHBondContact O-N 2.94Å; Q14-T18 PolarHBondContact O-OG1 3.33Å; I15-T18 PolarHBondContact O-N 3.4Å; K16-T18 VanDerWaalsContact C-N 3.31Å; K16-T18 PolarHBondContact O-N 3.18Å; T18-L21 PolarHBondContact O-N 3.29Å; T18-Y22 PolarHBondContact O-N 3.38Å
19	S	96.8	Very high	96.6	Very high	65 Å²	65	92.3 Å²	92.3	46%	0.455	45%	0.454	S	S	.	.	H	α-helix	trans	-65.9	-41.4	176.9	-58.9	0	0	0	0	111.7	I15 K16 E17 Y22 V23	I15-S19 WeakPolarHBondContact O-CB 3.43Å; I15-S19 PolarHBondContact O-N 3.28Å; I15-S19 PolarHBondContact O-OG 3.5Å; K16-S19 WeakPolarHBondContact O-CB 3.48Å; K16-S19 PolarHBondContact O-N 3.02Å; K16-S19 VanDerWaalsContact O-N 3.12Å; E17-S19 VanDerWaalsContact C-N 3.3Å; E17-S19 PolarHBondContact O-N 2.91Å; S19-Y22 WeakPolarHBondContact O-CB 3.31Å; S19-Y22 PolarHBondContact O-N 3.35Å; S19-V23 WeakPolarHBondContact O-CG2 3.16Å; S19-V23 PolarHBondContact O-N 3.44Å
20	E	97.3	Very high	96.8	Very high	112 Å²	112	90.3 Å²	90.3	52%	0.523	45%	0.448	S	S	.	.	H	α-helix	trans	-64.3	-41.1	175.5	-69.2	175.7	-174.1	0	0	111.9	K16 E17 Y22 V23 R24	K16-E20 WeakPolarHBondContact CE-OE1 3.35Å; K16-E20 PolarHBondContact O-N 2.84Å; E17-E20 PolarHBondContact O-N 3.27Å; E20-Y22 VanDerWaalsContact C-N 3.33Å; E20-Y22 PolarHBondContact O-N 3.06Å; E20-V23 PolarHBondContact O-N 3.41Å; E20-R24 WeakPolarHBondContact O-CB 3.18Å; E20-R24 PolarHBondContact O-N 2.66Å
21	L	96.6	Very high	96.9	Very high	75 Å²	75	91.9 Å²	91.9	39%	0.393	46%	0.457	S	S	.	.	H	α-helix	trans	-62.2	-39.7	173.8	-76.3	171.2	0	0	0	112.2	E17 T18 R24 C25 N61	E17-L21 WeakPolarHBondContact O-CG 3.15Å; E17-L21 PolarHBondContact O-N 3.23Å; T18-L21 PolarHBondContact O-N 3.29Å; L21-R24 PolarHBondContact O-N 3.28Å; L21-C25 WeakPolarHBondContact O-CB 3.36Å; L21-C25 PolarHBondContact O-N 3.47Å; L21-N61 WeakPolarHBondContact CD2-OD1 3.31Å
22	Y	97	Very high	97	Very high	174 Å²	174	97.3 Å²	97.3	68%	0.682	47%	0.471	S	S	*	.	H	α-helix	trans	-61.7	-48.7	176.4	177.7	-96.5	0	0	0	111.7	T18 S19 E20 R24 C25 S26	T18-Y22 PolarHBondContact O-N 3.38Å; S19-Y22 WeakPolarHBondContact O-CB 3.31Å; S19-Y22 PolarHBondContact O-N 3.35Å; E20-Y22 VanDerWaalsContact C-N 3.33Å; E20-Y22 PolarHBondContact O-N 3.06Å; Y22-R24 VanDerWaalsContact C-N 3.3Å; Y22-R24 PolarHBondContact O-N 3.01Å; Y22-C25 WeakPolarHBondContact O-CB 3.47Å; Y22-C25 PolarHBondContact O-N 3.09Å; Y22-S26 PolarHBondContact O-N 3.39Å; Y22-S26 PolarHBondContact O-OG 3.03Å
23	V	97.7	Very high	97.1	Very high	87 Å²	87	91.8 Å²	91.8	53%	0.527	45%	0.449	S	S	.	.	H	α-helix	trans	-62.7	-38.3	177.5	174	0	0	0	0	111.4	S19 E20 S26 T27	S19-V23 WeakPolarHBondContact O-CG2 3.16Å; S19-V23 PolarHBondContact O-N 3.44Å; E20-V23 PolarHBondContact O-N 3.41Å; V23-S26 PolarHBondContact O-OG 3.07Å; V23-T27 WeakPolarHBondContact O-CB 3.45Å; V23-T27 PolarHBondContact O-N 2.73Å; V23-T27 VanDerWaalsContact O-N 3.08Å; V23-T27 PolarHBondContact O-OG1 2.96Å
24	R	97.9	Very high	97.2	Very high	172 Å²	172	89 Å²	89	65%	0.649	44%	0.436	S	S	*	.	H	α-helix	trans	-68.2	-40.8	176.3	-176.2	162.4	-83.9	159.6	-4.2	111.9	E20 L21 Y22 T27 V28 F57	E20-R24 WeakPolarHBondContact O-CB 3.18Å; E20-R24 PolarHBondContact O-N 2.66Å; L21-R24 PolarHBondContact O-N 3.28Å; Y22-R24 VanDerWaalsContact C-N 3.3Å; Y22-R24 PolarHBondContact O-N 3.01Å; R24-T27 PolarHBondContact O-N 2.79Å; R24-V28 HydrophobicContact CG-CG2 4.37Å; R24-V28 WeakPolarHBondContact O-CB 3.47Å; R24-V28 VanDerWaalsContact O-CG2 3.26Å; R24-V28 WeakPolarHBondContact O-CG2 3.31Å; R24-V28 PolarHBondContact O-N 3.44Å; R24-F57 HydrophobicContact CB-CZ 4.31Å; R24-F57 HydrophobicContact CG-CE2 4.29Å; R24-F57 HydrophobicContact CG-CZ 4.04Å
25	C	98.2	Very high	97.1	Very high	21 Å²	21	88.2 Å²	88.2	14%	0.142	44%	0.443	C	S	.	.	H	α-helix	trans	-58.6	-49.9	175.2	-172.6	0	0	0	0	111	L21 Y22 T27 V28 C29 F57	L21-C25 WeakPolarHBondContact O-CB 3.36Å; L21-C25 PolarHBondContact O-N 3.47Å; Y22-C25 WeakPolarHBondContact O-CB 3.47Å; Y22-C25 PolarHBondContact O-N 3.09Å; C25-T27 PolarHBondContact O-N 3.28Å; C25-V28 PolarHBondContact O-N 3.39Å; C25-C29 WeakPolarHBondContact O-CB 3.35Å; C25-C29 PolarHBondContact O-N 3.17Å; C25-C29 PolarHBondContact O-SG 2.76Å; C25-F57 HydrophobicContact CB-CD1 3.54Å; C25-F57 HydrophobicContact CB-CE1 3.46Å; C25-F57 VanDerWaalsContact CB-CE1 3.46Å; C25-F57 HydrophobicContact CB-CG 4.2Å; C25-F57 HydrophobicContact CB-CZ 4.07Å; C25-F57 WeakPolarHBondContact SG-CD1 3.44Å
26	S	97.9	Very high	97	Very high	56 Å²	56	86.1 Å²	86.1	39%	0.392	43%	0.433	S	S	.	.	H	α-helix	trans	-62.3	-44.4	-178.7	64.5	0	0	0	0	111.9	Y22 V23 C29 F30	Y22-S26 PolarHBondContact O-N 3.39Å; Y22-S26 PolarHBondContact O-OG 3.03Å; V23-S26 PolarHBondContact O-OG 3.07Å; S26-C29 PolarHBondContact O-N 2.96Å; S26-F30 VanDerWaalsContact O-CB 3.24Å; S26-F30 WeakPolarHBondContact O-CB 3.48Å; S26-F30 PolarHBondContact O-N 3.29Å
27	T	98.1	Very high	97	Very high	70 Å²	70	87 Å²	87	43%	0.429	44%	0.437	S	S	.	.	H	α-helix	trans	-61.7	-49	177.7	-52.2	0	0	0	0	111.2	V23 R24 C25 C29 F30 D31	V23-T27 WeakPolarHBondContact O-CB 3.45Å; V23-T27 PolarHBondContact O-N 2.73Å; V23-T27 VanDerWaalsContact O-N 3.08Å; V23-T27 PolarHBondContact O-OG1 2.96Å; R24-T27 PolarHBondContact O-N 2.79Å; C25-T27 PolarHBondContact O-N 3.28Å; T27-C29 PolarHBondContact O-N 3.06Å; T27-F30 PolarHBondContact O-N 3.43Å; T27-D31 PolarHBondContact O-N 3.12Å
28	V	98.1	Very high	97	Very high	43 Å²	43	88 Å²	88	26%	0.261	45%	0.45	S	S	.	.	H	α-helix	trans	-62.9	-42	-179.4	168.9	0	0	0	0	111.8	R24 C25 R32 F57	R24-V28 HydrophobicContact CG-CG2 4.37Å; R24-V28 WeakPolarHBondContact O-CB 3.47Å; R24-V28 VanDerWaalsContact O-CG2 3.26Å; R24-V28 WeakPolarHBondContact O-CG2 3.31Å; R24-V28 PolarHBondContact O-N 3.44Å; C25-V28 PolarHBondContact O-N 3.39Å; V28-R32 WeakPolarHBondContact O-CB 3.4Å; V28-R32 VanDerWaalsContact O-CG 3.27Å; V28-R32 WeakPolarHBondContact O-CG 3.44Å; V28-R32 PolarHBondContact O-N 3.46Å; V28-F57 HydrophobicContact CG1-CD2 4.49Å; V28-F57 HydrophobicContact CG2-CE2 4.45Å
29	C	98.4	Very high	97	Very high	3 Å²	3	87.8 Å²	87.8	2%	0.02	45%	0.452	C	S	.	.	H	α-helix	trans	-75	-33.2	-179.5	-66.5	0	0	0	0	112.5	C25 S26 T27 C33 C53	C25-C29 WeakPolarHBondContact O-CB 3.35Å; C25-C29 PolarHBondContact O-N 3.17Å; C25-C29 PolarHBondContact O-SG 2.76Å; S26-C29 PolarHBondContact O-N 2.96Å; T27-C29 PolarHBondContact O-N 3.06Å; C29-C33 WeakPolarHBondContact O-CB 3.49Å; C29-C33 PolarHBondContact O-N 3.47Å; C29-C53 WeakPolarHBondContact CA-SG 3.5Å; C29-C53 HydrophobicContact CB-CB 3.82Å; C29-C53 WeakPolarHBondContact CB-SG 3.46Å; C29-C53 WeakPolarHBondContact SG-CB 3.4Å; C29-C53 CovalentContact SG-SG 2.05Å; C29-C53 PolarHBondContact SG-SG 2.91Å
30	F	98.1	Very high	97	Very high	104 Å²	104	97 Å²	97	46%	0.456	48%	0.477	S	S	.	.	H	α-helix	trans	-60.8	-53.7	171.2	-177.3	-96.4	0	0	0	111.1	S26 T27 R32 C33 V34 F37	S26-F30 VanDerWaalsContact O-CB 3.24Å; S26-F30 WeakPolarHBondContact O-CB 3.48Å; S26-F30 PolarHBondContact O-N 3.29Å; T27-F30 PolarHBondContact O-N 3.43Å; F30-R32 PolarHBondContact O-N 3Å; F30-C33 PolarHBondContact O-N 3.31Å; F30-V34 HydrophobicContact CD2-CB 3.92Å; F30-V34 HydrophobicContact CD2-CG1 4.35Å; F30-V34 HydrophobicContact CD2-CG2 3.68Å; F30-V34 HydrophobicContact CE2-CB 3.91Å; F30-V34 HydrophobicContact CE2-CG1 3.85Å; F30-V34 HydrophobicContact CE2-CG2 4.03Å; F30-V34 HydrophobicContact CG-CB 4.47Å; F30-V34 HydrophobicContact CG-CG2 4.4Å; F30-V34 HydrophobicContact CZ-CB 4.45Å; F30-V34 HydrophobicContact CZ-CG1 4.31Å; F30-V34 WeakPolarHBondContact O-CB 3.34Å; F30-V34 PolarHBondContact O-N 2.91Å; F30-F37 HydrophobicContact CZ-CE1 4.04Å; F30-F37 HydrophobicContact CZ-CZ 4.37Å
31	D	97.8	Very high	96.9	Very high	120 Å²	120	99.8 Å²	99.8	64%	0.642	49%	0.488	S	S	*	.	H	α-helix	trans	-60.9	-30.3	-178.4	-74.5	-8.9	0	0	0	113.5	T27	T27-D31 PolarHBondContact O-N 3.12Å
32	R	97.6	Very high	96.9	Very high	193 Å²	193	100.2 Å²	100.2	73%	0.728	49%	0.49	S	S	*	.	H	α-helix	trans	-88.8	-35.3	-178.2	-73	-179.6	-178.6	-136	1.6	113.9	V28 F30	V28-R32 WeakPolarHBondContact O-CB 3.4Å; V28-R32 VanDerWaalsContact O-CG 3.27Å; V28-R32 WeakPolarHBondContact O-CG 3.44Å; V28-R32 PolarHBondContact O-N 3.46Å; F30-R32 PolarHBondContact O-N 3Å
33	C	98.3	Very high	96.9	Very high	8 Å²	8	94.7 Å²	94.7	5%	0.054	47%	0.472	C	S	.	.	H	α-helix	trans	-106	-31	-168.8	-67.8	0	0	0	0	113.5	C29 F30 S35 E46 C49 V50	C29-C33 WeakPolarHBondContact O-CB 3.49Å; C29-C33 PolarHBondContact O-N 3.47Å; F30-C33 PolarHBondContact O-N 3.31Å; C33-S35 PolarHBondContact O-N 3.14Å; C33-E46 WeakPolarHBondContact O-CG 3.24Å; C33-C49 WeakPolarHBondContact CA-SG 3.42Å; C33-C49 HydrophobicContact CB-CB 3.57Å; C33-C49 WeakPolarHBondContact CB-SG 3.28Å; C33-C49 WeakPolarHBondContact SG-CB 3.21Å; C33-C49 PolarHBondContact SG-O 3.4Å; C33-C49 CovalentContact SG-SG 2.05Å; C33-C49 PolarHBondContact SG-SG 3.2Å; C33-V50 HydrophobicContact CB-CG2 3.73Å
34	V	97.5	Very high	96.8	Very high	18 Å²	18	97.4 Å²	97.4	11%	0.109	48%	0.484	C	S	.	.			trans	-94.1	104.9	-176.7	-172.9	0	0	0	0	108.9	F30 F37 L42	F30-V34 HydrophobicContact CD2-CB 3.92Å; F30-V34 HydrophobicContact CD2-CG1 4.35Å; F30-V34 HydrophobicContact CD2-CG2 3.68Å; F30-V34 HydrophobicContact CE2-CB 3.91Å; F30-V34 HydrophobicContact CE2-CG1 3.85Å; F30-V34 HydrophobicContact CE2-CG2 4.03Å; F30-V34 HydrophobicContact CG-CB 4.47Å; F30-V34 HydrophobicContact CG-CG2 4.4Å; F30-V34 HydrophobicContact CZ-CB 4.45Å; F30-V34 HydrophobicContact CZ-CG1 4.31Å; F30-V34 WeakPolarHBondContact O-CB 3.34Å; F30-V34 PolarHBondContact O-N 2.91Å; V34-F37 HydrophobicContact CG1-CE1 4.04Å; V34-F37 HydrophobicContact CG1-CZ 4.22Å; V34-L42 HydrophobicContact CG1-CD2 4.13Å; V34-L42 HydrophobicContact CG2-CD2 3.67Å
35	S	94.1	Very high	96.8	Very high	99 Å²	99	97.4 Å²	97.4	69%	0.692	49%	0.488	S	S	*	.			trans	-126.2	-14.5	-175.4	57	0	0	0	0	113.2	C33 E46	C33-S35 PolarHBondContact O-N 3.14Å; S35-E46 PolarHBondContact N-OE1 3.38Å; S35-E46 VanDerWaalsContact N-OE1 3.15Å
36	N	93.3	Very high	96.8	Very high	71 Å²	71	96.9 Å²	96.9	38%	0.38	48%	0.484	S	S	.	.			trans	-110.6	111	-178.3	-177	0.4	0	0	0	111	T38 E46	N36-T38 PolarHBondContact ND2-OG1 3.41Å; N36-T38 WeakPolarHBondContact OD1-CB 3.26Å; N36-T38 VanDerWaalsContact OD1-CG2 3.29Å; N36-T38 WeakPolarHBondContact OD1-CG2 3.41Å; N36-T38 PolarHBondContact OD1-N 2.8Å; N36-T38 VanDerWaalsContact OD1-N 3.1Å; N36-T38 PolarHBondContact OD1-OG1 2.95Å; N36-E46 PolarHBondContact N-OE1 3Å; N36-E46 VanDerWaalsContact N-OE1 3.09Å
37	F	96	Very high	96.7	Very high	152 Å²	152	97 Å²	97	67%	0.667	48%	0.482	S	S	*	.			trans	-101	24.4	-177.4	-60.4	-82.8	0	0	0	113.6	F30 V34	F30-F37 HydrophobicContact CZ-CE1 4.04Å; F30-F37 HydrophobicContact CZ-CZ 4.37Å; V34-F37 HydrophobicContact CG1-CE1 4.04Å; V34-F37 HydrophobicContact CG1-CZ 4.22Å
38	T	95.8	Very high	96.7	Very high	125 Å²	125	98.6 Å²	98.6	77%	0.767	49%	0.485	S	S	*	.	S	Bend	trans	-82.7	-12	178.4	57	0	0	0	0	113.9	N36	N36-T38 PolarHBondContact ND2-OG1 3.41Å; N36-T38 WeakPolarHBondContact OD1-CB 3.26Å; N36-T38 VanDerWaalsContact OD1-CG2 3.29Å; N36-T38 WeakPolarHBondContact OD1-CG2 3.41Å; N36-T38 PolarHBondContact OD1-N 2.8Å; N36-T38 VanDerWaalsContact OD1-N 3.1Å; N36-T38 PolarHBondContact OD1-OG1 2.95Å
39	S	95.1	Very high	96.8	Very high	76 Å²	76	98.8 Å²	98.8	53%	0.531	49%	0.487	S	S	.	.	S	Bend	trans	-135.1	154.7	178.6	175.2	0	0	0	0	110.8	K41	S39-K41 VanDerWaalsContact C-N 3.29Å; S39-K41 PolarHBondContact OG-N 3.38Å; S39-K41 VanDerWaalsContact OG-N 3.14Å; S39-K41 PolarHBondContact OG-O 2.95Å
40	R	95.7	Very high	96.7	Very high	258 Å²	258	100.5 Å²	100.5	97%	0.974	50%	0.497	S	S	*	.	S	Bend	trans	-77.8	-13.8	172.3	-67.5	-175	175.2	-162.1	-1.4	113.5
41	K	96.3	Very high	96.8	Very high	171 Å²	171	100.4 Å²	100.4	74%	0.743	50%	0.502	S	S	*	.	S	Bend	trans	-108.4	141.5	179.6	-64.3	-175.7	179.3	-177.3	0	109.3	S39	S39-K41 VanDerWaalsContact C-N 3.29Å; S39-K41 PolarHBondContact OG-N 3.38Å; S39-K41 VanDerWaalsContact OG-N 3.14Å; S39-K41 PolarHBondContact OG-O 2.95Å
42	L	96.4	Very high	96.8	Very high	83 Å²	83	100.4 Å²	100.4	44%	0.435	50%	0.496	S	S	.	.			trans	-58.8	138.2	168.3	-62	180	0	0	0	109.4	V34 E46	V34-L42 HydrophobicContact CG1-CD2 4.13Å; V34-L42 HydrophobicContact CG2-CD2 3.67Å; L42-E46 HydrophobicContact CB-CB 4.22Å; L42-E46 HydrophobicContact CD2-CB 4.1Å
43	N	95.8	Very high	96.8	Very high	58 Å²	58	92 Å²	92	31%	0.31	47%	0.467	S	S	.	.			trans	-80.2	170.8	168.4	68.4	63.5	0	0	0	110.8	K45 E46 T47	N43-K45 VanDerWaalsContact C-N 3.27Å; N43-K45 PolarHBondContact O-N 2.89Å; N43-K45 WeakPolarHBondContact OD1-CA 3.4Å; N43-K45 WeakPolarHBondContact OD1-CB 3.44Å; N43-K45 PolarHBondContact OD1-N 3.4Å; N43-E46 PolarHBondContact N-OE2 3.36Å; N43-E46 VanDerWaalsContact N-OE2 3.14Å; N43-E46 WeakPolarHBondContact ND2-CG 3.2Å; N43-E46 PolarHBondContact ND2-OE2 3.43Å; N43-E46 PolarHBondContact O-N 3.08Å; N43-E46 PolarHBondContact OD1-N 2.85Å; N43-T47 PolarHBondContact O-N 2.99Å; N43-T47 PolarHBondContact O-OG1 3.24Å
44	D	97	Very high	96.8	Very high	145 Å²	145	94.3 Å²	94.3	78%	0.775	48%	0.481	S	S	*	.	H	α-helix	trans	-59.8	-36.6	-176.1	-60.1	-22.1	0	0	0	112.7	T47 E48	D44-T47 PolarHBondContact O-N 2.8Å; D44-E48 WeakPolarHBondContact O-CB 3.41Å; D44-E48 PolarHBondContact O-N 3.49Å
45	K	96.9	Very high	96.9	Very high	172 Å²	172	98.5 Å²	98.5	75%	0.748	50%	0.499	S	S	*	.	H	α-helix	trans	-69.5	-40.3	178.2	-62.8	-176.3	177.7	-179.5	0	112.1	N43 T47 C49	N43-K45 VanDerWaalsContact C-N 3.27Å; N43-K45 PolarHBondContact O-N 2.89Å; N43-K45 WeakPolarHBondContact OD1-CA 3.4Å; N43-K45 WeakPolarHBondContact OD1-CB 3.44Å; N43-K45 PolarHBondContact OD1-N 3.4Å; K45-T47 VanDerWaalsContact C-N 3.35Å; K45-C49 VanDerWaalsContact O-CB 3.31Å; K45-C49 WeakPolarHBondContact O-CB 3.05Å; K45-C49 PolarHBondContact O-N 3.39Å
46	E	97.8	Very high	97.1	Very high	10 Å²	10	101.1 Å²	101.1	5%	0.047	50%	0.498	C	S	.	.	H	α-helix	trans	-66.5	-41.1	176.3	-66.7	177.1	137.2	0	0	110.5	C33 S35 N36 L42 N43 C49 V50	C33-E46 WeakPolarHBondContact O-CG 3.24Å; S35-E46 PolarHBondContact N-OE1 3.38Å; S35-E46 VanDerWaalsContact N-OE1 3.15Å; N36-E46 PolarHBondContact N-OE1 3Å; N36-E46 VanDerWaalsContact N-OE1 3.09Å; L42-E46 HydrophobicContact CB-CB 4.22Å; L42-E46 HydrophobicContact CD2-CB 4.1Å; N43-E46 PolarHBondContact N-OE2 3.36Å; N43-E46 VanDerWaalsContact N-OE2 3.14Å; N43-E46 WeakPolarHBondContact ND2-CG 3.2Å; N43-E46 PolarHBondContact ND2-OE2 3.43Å; N43-E46 PolarHBondContact O-N 3.08Å; N43-E46 PolarHBondContact OD1-N 2.85Å; E46-C49 WeakPolarHBondContact O-CB 3.46Å; E46-C49 PolarHBondContact O-N 2.96Å; E46-V50 WeakPolarHBondContact O-CG2 3.27Å; E46-V50 PolarHBondContact O-N 3.47Å
47	T	97.3	Very high	97.3	Very high	57 Å²	57	98.9 Å²	98.9	35%	0.35	49%	0.485	S	S	.	.	H	α-helix	trans	-61	-51.6	176.1	-53.8	0	0	0	0	111.1	N43 D44 K45 C49 V50 D51	N43-T47 PolarHBondContact O-N 2.99Å; N43-T47 PolarHBondContact O-OG1 3.24Å; D44-T47 PolarHBondContact O-N 2.8Å; K45-T47 VanDerWaalsContact C-N 3.35Å; T47-C49 VanDerWaalsContact C-N 3.27Å; T47-C49 PolarHBondContact O-N 2.93Å; T47-V50 PolarHBondContact O-N 3.24Å; T47-V50 VanDerWaalsContact O-N 3.13Å; T47-D51 PolarHBondContact O-N 2.9Å
48	E	98.3	Very high	97.4	Very high	105 Å²	105	93.9 Å²	93.9	49%	0.491	47%	0.472	S	S	.	.	H	α-helix	trans	-59.6	-37.6	176.6	-173.1	-173.1	177.6	0	0	112.1	D44 K52	D44-E48 WeakPolarHBondContact O-CB 3.41Å; D44-E48 PolarHBondContact O-N 3.49Å; E48-K52 HydrophobicContact CG-CD 4.45Å; E48-K52 WeakPolarHBondContact O-CG 3.45Å; E48-K52 PolarHBondContact O-N 3.06Å; E48-K52 VanDerWaalsContact O-N 3.13Å; E48-K52 VanDerWaalsContact OE1-CE 3.3Å; E48-K52 WeakPolarHBondContact OE1-CE 3.05Å; E48-K52 IonicContact OE1-NZ 2.73Å; E48-K52 PolarHBondContact OE1-NZ 3.46Å
49	C	98.5	Very high	97.5	Very high	47 Å²	47	93.6 Å²	93.6	32%	0.318	46%	0.46	S	S	.	.	H	α-helix	trans	-64.4	-45.2	175.4	-177.5	0	0	0	0	111.7	C33 K45 E46 T47 D51 K52 C53	C33-C49 WeakPolarHBondContact CA-SG 3.42Å; C33-C49 HydrophobicContact CB-CB 3.57Å; C33-C49 WeakPolarHBondContact CB-SG 3.28Å; C33-C49 WeakPolarHBondContact SG-CB 3.21Å; C33-C49 PolarHBondContact SG-O 3.4Å; C33-C49 CovalentContact SG-SG 2.05Å; C33-C49 PolarHBondContact SG-SG 3.2Å; K45-C49 VanDerWaalsContact O-CB 3.31Å; K45-C49 WeakPolarHBondContact O-CB 3.05Å; K45-C49 PolarHBondContact O-N 3.39Å; E46-C49 WeakPolarHBondContact O-CB 3.46Å; E46-C49 PolarHBondContact O-N 2.96Å; T47-C49 VanDerWaalsContact C-N 3.27Å; T47-C49 PolarHBondContact O-N 2.93Å; C49-D51 VanDerWaalsContact C-N 3.34Å; C49-D51 PolarHBondContact O-N 2.9Å; C49-K52 PolarHBondContact O-N 3.08Å; C49-C53 WeakPolarHBondContact O-CB 3.47Å; C49-C53 PolarHBondContact O-N 2.98Å
50	V	98.3	Very high	97.6	Very high	38 Å²	38	94.3 Å²	94.3	23%	0.23	46%	0.456	C	S	.	.	H	α-helix	trans	-62	-42.4	179.2	170.5	0	0	0	0	110.8	C33 E46 T47 K52 C53 T54	C33-V50 HydrophobicContact CB-CG2 3.73Å; E46-V50 WeakPolarHBondContact O-CG2 3.27Å; E46-V50 PolarHBondContact O-N 3.47Å; T47-V50 PolarHBondContact O-N 3.24Å; T47-V50 VanDerWaalsContact O-N 3.13Å; V50-K52 PolarHBondContact O-N 3.34Å; V50-C53 PolarHBondContact O-N 3.46Å; V50-T54 HydrophobicContact CG1-CG2 4.28Å; V50-T54 VanDerWaalsContact O-CG2 3.31Å; V50-T54 WeakPolarHBondContact O-CG2 3Å; V50-T54 PolarHBondContact O-N 3.04Å; V50-T54 PolarHBondContact O-OG1 3.45Å; V50-T54 VanDerWaalsContact O-OG1 3.07Å
51	D	98.3	Very high	97.6	Very high	103 Å²	103	83.6 Å²	83.6	55%	0.551	42%	0.418	S	S	*	.	H	α-helix	trans	-59.7	-48.6	176.1	-70.7	-21.3	0	0	0	111.5	T47 C49 C53 T54 E55	T47-D51 PolarHBondContact O-N 2.9Å; C49-D51 VanDerWaalsContact C-N 3.34Å; C49-D51 PolarHBondContact O-N 2.9Å; D51-C53 VanDerWaalsContact C-N 3.34Å; D51-C53 PolarHBondContact O-N 3.49Å; D51-T54 PolarHBondContact O-OG1 3.45Å; D51-E55 PolarHBondContact O-N 2.98Å; D51-E55 VanDerWaalsContact O-N 3.16Å
52	K	98.5	Very high	97.6	Very high	120 Å²	120	81.7 Å²	81.7	52%	0.522	41%	0.412	S	S	.	.	H	α-helix	trans	-65.3	-37.7	176.5	-70	175.8	-173.9	170.9	0	112.5	E48 C49 V50 K56	E48-K52 HydrophobicContact CG-CD 4.45Å; E48-K52 WeakPolarHBondContact O-CG 3.45Å; E48-K52 PolarHBondContact O-N 3.06Å; E48-K52 VanDerWaalsContact O-N 3.13Å; E48-K52 VanDerWaalsContact OE1-CE 3.3Å; E48-K52 WeakPolarHBondContact OE1-CE 3.05Å; E48-K52 IonicContact OE1-NZ 2.73Å; E48-K52 PolarHBondContact OE1-NZ 3.46Å; C49-K52 PolarHBondContact O-N 3.08Å; V50-K52 PolarHBondContact O-N 3.34Å; K52-K56 VanDerWaalsContact O-CB 3.25Å; K52-K56 WeakPolarHBondContact O-CB 3.39Å; K52-K56 PolarHBondContact O-N 3.23Å
53	C	98.7	Very high	97.7	Very high	17 Å²	17	87.2 Å²	87.2	12%	0.115	43%	0.427	C	S	.	.	H	α-helix	trans	-64.8	-47.7	-179.9	176.7	0	0	0	0	111.1	C29 C49 V50 D51 K56 F57	C29-C53 WeakPolarHBondContact CA-SG 3.5Å; C29-C53 HydrophobicContact CB-CB 3.82Å; C29-C53 WeakPolarHBondContact CB-SG 3.46Å; C29-C53 WeakPolarHBondContact SG-CB 3.4Å; C29-C53 CovalentContact SG-SG 2.05Å; C29-C53 PolarHBondContact SG-SG 2.91Å; C49-C53 WeakPolarHBondContact O-CB 3.47Å; C49-C53 PolarHBondContact O-N 2.98Å; V50-C53 PolarHBondContact O-N 3.46Å; D51-C53 VanDerWaalsContact C-N 3.34Å; D51-C53 PolarHBondContact O-N 3.49Å; C53-K56 PolarHBondContact O-N 2.88Å; C53-F57 VanDerWaalsContact O-CB 3.27Å; C53-F57 WeakPolarHBondContact O-CB 3.45Å; C53-F57 PolarHBondContact O-N 2.95Å
54	T	98.2	Very high	97.8	Very high	56 Å²	56	89.2 Å²	89.2	34%	0.344	44%	0.437	S	S	.	.	H	α-helix	trans	-64.3	-43.2	-179.7	54.8	0	0	0	0	111.5	V50 D51 K56 F57 A58	V50-T54 HydrophobicContact CG1-CG2 4.28Å; V50-T54 VanDerWaalsContact O-CG2 3.31Å; V50-T54 WeakPolarHBondContact O-CG2 3Å; V50-T54 PolarHBondContact O-N 3.04Å; V50-T54 PolarHBondContact O-OG1 3.45Å; V50-T54 VanDerWaalsContact O-OG1 3.07Å; D51-T54 PolarHBondContact O-OG1 3.45Å; T54-K56 PolarHBondContact O-N 2.97Å; T54-F57 PolarHBondContact O-N 3.39Å; T54-A58 WeakPolarHBondContact O-CB 3.37Å; T54-A58 PolarHBondContact O-N 2.96Å
55	E	98.2	Very high	97.7	Very high	106 Å²	106	85.5 Å²	85.5	50%	0.495	42%	0.42	S	S	.	.	H	α-helix	trans	-60.2	-47.4	174.7	-172.3	-172.3	-179.9	0	0	111.6	D51 F57 A58 K59	D51-E55 PolarHBondContact O-N 2.98Å; D51-E55 VanDerWaalsContact O-N 3.16Å; E55-F57 PolarHBondContact O-N 3.19Å; E55-A58 PolarHBondContact O-N 2.93Å; E55-K59 HydrophobicContact CG-CD 4.38Å; E55-K59 WeakPolarHBondContact O-CG 3.21Å; E55-K59 PolarHBondContact O-N 3.18Å; E55-K59 VanDerWaalsContact OE1-CE 3.24Å; E55-K59 WeakPolarHBondContact OE1-CE 3.33Å; E55-K59 IonicContact OE1-NZ 3.68Å; E55-K59 PolarHBondContact OE1-NZ 3.43Å
56	K	98.5	Very high	97.7	Very high	153 Å²	153	82.7 Å²	82.7	67%	0.665	41%	0.412	S	S	*	.	H	α-helix	trans	-64.6	-40.9	179	-173.7	173.7	-178.2	175.6	0	111.8	K52 C53 T54 M60	K52-K56 VanDerWaalsContact O-CB 3.25Å; K52-K56 WeakPolarHBondContact O-CB 3.39Å; K52-K56 PolarHBondContact O-N 3.23Å; C53-K56 PolarHBondContact O-N 2.88Å; T54-K56 PolarHBondContact O-N 2.97Å; K56-M60 VanDerWaalsContact O-CB 3.23Å; K56-M60 WeakPolarHBondContact O-CB 3.27Å; K56-M60 PolarHBondContact O-N 2.05Å
57	F	98.3	Very high	97.7	Very high	24 Å²	24	87.7 Å²	87.7	11%	0.105	43%	0.431	C	S	.	.	H	α-helix	trans	-62	-45.8	177	-176.3	-90.3	0	0	0	110.8	R24 C25 V28 C53 T54 E55 M60 N61	R24-F57 HydrophobicContact CB-CZ 4.31Å; R24-F57 HydrophobicContact CG-CE2 4.29Å; R24-F57 HydrophobicContact CG-CZ 4.04Å; C25-F57 HydrophobicContact CB-CD1 3.54Å; C25-F57 HydrophobicContact CB-CE1 3.46Å; C25-F57 VanDerWaalsContact CB-CE1 3.46Å; C25-F57 HydrophobicContact CB-CG 4.2Å; C25-F57 HydrophobicContact CB-CZ 4.07Å; C25-F57 WeakPolarHBondContact SG-CD1 3.44Å; V28-F57 HydrophobicContact CG1-CD2 4.49Å; V28-F57 HydrophobicContact CG2-CE2 4.45Å; C53-F57 VanDerWaalsContact O-CB 3.27Å; C53-F57 WeakPolarHBondContact O-CB 3.45Å; C53-F57 PolarHBondContact O-N 2.95Å; T54-F57 PolarHBondContact O-N 3.39Å; E55-F57 PolarHBondContact O-N 3.19Å; F57-M60 HydrophobicContact CD2-CE 4.2Å; F57-M60 HydrophobicContact CE2-CE 4.32Å; F57-M60 PolarHBondContact O-N 2.8Å; F57-N61 WeakPolarHBondContact CD1-ND2 3.23Å; F57-N61 WeakPolarHBondContact CE1-ND2 3.41Å; F57-N61 WeakPolarHBondContact CZ-ND2 3.29Å; F57-N61 PolarHBondContact O-N 2.92Å; F57-N61 PolarHBondContact O-ND2 2.94Å
58	A	96.9	Very high	97.6	Very high	47 Å²	47	89.5 Å²	89.5	39%	0.388	44%	0.437	S	S	.	.	H	α-helix	trans	-61.1	-50.5	178	0	0	0	0	0	111.9	T54 E55 M60 N61 Q62	T54-A58 WeakPolarHBondContact O-CB 3.37Å; T54-A58 PolarHBondContact O-N 2.96Å; E55-A58 PolarHBondContact O-N 2.93Å; A58-M60 VanDerWaalsContact C-N 3.31Å; A58-M60 PolarHBondContact O-N 3.5Å; A58-N61 PolarHBondContact O-N 3.38Å; A58-Q62 WeakPolarHBondContact O-CG 3.47Å; A58-Q62 PolarHBondContact O-N 3.1Å
59	K	98.1	Very high	97.5	Very high	120 Å²	120	90.9 Å²	90.9	52%	0.522	44%	0.442	S	S	.	.	H	α-helix	trans	-60.8	-40	177.6	-70.8	179.2	-175.6	173.8	0	112.3	E55 R63	E55-K59 HydrophobicContact CG-CD 4.38Å; E55-K59 WeakPolarHBondContact O-CG 3.21Å; E55-K59 PolarHBondContact O-N 3.18Å; E55-K59 VanDerWaalsContact OE1-CE 3.24Å; E55-K59 WeakPolarHBondContact OE1-CE 3.33Å; E55-K59 IonicContact OE1-NZ 3.68Å; E55-K59 PolarHBondContact OE1-NZ 3.43Å; K59-R63 WeakPolarHBondContact O-CB 3.31Å; K59-R63 PolarHBondContact O-N 3.09Å
60	M	97.6	Very high	97.3	Very high	90 Å²	90	93.2 Å²	93.2	44%	0.443	45%	0.448	S	S	.	.	H	α-helix	trans	-62.4	-48.7	176.2	-178.8	-163.5	75	0	0	111.1	K56 F57 A58 Q62 R63 L64	K56-M60 VanDerWaalsContact O-CB 3.23Å; K56-M60 WeakPolarHBondContact O-CB 3.27Å; K56-M60 PolarHBondContact O-N 2.05Å; F57-M60 HydrophobicContact CD2-CE 4.2Å; F57-M60 HydrophobicContact CE2-CE 4.32Å; F57-M60 PolarHBondContact O-N 2.8Å; A58-M60 VanDerWaalsContact C-N 3.31Å; A58-M60 PolarHBondContact O-N 3.5Å; M60-Q62 PolarHBondContact O-N 3.35Å; M60-R63 PolarHBondContact O-N 3.33Å; M60-L64 HydrophobicContact CE-CD1 4.14Å; M60-L64 HydrophobicContact CG-CD1 3.99Å; M60-L64 HydrophobicContact CG-CG 4.38Å; M60-L64 WeakPolarHBondContact O-CG 3.2Å; M60-L64 PolarHBondContact O-N 3.37Å; M60-L64 HydrophobicContact SD-CD1 4.41Å
61	N	96.4	Very high	97.2	Very high	33 Å²	33	95 Å²	95	18%	0.176	46%	0.457	C	S	.	.	H	α-helix	trans	-60.9	-45.9	179.2	-82	-83.3	0	0	0	111.3	L21 F57 A58 R63 L64 T65	L21-N61 WeakPolarHBondContact CD2-OD1 3.31Å; F57-N61 WeakPolarHBondContact CD1-ND2 3.23Å; F57-N61 WeakPolarHBondContact CE1-ND2 3.41Å; F57-N61 WeakPolarHBondContact CZ-ND2 3.29Å; F57-N61 PolarHBondContact O-N 2.92Å; F57-N61 PolarHBondContact O-ND2 2.94Å; A58-N61 PolarHBondContact O-N 3.38Å; N61-R63 VanDerWaalsContact C-N 3.31Å; N61-R63 PolarHBondContact O-N 3.04Å; N61-L64 PolarHBondContact O-N 3.38Å; N61-T65 PolarHBondContact O-N 2.93Å; N61-T65 PolarHBondContact O-OG1 2.05Å; N61-T65 VanDerWaalsContact O-OG1 3.06Å
62	Q	96.4	Very high	97.1	Very high	132 Å²	132	94 Å²	94	62%	0.617	45%	0.451	S	S	*	.	H	α-helix	trans	-55.4	-46.1	175.1	-72.9	174	-17.3	0	0	112.1	A58 M60 T65 L66	A58-Q62 WeakPolarHBondContact O-CG 3.47Å; A58-Q62 PolarHBondContact O-N 3.1Å; M60-Q62 PolarHBondContact O-N 3.35Å; Q62-T65 PolarHBondContact O-N 3.49Å; Q62-L66 WeakPolarHBondContact O-CG 3.01Å; Q62-L66 PolarHBondContact O-N 2.65Å; Q62-L66 VanDerWaalsContact O-N 3.08Å
63	R	98.2	Very high	96.8	Very high	198 Å²	198	97.4 Å²	97.4	75%	0.747	46%	0.461	S	S	*	.	H	α-helix	trans	-65.7	-40.8	178.8	-173.4	172.8	-176	-96.9	-0.6	112.6	K59 M60 N61 L66 R67	K59-R63 WeakPolarHBondContact O-CB 3.31Å; K59-R63 PolarHBondContact O-N 3.09Å; M60-R63 PolarHBondContact O-N 3.33Å; N61-R63 VanDerWaalsContact C-N 3.31Å; N61-R63 PolarHBondContact O-N 3.04Å; R63-L66 PolarHBondContact O-N 3.25Å; R63-R67 PolarHBondContact O-N 3.48Å
64	L	97	Very high	96.5	Very high	100 Å²	100	101.2 Å²	101.2	52%	0.524	48%	0.477	S	S	.	.	H	α-helix	trans	-63.8	-42.7	176.6	-73.1	173.5	0	0	0	111.2	M60 N61 L66 R67 L68	M60-L64 HydrophobicContact CE-CD1 4.14Å; M60-L64 HydrophobicContact CG-CD1 3.99Å; M60-L64 HydrophobicContact CG-CG 4.38Å; M60-L64 WeakPolarHBondContact O-CG 3.2Å; M60-L64 PolarHBondContact O-N 3.37Å; M60-L64 HydrophobicContact SD-CD1 4.41Å; N61-L64 PolarHBondContact O-N 3.38Å; L64-L66 PolarHBondContact O-N 3.15Å; L64-R67 PolarHBondContact O-N 3.48Å; L64-L68 WeakPolarHBondContact O-CB 3.09Å; L64-L68 PolarHBondContact O-N 3.07Å
65	T	95.5	Very high	96.2	Very high	68 Å²	68	103.3 Å²	103.3	42%	0.417	48%	0.482	S	S	.	.	H	α-helix	trans	-59.9	-46	176.3	-62.5	0	0	0	0	111.7	N61 Q62 R67 L68 F69	N61-T65 PolarHBondContact O-N 2.93Å; N61-T65 PolarHBondContact O-OG1 2.05Å; N61-T65 VanDerWaalsContact O-OG1 3.06Å; Q62-T65 PolarHBondContact O-N 3.49Å; T65-R67 PolarHBondContact O-N 2.91Å; T65-L68 PolarHBondContact O-N 3.25Å; T65-F69 HydrophobicContact CG2-CD2 3.87Å; T65-F69 HydrophobicContact CG2-CE2 3.34Å; T65-F69 HydrophobicContact CG2-CZ 4.12Å; T65-F69 WeakPolarHBondContact O-CD2 3.45Å; T65-F69 PolarHBondContact O-N 3.16Å
66	L	96.8	Very high	95.7	Very high	112 Å²	112	104 Å²	104	59%	0.586	49%	0.489	S	S	*	.	H	α-helix	trans	-59.2	-47.1	175.4	-70.3	172.5	0	0	0	111.6	Q62 R63 L64 L68 F69 E70	Q62-L66 WeakPolarHBondContact O-CG 3.01Å; Q62-L66 PolarHBondContact O-N 2.65Å; Q62-L66 VanDerWaalsContact O-N 3.08Å; R63-L66 PolarHBondContact O-N 3.25Å; L64-L66 PolarHBondContact O-N 3.15Å; L66-L68 VanDerWaalsContact C-N 3.31Å; L66-L68 PolarHBondContact O-N 3.33Å; L66-F69 PolarHBondContact O-N 3.44Å; L66-E70 WeakPolarHBondContact O-CG 3.25Å; L66-E70 PolarHBondContact O-N 2.6Å; L66-E70 VanDerWaalsContact O-N 3.09Å
67	R	97.7	Very high	95.3	Very high	116 Å²	116	102.4 Å²	102.4	44%	0.438	49%	0.492	S	S	.	.	H	α-helix	trans	-65.6	-35.3	179.8	-172.3	56.6	-178	161.7	10.4	112.3	R63 L64 T65 E70 L71	R63-R67 PolarHBondContact O-N 3.48Å; L64-R67 PolarHBondContact O-N 3.48Å; T65-R67 PolarHBondContact O-N 2.91Å; R67-E70 WeakPolarHBondContact CD-OE2 3.41Å; R67-E70 IonicContact CZ-OE2 2.66Å; R67-E70 IonicContact NE-OE2 2.61Å; R67-E70 IonicContact NH1-OE2 2.6Å; R67-E70 PolarHBondContact NH1-OE2 3.14Å; R67-E70 PolarHBondContact O-N 3.34Å; R67-L71 HydrophobicContact CG-CD1 4.22Å; R67-L71 HydrophobicContact CG-CG 4.49Å; R67-L71 VanDerWaalsContact O-CG 3.3Å; R67-L71 WeakPolarHBondContact O-CG 3.44Å; R67-L71 PolarHBondContact O-N 3.39Å
68	L	96	Very high	94.6	Very high	94 Å²	94	108.3 Å²	108.3	49%	0.492	52%	0.517	S	S	.	.	H	α-helix	trans	-62.6	-43.6	175.1	179.7	61.6	0	0	0	111.1	L64 T65 L66 E70 L71 N72	L64-L68 WeakPolarHBondContact O-CB 3.09Å; L64-L68 PolarHBondContact O-N 3.07Å; T65-L68 PolarHBondContact O-N 3.25Å; L66-L68 VanDerWaalsContact C-N 3.31Å; L66-L68 PolarHBondContact O-N 3.33Å; L68-E70 PolarHBondContact O-N 2.79Å; L68-L71 PolarHBondContact O-N 2.99Å; L68-N72 WeakPolarHBondContact O-CB 3.49Å; L68-N72 PolarHBondContact O-N 3.49Å; L68-N72 PolarHBondContact O-ND2 3.29Å; L68-N72 PolarHBondContact O-OD1 2.92Å
69	F	95.2	Very high	92.9	Very high	135 Å²	135	116 Å²	116	59%	0.592	55%	0.545	S	S	*	.	H	α-helix	trans	-63.9	-39.7	176.1	-71.7	-52.7	0	0	0	113.1	T65 L66 R73	T65-F69 HydrophobicContact CG2-CD2 3.87Å; T65-F69 HydrophobicContact CG2-CE2 3.34Å; T65-F69 HydrophobicContact CG2-CZ 4.12Å; T65-F69 WeakPolarHBondContact O-CD2 3.45Å; T65-F69 PolarHBondContact O-N 3.16Å; L66-F69 PolarHBondContact O-N 3.44Å; F69-R73 WeakPolarHBondContact O-CB 3.34Å; F69-R73 PolarHBondContact O-N 3.19Å
70	E	95.6	Very high	92.7	Very high	95 Å²	95	115.8 Å²	115.8	44%	0.444	55%	0.546	S	S	.	.	H	α-helix	trans	-59.7	-50.6	174.1	-69.7	169.5	-178.1	0	0	111.2	L66 R67 L68 N72 R73 E74	L66-E70 WeakPolarHBondContact O-CG 3.25Å; L66-E70 PolarHBondContact O-N 2.6Å; L66-E70 VanDerWaalsContact O-N 3.09Å; R67-E70 WeakPolarHBondContact CD-OE2 3.41Å; R67-E70 IonicContact CZ-OE2 2.66Å; R67-E70 IonicContact NE-OE2 2.61Å; R67-E70 IonicContact NH1-OE2 2.6Å; R67-E70 PolarHBondContact NH1-OE2 3.14Å; R67-E70 PolarHBondContact O-N 3.34Å; L68-E70 PolarHBondContact O-N 2.79Å; E70-N72 PolarHBondContact O-N 2.93Å; E70-R73 WeakPolarHBondContact O-CB 3.46Å; E70-R73 PolarHBondContact O-N 3.27Å; E70-E74 WeakPolarHBondContact O-CG 3.24Å; E70-E74 PolarHBondContact O-N 3.04Å
71	L	96.1	Very high	92.4	Very high	77 Å²	77	117.2 Å²	117.2	40%	0.403	55%	0.552	S	S	.	*	H	α-helix	trans	-63.1	-42	-179.9	-70.1	172.2	0	0	0	112.3	R67 L68 R73 E74 E75	R67-L71 HydrophobicContact CG-CD1 4.22Å; R67-L71 HydrophobicContact CG-CG 4.49Å; R67-L71 VanDerWaalsContact O-CG 3.3Å; R67-L71 WeakPolarHBondContact O-CG 3.44Å; R67-L71 PolarHBondContact O-N 3.39Å; L68-L71 PolarHBondContact O-N 2.99Å; L71-R73 VanDerWaalsContact C-N 3.28Å; L71-R73 PolarHBondContact O-N 2.93Å; L71-E74 PolarHBondContact O-N 3.14Å; L71-E75 WeakPolarHBondContact O-CB 3.41Å; L71-E75 PolarHBondContact O-N 3.13Å
72	N	94.7	Very high	92.2	Very high	82 Å²	82	121.8 Å²	121.8	44%	0.439	57%	0.573	S	S	.	*	H	α-helix	trans	-62.8	-37.7	177	-71.6	-11.2	0	0	0	111.5	L68 E70 E75 L76	L68-N72 WeakPolarHBondContact O-CB 3.49Å; L68-N72 PolarHBondContact O-N 3.49Å; L68-N72 PolarHBondContact O-ND2 3.29Å; L68-N72 PolarHBondContact O-OD1 2.92Å; E70-N72 PolarHBondContact O-N 2.93Å; N72-E75 PolarHBondContact O-N 2.94Å; N72-L76 WeakPolarHBondContact O-CG 3.41Å; N72-L76 PolarHBondContact O-N 3.45Å; N72-L76 VanDerWaalsContact O-N 3.12Å
73	R	92.7	Very high	92	Very high	191 Å²	191	121.2 Å²	121.2	72%	0.721	57%	0.57	S	S	*	*	H	α-helix	trans	-66.7	-44.4	175.2	-173.8	-172.8	-66	-175.1	-1.3	111.6	F69 E70 L71 E75 L76 V77	F69-R73 WeakPolarHBondContact O-CB 3.34Å; F69-R73 PolarHBondContact O-N 3.19Å; E70-R73 WeakPolarHBondContact O-CB 3.46Å; E70-R73 PolarHBondContact O-N 3.27Å; L71-R73 VanDerWaalsContact C-N 3.28Å; L71-R73 PolarHBondContact O-N 2.93Å; R73-E75 VanDerWaalsContact C-N 3.27Å; R73-E75 PolarHBondContact O-N 2.99Å; R73-L76 PolarHBondContact O-N 3.13Å; R73-V77 WeakPolarHBondContact O-CG2 3.3Å; R73-V77 PolarHBondContact O-N 2.94Å
74	E	92.2	Very high	91.6	Very high	97 Å²	97	116.4 Å²	116.4	45%	0.453	56%	0.559	S	S	.	*	H	α-helix	trans	-59.9	-39.4	176.5	-72.6	173.1	-168.5	0	0	111.6	E70 L71 V77	E70-E74 WeakPolarHBondContact O-CG 3.24Å; E70-E74 PolarHBondContact O-N 3.04Å; L71-E74 PolarHBondContact O-N 3.14Å; E74-V77 PolarHBondContact O-N 3.31Å
75	E	91.8	Very high	91.2	Very high	99 Å²	99	117.5 Å²	117.5	46%	0.463	56%	0.562	S	S	.	*	H	α-helix	trans	-69.7	-38.3	179.9	-163.7	60.9	-165.2	0	0	112.6	L71 N72 R73 V77 K78	L71-E75 WeakPolarHBondContact O-CB 3.41Å; L71-E75 PolarHBondContact O-N 3.13Å; N72-E75 PolarHBondContact O-N 2.94Å; R73-E75 VanDerWaalsContact C-N 3.27Å; R73-E75 PolarHBondContact O-N 2.99Å; E75-V77 PolarHBondContact O-N 2.98Å; E75-K78 PolarHBondContact O-N 2.61Å; E75-K78 VanDerWaalsContact O-N 3.17Å; E75-K78 IonicContact OE2-NZ 3.86Å; E75-K78 PolarHBondContact OE2-NZ 2.96Å
76	L	88.8	Confident	90.9	Very high	121 Å²	121	121.1 Å²	121.1	63%	0.634	57%	0.572	S	S	*	*	H	α-helix	trans	-62.4	-28.8	174.7	-74.6	167	0	0	0	113.2	N72 R73 K78	N72-L76 WeakPolarHBondContact O-CG 3.41Å; N72-L76 PolarHBondContact O-N 3.45Å; N72-L76 VanDerWaalsContact O-N 3.12Å; R73-L76 PolarHBondContact O-N 3.13Å; L76-K78 VanDerWaalsContact C-N 3.31Å
77	V	88.7	Confident	90.5	Very high	119 Å²	119	121.8 Å²	121.8	72%	0.721	57%	0.571	S	S	*	*	H	α-helix	trans	-77.4	-18.2	179	174	0	0	0	0	112.3	R73 E74 E75	R73-V77 WeakPolarHBondContact O-CG2 3.3Å; R73-V77 PolarHBondContact O-N 2.94Å; E74-V77 PolarHBondContact O-N 3.31Å; E75-V77 PolarHBondContact O-N 2.98Å
78	K	84.4	Confident	89.9	Confident	148 Å²	148	122.3 Å²	122.3	64%	0.643	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.6	-13.9	179	-64.9	177.2	-161.8	155.6	0	113.7	E75 L76	E75-K78 PolarHBondContact O-N 2.61Å; E75-K78 VanDerWaalsContact O-N 3.17Å; E75-K78 IonicContact OE2-NZ 3.86Å; E75-K78 PolarHBondContact OE2-NZ 2.96Å; L76-K78 VanDerWaalsContact C-N 3.31Å
79	Q	62	Low	89.3	Confident	209 Å²	209	124.8 Å²	124.8	98%	0.977	59%	0.59	S	S	*	*			trans	-85	0	176.4	-65	-175.8	-9.9	0	0	110.7

Retrieved 79 of 79 residues in 17.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).