G4VLW5_SCHMA Loading...

Hypothetical Schistosoma spp. protein UPF0506

AlphaFold DB , UniProt , Accession G4VLW5, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 96 aa.

						>G4VLW5_SCHMA|G4VLW5
MNQFYYAILMVMIVTFSYFNVVSGECRTVGQECSKTVFSPCCENFYCGLNTLFSGQCQPCLAGGYFCWTDKECCSGKCSWLKCTDPIKDVVERLTG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.9	Low	85.3	Confident	202 Å²	202	128.2 Å²	128.2	100%	0.995	63%	0.627	S	S	*	*				0	-47.7	0	-67.1	-174.9	-64.1	0	0	111.9	Q3 F4	M1-Q3 PolarHBondContact O-N 3.26Å; M1-F4 PolarHBondContact O-N 3.39Å
2	N	77	Confident	85.5	Confident	124 Å²	124	127.9 Å²	127.9	66%	0.663	63%	0.626	S	S	*	*	H	α-helix	trans	-61.1	-35.7	-177.7	-59.9	-5.9	0	0	0	114.7	F4 Y5 Y6	N2-F4 PolarHBondContact O-N 3.39Å; N2-Y5 WeakPolarHBondContact O-CB 3.06Å; N2-Y5 PolarHBondContact O-N 3.45Å; N2-Y6 HydrophobicContact CB-CE2 4.26Å; N2-Y6 WeakPolarHBondContact O-CD2 3.33Å; N2-Y6 PolarHBondContact O-N 3.46Å
3	Q	82.3	Confident	85.7	Confident	166 Å²	166	125.5 Å²	125.5	78%	0.776	62%	0.615	S	S	*	*	H	α-helix	trans	-61.6	-39.9	-179.2	-173.7	175.9	-8.1	0	0	113.4	M1 Y5 Y6 A7	M1-Q3 PolarHBondContact O-N 3.26Å; Q3-Y5 VanDerWaalsContact C-N 3.31Å; Q3-Y5 PolarHBondContact O-N 3.46Å; Q3-Y6 PolarHBondContact O-N 3.31Å; Q3-A7 PolarHBondContact O-N 3.34Å
4	F	85.9	Confident	85.6	Confident	158 Å²	158	122.9 Å²	122.9	69%	0.693	61%	0.61	S	S	*	*	H	α-helix	trans	-66.3	-35.9	177.7	-69.8	-73.2	0	0	0	111.9	M1 N2 A7 I8	M1-F4 PolarHBondContact O-N 3.39Å; N2-F4 PolarHBondContact O-N 3.39Å; F4-A7 PolarHBondContact O-N 3.05Å; F4-I8 WeakPolarHBondContact O-CG1 3.44Å; F4-I8 PolarHBondContact O-N 3.2Å
5	Y	88.7	Confident	85.2	Confident	153 Å²	153	118.7 Å²	118.7	60%	0.6	59%	0.594	S	S	*	*	H	α-helix	trans	-62.9	-44.4	178.4	-176.6	-99.7	0	0	0	111.8	N2 Q3 A7 I8 L9	N2-Y5 WeakPolarHBondContact O-CB 3.06Å; N2-Y5 PolarHBondContact O-N 3.45Å; Q3-Y5 VanDerWaalsContact C-N 3.31Å; Q3-Y5 PolarHBondContact O-N 3.46Å; Y5-A7 VanDerWaalsContact C-N 3.35Å; Y5-A7 PolarHBondContact O-N 3.29Å; Y5-I8 PolarHBondContact O-N 3.07Å; Y5-L9 HydrophobicContact CE1-CD1 3.72Å; Y5-L9 WeakPolarHBondContact O-CB 3.37Å; Y5-L9 PolarHBondContact O-N 3.24Å
6	Y	89.3	Confident	84.8	Confident	158 Å²	158	120 Å²	120	62%	0.62	60%	0.595	S	S	*	*	H	α-helix	trans	-62.8	-40.3	175.9	-68.1	-67.7	0	0	0	112.6	N2 Q3 L9 M10	N2-Y6 HydrophobicContact CB-CE2 4.26Å; N2-Y6 WeakPolarHBondContact O-CD2 3.33Å; N2-Y6 PolarHBondContact O-N 3.46Å; Q3-Y6 PolarHBondContact O-N 3.31Å; Y6-L9 PolarHBondContact O-N 3.32Å; Y6-M10 WeakPolarHBondContact O-CB 3.26Å; Y6-M10 VanDerWaalsContact O-CG 3.26Å; Y6-M10 WeakPolarHBondContact O-CG 3.46Å; Y6-M10 PolarHBondContact O-N 3.42Å
7	A	89.7	Confident	84.2	Confident	56 Å²	56	116.9 Å²	116.9	46%	0.463	59%	0.588	S	S	.	*	H	α-helix	trans	-62.2	-45	177.3	0	0	0	0	0	111.6	Q3 F4 Y5 M10 V11	Q3-A7 PolarHBondContact O-N 3.34Å; F4-A7 PolarHBondContact O-N 3.05Å; Y5-A7 VanDerWaalsContact C-N 3.35Å; Y5-A7 PolarHBondContact O-N 3.29Å; A7-M10 PolarHBondContact O-N 3.46Å; A7-V11 WeakPolarHBondContact O-CG2 3.38Å; A7-V11 PolarHBondContact O-N 2.92Å; A7-V11 VanDerWaalsContact O-N 3.07Å
8	I	90.2	Very high	83.6	Confident	111 Å²	111	119.6 Å²	119.6	57%	0.569	59%	0.591	S	S	*	*	H	α-helix	trans	-63.4	-43.9	176.9	-65.7	167.2	0	0	0	110.7	F4 Y5 M10 V11 M12	F4-I8 WeakPolarHBondContact O-CG1 3.44Å; F4-I8 PolarHBondContact O-N 3.2Å; Y5-I8 PolarHBondContact O-N 3.07Å; I8-M10 VanDerWaalsContact C-N 3.35Å; I8-M10 PolarHBondContact O-N 2.91Å; I8-V11 PolarHBondContact O-N 2.95Å; I8-M12 HydrophobicContact CG2-CG 4.45Å; I8-M12 WeakPolarHBondContact O-CG 3.33Å; I8-M12 PolarHBondContact O-N 3.02Å
9	L	91.4	Very high	82.7	Confident	68 Å²	68	120.7 Å²	120.7	36%	0.356	59%	0.593	S	S	.	*	H	α-helix	trans	-64.9	-38.6	-179.3	-164.4	140.1	0	0	0	111.8	Y5 Y6 M12 I13	Y5-L9 HydrophobicContact CE1-CD1 3.72Å; Y5-L9 WeakPolarHBondContact O-CB 3.37Å; Y5-L9 PolarHBondContact O-N 3.24Å; Y6-L9 PolarHBondContact O-N 3.32Å; L9-M12 PolarHBondContact O-N 3.03Å; L9-I13 HydrophobicContact CD2-CD1 3.56Å; L9-I13 HydrophobicContact CD2-CG1 4.42Å; L9-I13 WeakPolarHBondContact O-CG1 3.29Å; L9-I13 PolarHBondContact O-N 3.38Å
10	M	89	Confident	81.5	Confident	123 Å²	123	119 Å²	119	61%	0.606	59%	0.586	S	S	*	*	H	α-helix	trans	-63.1	-44.1	172.7	-73.3	-70.3	-74	0	0	112.1	Y6 A7 I8 M12 I13 V14	Y6-M10 WeakPolarHBondContact O-CB 3.26Å; Y6-M10 VanDerWaalsContact O-CG 3.26Å; Y6-M10 WeakPolarHBondContact O-CG 3.46Å; Y6-M10 PolarHBondContact O-N 3.42Å; A7-M10 PolarHBondContact O-N 3.46Å; I8-M10 VanDerWaalsContact C-N 3.35Å; I8-M10 PolarHBondContact O-N 2.91Å; M10-M12 VanDerWaalsContact C-N 3.32Å; M10-M12 PolarHBondContact O-N 3.35Å; M10-I13 PolarHBondContact O-N 3Å; M10-V14 VanDerWaalsContact O-CG2 3.29Å; M10-V14 WeakPolarHBondContact O-CG2 3.02Å; M10-V14 PolarHBondContact O-N 3.28Å
11	V	90.4	Very high	80.5	Confident	91 Å²	91	118.5 Å²	118.5	55%	0.552	59%	0.589	S	S	*	*	H	α-helix	trans	-61.5	-42.5	176.7	172.1	0	0	0	0	110.9	A7 I8 V14 T15	A7-V11 WeakPolarHBondContact O-CG2 3.38Å; A7-V11 PolarHBondContact O-N 2.92Å; A7-V11 VanDerWaalsContact O-N 3.07Å; I8-V11 PolarHBondContact O-N 2.95Å; V11-V14 PolarHBondContact O-N 3.45Å; V11-T15 HydrophobicContact CG1-CG2 4.4Å; V11-T15 WeakPolarHBondContact O-CG2 3.19Å; V11-T15 PolarHBondContact O-N 3.38Å; V11-T15 PolarHBondContact O-OG1 2.93Å
12	M	88.1	Confident	80.2	Confident	125 Å²	125	113.6 Å²	113.6	62%	0.616	57%	0.571	S	S	*	*	H	α-helix	trans	-63.4	-39.6	176.9	-70.9	-69.2	-70.6	0	0	112.6	I8 L9 M10 T15 F16	I8-M12 HydrophobicContact CG2-CG 4.45Å; I8-M12 WeakPolarHBondContact O-CG 3.33Å; I8-M12 PolarHBondContact O-N 3.02Å; L9-M12 PolarHBondContact O-N 3.03Å; M10-M12 VanDerWaalsContact C-N 3.32Å; M10-M12 PolarHBondContact O-N 3.35Å; M12-T15 WeakPolarHBondContact CA-OG1 3.47Å; M12-T15 PolarHBondContact O-OG1 3.04Å; M12-T15 VanDerWaalsContact O-OG1 3.04Å; M12-F16 WeakPolarHBondContact O-CB 3.33Å; M12-F16 PolarHBondContact O-N 2.85Å
13	I	87.8	Confident	79.2	Confident	96 Å²	96	112.2 Å²	112.2	49%	0.492	57%	0.571	S	S	.	*	H	α-helix	trans	-68.1	-43.4	176.9	-68	168.6	0	0	0	110.7	L9 M10 F16 S17	L9-I13 HydrophobicContact CD2-CD1 3.56Å; L9-I13 HydrophobicContact CD2-CG1 4.42Å; L9-I13 WeakPolarHBondContact O-CG1 3.29Å; L9-I13 PolarHBondContact O-N 3.38Å; M10-I13 PolarHBondContact O-N 3Å; I13-F16 PolarHBondContact O-N 3.01Å; I13-S17 PolarHBondContact O-N 2.96Å; I13-S17 PolarHBondContact O-OG 3.06Å; I13-S17 VanDerWaalsContact O-OG 3.04Å
14	V	84.3	Confident	78.2	Confident	89 Å²	89	105.5 Å²	105.5	54%	0.539	55%	0.546	S	S	.	.	H	α-helix	trans	-65.4	-42.5	179.6	172	0	0	0	0	111.4	M10 V11 S17 Y18	M10-V14 VanDerWaalsContact O-CG2 3.29Å; M10-V14 WeakPolarHBondContact O-CG2 3.02Å; M10-V14 PolarHBondContact O-N 3.28Å; V11-V14 PolarHBondContact O-N 3.45Å; V14-S17 WeakPolarHBondContact CA-OG 3.36Å; V14-S17 PolarHBondContact O-OG 2.88Å; V14-Y18 WeakPolarHBondContact O-CB 3.48Å; V14-Y18 PolarHBondContact O-N 3.49Å
15	T	79.6	Confident	77.7	Confident	60 Å²	60	106.4 Å²	106.4	37%	0.368	55%	0.553	S	S	.	*	H	α-helix	trans	-66.2	-43.2	175.3	52.6	0	0	0	0	110.5	V11 M12 S17 Y18 F19	V11-T15 HydrophobicContact CG1-CG2 4.4Å; V11-T15 WeakPolarHBondContact O-CG2 3.19Å; V11-T15 PolarHBondContact O-N 3.38Å; V11-T15 PolarHBondContact O-OG1 2.93Å; M12-T15 WeakPolarHBondContact CA-OG1 3.47Å; M12-T15 PolarHBondContact O-OG1 3.04Å; M12-T15 VanDerWaalsContact O-OG1 3.04Å; T15-S17 PolarHBondContact O-N 3.34Å; T15-Y18 WeakPolarHBondContact O-CB 3.33Å; T15-Y18 PolarHBondContact O-N 3.28Å; T15-F19 WeakPolarHBondContact O-CD2 3.26Å; T15-F19 PolarHBondContact O-N 2.95Å
16	F	79.3	Confident	77.4	Confident	140 Å²	140	102.2 Å²	102.2	61%	0.614	55%	0.545	S	S	*	.	H	α-helix	trans	-60.7	-47.1	177.5	-168.6	-103.7	0	0	0	112	M12 I13 Y18 F19 N20	M12-F16 WeakPolarHBondContact O-CB 3.33Å; M12-F16 PolarHBondContact O-N 2.85Å; I13-F16 PolarHBondContact O-N 3.01Å; F16-Y18 VanDerWaalsContact C-N 3.3Å; F16-Y18 PolarHBondContact O-N 3.04Å; F16-F19 PolarHBondContact O-N 3.45Å; F16-F19 VanDerWaalsContact O-N 3.16Å; F16-N20 WeakPolarHBondContact CD1-ND2 3.49Å; F16-N20 WeakPolarHBondContact CE1-ND2 3.22Å; F16-N20 WeakPolarHBondContact CZ-ND2 3.18Å; F16-N20 PolarHBondContact O-N 3.46Å; F16-N20 PolarHBondContact O-ND2 2.73Å
17	S	75.2	Confident	77.1	Confident	68 Å²	68	98.9 Å²	98.9	48%	0.476	53%	0.531	S	S	.	.	H	α-helix	trans	-63.3	-36.8	177.2	55.7	0	0	0	0	112.2	I13 V14 T15 N20 V21	I13-S17 PolarHBondContact O-N 2.96Å; I13-S17 PolarHBondContact O-OG 3.06Å; I13-S17 VanDerWaalsContact O-OG 3.04Å; V14-S17 WeakPolarHBondContact CA-OG 3.36Å; V14-S17 PolarHBondContact O-OG 2.88Å; T15-S17 PolarHBondContact O-N 3.34Å; S17-N20 PolarHBondContact O-N 3.25Å; S17-V21 PolarHBondContact O-N 3.4Å
18	Y	72.1	Confident	76.9	Confident	165 Å²	165	99.6 Å²	99.6	65%	0.647	53%	0.53	S	S	*	.	H	α-helix	trans	-64.1	-39.6	172.6	-171.7	-97.3	0	0	0	112.9	V14 T15 F16 N20 V21 V22	V14-Y18 WeakPolarHBondContact O-CB 3.48Å; V14-Y18 PolarHBondContact O-N 3.49Å; T15-Y18 WeakPolarHBondContact O-CB 3.33Å; T15-Y18 PolarHBondContact O-N 3.28Å; F16-Y18 VanDerWaalsContact C-N 3.3Å; F16-Y18 PolarHBondContact O-N 3.04Å; Y18-N20 VanDerWaalsContact C-N 3.33Å; Y18-N20 PolarHBondContact O-N 3.45Å; Y18-V21 HydrophobicContact CD2-CG1 4.43Å; Y18-V21 VanDerWaalsContact O-CG1 3.26Å; Y18-V21 WeakPolarHBondContact O-CG1 3.45Å; Y18-V21 PolarHBondContact O-N 3.49Å; Y18-V22 PolarHBondContact O-N 2.97Å
19	F	66.2	Low	76.6	Confident	141 Å²	141	97.8 Å²	97.8	62%	0.618	52%	0.524	S	S	*	.	H	α-helix	trans	-67	-34.2	174.3	-79.4	-68.1	0	0	0	112.5	T15 F16 V22	T15-F19 WeakPolarHBondContact O-CD2 3.26Å; T15-F19 PolarHBondContact O-N 2.95Å; F16-F19 PolarHBondContact O-N 3.45Å; F16-F19 VanDerWaalsContact O-N 3.16Å; F19-V22 VanDerWaalsContact O-CG1 3.22Å; F19-V22 WeakPolarHBondContact O-CG1 3.07Å; F19-V22 PolarHBondContact O-N 3.16Å
20	N	60.2	Low	76.2	Confident	86 Å²	86	96.8 Å²	96.8	46%	0.46	53%	0.53	S	S	.	.	H	α-helix	trans	-72.7	-33.6	177.8	-72.9	-81.5	0	0	0	112.1	F16 S17 Y18 V22 S23	F16-N20 WeakPolarHBondContact CD1-ND2 3.49Å; F16-N20 WeakPolarHBondContact CE1-ND2 3.22Å; F16-N20 WeakPolarHBondContact CZ-ND2 3.18Å; F16-N20 PolarHBondContact O-N 3.46Å; F16-N20 PolarHBondContact O-ND2 2.73Å; S17-N20 PolarHBondContact O-N 3.25Å; Y18-N20 VanDerWaalsContact C-N 3.33Å; Y18-N20 PolarHBondContact O-N 3.45Å; N20-V22 PolarHBondContact O-N 2.79Å; N20-S23 PolarHBondContact O-N 3.23Å; N20-S23 PolarHBondContact O-OG 2.91Å
21	V	59.8	Low	76	Confident	108 Å²	108	94.9 Å²	94.9	66%	0.655	52%	0.519	S	S	*	.	H	α-helix	trans	-69.2	-19.4	177	78.7	0	0	0	0	112.9	S17 Y18 S23	S17-V21 PolarHBondContact O-N 3.4Å; Y18-V21 HydrophobicContact CD2-CG1 4.43Å; Y18-V21 VanDerWaalsContact O-CG1 3.26Å; Y18-V21 WeakPolarHBondContact O-CG1 3.45Å; Y18-V21 PolarHBondContact O-N 3.49Å; V21-S23 PolarHBondContact O-N 3.27Å
22	V	57.1	Low	75.8	Confident	99 Å²	99	96.9 Å²	96.9	60%	0.6	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.8	7.9	174.8	94.5	0	0	0	0	113.6	Y18 F19 N20 G24	Y18-V22 PolarHBondContact O-N 2.97Å; F19-V22 VanDerWaalsContact O-CG1 3.22Å; F19-V22 WeakPolarHBondContact O-CG1 3.07Å; F19-V22 PolarHBondContact O-N 3.16Å; N20-V22 PolarHBondContact O-N 2.79Å; V22-G24 PolarHBondContact O-N 3.3Å
23	S	57.4	Low	75.7	Confident	96 Å²	96	91 Å²	91	67%	0.671	49%	0.494	S	S	*	.	S	Bend	trans	-67.3	81.5	155.8	59.6	0	0	0	0	107	N20 V21 E25	N20-S23 PolarHBondContact O-N 3.23Å; N20-S23 PolarHBondContact O-OG 2.91Å; V21-S23 PolarHBondContact O-N 3.27Å; S23-E25 PolarHBondContact O-N 3.19Å
24	G	61.3	Low	75.3	Confident	25 Å²	25	87.7 Å²	87.7	26%	0.258	48%	0.479	S	S	.	.			trans	-46.5	132.1	-167.7	0	0	0	0	0	111.1	V22 C26	V22-G24 PolarHBondContact O-N 3.3Å; G24-C26 PolarHBondContact O-N 3.11Å
25	E	73.8	Confident	74.6	Confident	177 Å²	177	87.3 Å²	87.3	83%	0.827	47%	0.47	S	S	*	.			trans	-45.1	137.7	173.2	-62	178.1	108.4	0	0	109.6	S23	S23-E25 PolarHBondContact O-N 3.19Å
26	C	82.4	Confident	74.3	Confident	64 Å²	64	87 Å²	87	43%	0.432	47%	0.469	S	S	.	.	P	Polyproline II helix	trans	-62.4	147.1	179.6	70.7	0	0	0	0	110.1	G24 P40 C42	G24-C26 PolarHBondContact O-N 3.11Å; C26-P40 CarbonylContact C-O 3.52Å; C26-P40 WeakPolarHBondContact CA-O 3.05Å; C26-C42 HydrophobicContact CB-CB 3.83Å; C26-C42 WeakPolarHBondContact CB-SG 3.44Å; C26-C42 PolarHBondContact O-SG 3.47Å; C26-C42 WeakPolarHBondContact SG-CA 3.29Å; C26-C42 WeakPolarHBondContact SG-CB 3.47Å; C26-C42 CovalentContact SG-SG 2.04Å; C26-C42 PolarHBondContact SG-SG 3.13Å
27	R	83.2	Confident	73.7	Confident	88 Å²	88	86.8 Å²	86.8	33%	0.332	48%	0.478	S	S	.	.	B	Isolated β-bridge	trans	-90.7	131.5	-174.4	-57.9	-54.7	179.9	108.7	-2.1	111	Q31 P40 C41 C42 C57	R27-Q31 HydrophobicContact CB-CB 4.02Å; R27-P40 PolarHBondContact N-O 3.41Å; R27-C41 WeakPolarHBondContact O-CA 3.33Å; R27-C42 PolarHBondContact O-N 2.73Å; R27-C57 VanDerWaalsContact CB-SG 3.55Å
28	T	85.7	Confident	73.5	Confident	72 Å²	72	91.7 Å²	91.7	44%	0.442	49%	0.491	S	S	.	.	P	Polyproline II helix	trans	-82.3	172	177.4	57.8	0	0	0	0	111.2	G30 Q31 C57	T28-G30 PolarHBondContact O-N 2.74Å; T28-Q31 VanDerWaalsContact N-OE1 3.14Å; T28-Q31 WeakPolarHBondContact O-CB 3.42Å; T28-Q31 PolarHBondContact O-N 3.35Å; T28-Q31 VanDerWaalsContact O-N 3.13Å; T28-C57 WeakPolarHBondContact O-CB 3.34Å
29	V	84.7	Confident	73.6	Confident	73 Å²	73	84.4 Å²	84.4	44%	0.442	47%	0.465	S	S	.	.	T	Hydrogen-bonded Turn	trans	-54.9	134.8	-179.8	178	0	0	0	0	111.4	Q31 F45 C57	V29-Q31 PolarHBondContact O-N 2.85Å; V29-F45 HydrophobicContact CG2-CD1 3.65Å; V29-F45 HydrophobicContact CG2-CD2 3.94Å; V29-F45 HydrophobicContact CG2-CE1 3.44Å; V29-F45 VanDerWaalsContact CG2-CE1 3.44Å; V29-F45 HydrophobicContact CG2-CE2 3.76Å; V29-F45 HydrophobicContact CG2-CG 3.9Å; V29-F45 HydrophobicContact CG2-CZ 3.51Å; V29-C57 CarbonylContact C-O 3.54Å; V29-C57 WeakPolarHBondContact CA-O 3.38Å
30	G	82.3	Confident	74.3	Confident	46 Å²	46	80.4 Å²	80.4	47%	0.474	45%	0.452	S	S	.	.	T	Hydrogen-bonded Turn	trans	82.8	-11.6	-179.6	0	0	0	0	0	114.6	T28 C57	T28-G30 PolarHBondContact O-N 2.74Å; G30-C57 PolarHBondContact N-O 3.19Å
31	Q	85.6	Confident	75.5	Confident	84 Å²	84	77.5 Å²	77.5	39%	0.393	44%	0.439	S	S	.	.	S	Bend	trans	-76.6	150.8	173.6	-67	-167.6	-28.6	0	0	111.6	R27 T28 V29 C33 Q56 C57	R27-Q31 HydrophobicContact CB-CB 4.02Å; T28-Q31 VanDerWaalsContact N-OE1 3.14Å; T28-Q31 WeakPolarHBondContact O-CB 3.42Å; T28-Q31 PolarHBondContact O-N 3.35Å; T28-Q31 VanDerWaalsContact O-N 3.13Å; V29-Q31 PolarHBondContact O-N 2.85Å; Q31-C33 PolarHBondContact O-N 3.28Å; Q31-Q56 WeakPolarHBondContact O-CA 3.06Å; Q31-C57 PolarHBondContact O-N 3.17Å
32	E	86.1	Confident	76.7	Confident	133 Å²	133	73.3 Å²	73.3	62%	0.621	41%	0.414	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-65.7	130.9	176.2	-65.8	-170.4	121.1	0	0	111.1	G55	E32-G55 CarbonylContact C-O 3.6Å; E32-G55 WeakPolarHBondContact CA-O 3.34Å
33	C	85.4	Confident	77.6	Confident	2 Å²	2	76.9 Å²	76.9	1%	0.014	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.2	135.4	172.8	63.7	0	0	0	0	109.3	Q31 C47 G55 C57	Q31-C33 PolarHBondContact O-N 3.28Å; C33-C47 HydrophobicContact CB-CB 3.91Å; C33-C47 WeakPolarHBondContact CB-SG 3.42Å; C33-C47 PolarHBondContact O-SG 2.81Å; C33-C47 VanDerWaalsContact O-SG 3.41Å; C33-C47 WeakPolarHBondContact SG-CA 3.21Å; C33-C47 WeakPolarHBondContact SG-CB 3.28Å; C33-C47 CovalentContact SG-SG 2.03Å; C33-C47 PolarHBondContact SG-SG 3.43Å; C33-G55 PolarHBondContact N-O 3.3Å; C33-G55 CarbonylContact O-C 3.54Å; C33-G55 WeakPolarHBondContact O-CA 3.5Å; C33-G55 PolarHBondContact O-N 2.79Å; C33-C57 VanDerWaalsContact CB-SG 3.56Å
34	S	78.9	Confident	78.6	Confident	26 Å²	26	78.3 Å²	78.3	18%	0.182	42%	0.424	C	S	.	.			trans	-93.6	138.6	154.5	-168.5	0	0	0	0	107.1	T36 S39 F53	S34-T36 VanDerWaalsContact CB-OG1 3.29Å; S34-T36 WeakPolarHBondContact CB-OG1 3.35Å; S34-T36 PolarHBondContact O-N 3.28Å; S34-T36 WeakPolarHBondContact OG-CG2 3.48Å; S34-T36 PolarHBondContact OG-OG1 3.02Å; S34-T36 VanDerWaalsContact OG-OG1 3.11Å; S34-S39 WeakPolarHBondContact CB-OG 3.36Å; S34-S39 PolarHBondContact N-OG 2.88Å; S34-S39 PolarHBondContact O-OG 3.17Å; S34-F53 VanDerWaalsContact CA-O 3.28Å; S34-F53 WeakPolarHBondContact CA-O 2.99Å; S34-F53 WeakPolarHBondContact CB-O 3.31Å; S34-F53 PolarHBondContact OG-O 3.38Å
35	K	69.4	Low	79.8	Confident	81 Å²	81	80.2 Å²	80.2	35%	0.352	43%	0.426	S	S	.	.	S	Bend	trans	-66.1	21.7	174.5	-161.1	169.4	178.7	124.8	0	112.8	L49	K35-L49 HydrophobicContact CB-CD1 4.07Å; K35-L49 HydrophobicContact CB-CD2 4.22Å; K35-L49 HydrophobicContact CB-CG 4.39Å; K35-L49 HydrophobicContact CD-CD1 3.65Å; K35-L49 HydrophobicContact CD-CG 4.36Å
36	T	73.3	Confident	80.5	Confident	54 Å²	54	75.4 Å²	75.4	33%	0.331	40%	0.401	S	S	.	.	S	Bend	trans	-106.8	167.7	178.8	63.4	0	0	0	0	109.9	S34 F38	S34-T36 VanDerWaalsContact CB-OG1 3.29Å; S34-T36 WeakPolarHBondContact CB-OG1 3.35Å; S34-T36 PolarHBondContact O-N 3.28Å; S34-T36 WeakPolarHBondContact OG-CG2 3.48Å; S34-T36 PolarHBondContact OG-OG1 3.02Å; S34-T36 VanDerWaalsContact OG-OG1 3.11Å; T36-F38 PolarHBondContact O-N 3.16Å
37	V	68.6	Low	80.7	Confident	135 Å²	135	73.4 Å²	73.4	82%	0.818	39%	0.387	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.2	-12.4	-175.9	-172.6	0	0	0	0	113	S39	V37-S39 VanDerWaalsContact C-N 3.33Å; V37-S39 PolarHBondContact O-N 3.01Å
38	F	69.4	Low	80.9	Confident	171 Å²	171	69.2 Å²	69.2	75%	0.75	37%	0.371	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.1	-23.6	-177.9	-62.8	-68.1	0	0	0	113.8	T36	T36-F38 PolarHBondContact O-N 3.16Å
39	S	74.3	Confident	80.9	Confident	12 Å²	12	67.6 Å²	67.6	8%	0.084	36%	0.36	C	S	.	.	S	Bend	trans	-147.9	64.2	-175.1	55.4	0	0	0	0	110.7	S34 V37	S34-S39 WeakPolarHBondContact CB-OG 3.36Å; S34-S39 PolarHBondContact N-OG 2.88Å; S34-S39 PolarHBondContact O-OG 3.17Å; V37-S39 VanDerWaalsContact C-N 3.33Å; V37-S39 PolarHBondContact O-N 3.01Å
40	P	81.8	Confident	80.3	Confident	56 Å²	56	68.4 Å²	68.4	36%	0.364	36%	0.361	S	S	.	.	P	Polyproline II helix	trans	-67.3	144	176.9	30.1	-33.7	0	0	0	109.7	C26 R27	C26-P40 CarbonylContact C-O 3.52Å; C26-P40 WeakPolarHBondContact CA-O 3.05Å; R27-P40 PolarHBondContact N-O 3.41Å
41	C	84.8	Confident	79.9	Confident	25 Å²	25	70.2 Å²	70.2	17%	0.169	36%	0.363	C	S	.	.	B	Isolated β-bridge	trans	-70.9	148.9	166.7	-61.8	0	0	0	0	110	R27 F45 C57	R27-C41 WeakPolarHBondContact O-CA 3.33Å; C41-F45 HydrophobicContact CB-CB 3.91Å; C41-F45 WeakPolarHBondContact CB-O 3.01Å; C41-C57 WeakPolarHBondContact CA-SG 3.45Å; C41-C57 HydrophobicContact CB-CB 3.87Å; C41-C57 WeakPolarHBondContact CB-SG 3.44Å; C41-C57 WeakPolarHBondContact SG-CA 3.47Å; C41-C57 WeakPolarHBondContact SG-CB 3.04Å; C41-C57 CovalentContact SG-SG 2.03Å; C41-C57 PolarHBondContact SG-SG 2.81Å
42	C	84.5	Confident	79.5	Confident	21 Å²	21	73.8 Å²	73.8	14%	0.142	38%	0.384	C	S	.	.	P	Polyproline II helix	trans	-62	161.3	173.5	-62.3	0	0	0	0	111.9	C26 R27 N44 F45	C26-C42 HydrophobicContact CB-CB 3.83Å; C26-C42 WeakPolarHBondContact CB-SG 3.44Å; C26-C42 PolarHBondContact O-SG 3.47Å; C26-C42 WeakPolarHBondContact SG-CA 3.29Å; C26-C42 WeakPolarHBondContact SG-CB 3.47Å; C26-C42 CovalentContact SG-SG 2.04Å; C26-C42 PolarHBondContact SG-SG 3.13Å; R27-C42 PolarHBondContact O-N 2.73Å; C42-N44 PolarHBondContact O-N 3.38Å; C42-F45 HydrophobicContact CB-CD2 3.98Å; C42-F45 HydrophobicContact CB-CE2 4.21Å; C42-F45 PolarHBondContact O-N 3.41Å
43	E	77.2	Confident	78.9	Confident	174 Å²	174	74.2 Å²	74.2	81%	0.813	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	-49.4	130.9	178.9	-151.8	174.6	137.2	0	0	110.6
44	N	78	Confident	78.8	Confident	126 Å²	126	75.9 Å²	75.9	67%	0.674	40%	0.396	S	S	*	.	T	Hydrogen-bonded Turn	trans	80.7	2.6	-174.8	-46.5	-74.7	0	0	0	117.4	C42	C42-N44 PolarHBondContact O-N 3.38Å
45	F	86.6	Confident	79.2	Confident	65 Å²	65	74.7 Å²	74.7	29%	0.285	39%	0.388	S	S	.	.			trans	-112.9	145.8	175.5	-54.1	-36.6	0	0	0	112.3	V29 C41 C42 C57 P59	V29-F45 HydrophobicContact CG2-CD1 3.65Å; V29-F45 HydrophobicContact CG2-CD2 3.94Å; V29-F45 HydrophobicContact CG2-CE1 3.44Å; V29-F45 VanDerWaalsContact CG2-CE1 3.44Å; V29-F45 HydrophobicContact CG2-CE2 3.76Å; V29-F45 HydrophobicContact CG2-CG 3.9Å; V29-F45 HydrophobicContact CG2-CZ 3.51Å; C41-F45 HydrophobicContact CB-CB 3.91Å; C41-F45 WeakPolarHBondContact CB-O 3.01Å; C42-F45 HydrophobicContact CB-CD2 3.98Å; C42-F45 HydrophobicContact CB-CE2 4.21Å; C42-F45 PolarHBondContact O-N 3.41Å; F45-C57 HydrophobicContact CB-CB 4.36Å; F45-P59 HydrophobicContact CD1-CB 4.25Å; F45-P59 HydrophobicContact CE1-CB 4.4Å
46	Y	87.3	Confident	80.1	Confident	76 Å²	76	74.5 Å²	74.5	30%	0.298	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	135.9	-178.1	-56.4	-68.5	0	0	0	110.4	G48 Q58 P59 E72	Y46-G48 PolarHBondContact O-N 3.25Å; Y46-G48 VanDerWaalsContact O-N 3.14Å; Y46-Q58 PolarHBondContact N-O 2.86Å; Y46-Q58 PolarHBondContact O-N 3.35Å; Y46-P59 WeakPolarHBondContact CD2-O 3.36Å; Y46-E72 HydrophobicContact CD1-CB 4.23Å; Y46-E72 HydrophobicContact CD1-CG 3.57Å; Y46-E72 HydrophobicContact CD2-CB 4.36Å; Y46-E72 HydrophobicContact CD2-CG 4.49Å; Y46-E72 HydrophobicContact CE1-CB 4.36Å; Y46-E72 HydrophobicContact CE1-CG 3.52Å; Y46-E72 HydrophobicContact CE2-CB 4.48Å; Y46-E72 HydrophobicContact CE2-CG 4.45Å; Y46-E72 HydrophobicContact CG-CB 4.2Å; Y46-E72 HydrophobicContact CG-CG 4.05Å
47	C	88.3	Confident	80.8	Confident	21 Å²	21	71.9 Å²	71.9	14%	0.142	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.6	100	176.7	-174.1	0	0	0	0	110.1	C33 L49	C33-C47 HydrophobicContact CB-CB 3.91Å; C33-C47 WeakPolarHBondContact CB-SG 3.42Å; C33-C47 PolarHBondContact O-SG 2.81Å; C33-C47 VanDerWaalsContact O-SG 3.41Å; C33-C47 WeakPolarHBondContact SG-CA 3.21Å; C33-C47 WeakPolarHBondContact SG-CB 3.28Å; C33-C47 CovalentContact SG-SG 2.03Å; C33-C47 PolarHBondContact SG-SG 3.43Å; C47-L49 PolarHBondContact O-N 2.04Å
48	G	87.3	Confident	81.7	Confident	0 Å²	0	66.9 Å²	66.9	0%	0	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.9	96.1	174.8	0	0	0	0	0	110.7	Y46 N50 G55 Q56 Y65	Y46-G48 PolarHBondContact O-N 3.25Å; Y46-G48 VanDerWaalsContact O-N 3.14Å; G48-N50 PolarHBondContact O-N 2.98Å; G48-G55 CarbonylContact O-C 3.58Å; G48-G55 WeakPolarHBondContact O-CA 3.48Å; G48-Q56 PolarHBondContact N-O 3.14Å; G48-Q56 PolarHBondContact O-N 3.22Å; G48-Y65 VanDerWaalsContact C-CD1 3.47Å; G48-Y65 VanDerWaalsContact CA-CD1 3.45Å; G48-Y65 WeakPolarHBondContact O-CE1 3.06Å
49	L	85.2	Confident	82.5	Confident	39 Å²	39	62.4 Å²	62.4	20%	0.204	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.7	118.8	175.3	-68.3	175.5	0	0	0	110.4	K35 C47 S54	K35-L49 HydrophobicContact CB-CD1 4.07Å; K35-L49 HydrophobicContact CB-CD2 4.22Å; K35-L49 HydrophobicContact CB-CG 4.39Å; K35-L49 HydrophobicContact CD-CD1 3.65Å; K35-L49 HydrophobicContact CD-CG 4.36Å; C47-L49 PolarHBondContact O-N 2.04Å; L49-S54 WeakPolarHBondContact CA-O 3.07Å; L49-S54 WeakPolarHBondContact CD2-O 3.5Å
50	N	72.4	Confident	83	Confident	90 Å²	90	63.1 Å²	63.1	48%	0.481	33%	0.332	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	-22.8	169.9	60.2	21	0	0	0	111.4	G48 S54	G48-N50 PolarHBondContact O-N 2.98Å; N50-S54 PolarHBondContact N-O 2.9Å; N50-S54 VanDerWaalsContact N-O 3.17Å; N50-S54 PolarHBondContact OD1-O 2.88Å
51	T	74.6	Confident	83.2	Confident	84 Å²	84	60.5 Å²	60.5	52%	0.515	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.1	176.4	-176.2	53.6	0	0	0	0	110.7	F53 S54	T51-F53 PolarHBondContact O-N 3.03Å; T51-S54 PolarHBondContact N-O 3.36Å; T51-S54 VanDerWaalsContact N-O 3.16Å; T51-S54 WeakPolarHBondContact OG1-CB 3.48Å; T51-S54 PolarHBondContact OG1-O 2.03Å
52	L	76.5	Confident	83.1	Confident	158 Å²	158	59.8 Å²	59.8	83%	0.827	31%	0.311	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.4	109.2	174.4	-76.8	155.2	0	0	0	109.5	S54	L52-S54 PolarHBondContact O-N 2.03Å
53	F	73.8	Confident	83	Confident	142 Å²	142	59.4 Å²	59.4	62%	0.623	31%	0.311	S	S	*	.	T	Hydrogen-bonded Turn	trans	66.1	6.8	176.4	-47.4	-77.7	0	0	0	117.1	S34 T51	S34-F53 VanDerWaalsContact CA-O 3.28Å; S34-F53 WeakPolarHBondContact CA-O 2.99Å; S34-F53 WeakPolarHBondContact CB-O 3.31Å; S34-F53 PolarHBondContact OG-O 3.38Å; T51-F53 PolarHBondContact O-N 3.03Å
54	S	81.7	Confident	83.2	Confident	38 Å²	38	53.5 Å²	53.5	27%	0.266	30%	0.297	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.4	142.4	169	-173.3	0	0	0	0	111.1	L49 N50 T51 L52	L49-S54 WeakPolarHBondContact CA-O 3.07Å; L49-S54 WeakPolarHBondContact CD2-O 3.5Å; N50-S54 PolarHBondContact N-O 2.9Å; N50-S54 VanDerWaalsContact N-O 3.17Å; N50-S54 PolarHBondContact OD1-O 2.88Å; T51-S54 PolarHBondContact N-O 3.36Å; T51-S54 VanDerWaalsContact N-O 3.16Å; T51-S54 WeakPolarHBondContact OG1-CB 3.48Å; T51-S54 PolarHBondContact OG1-O 2.03Å; L52-S54 PolarHBondContact O-N 2.03Å
55	G	87.8	Confident	83.6	Confident	0 Å²	0	50.1 Å²	50.1	0%	0	28%	0.275	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-165.4	-176.6	-174.4	0	0	0	0	0	110.4	E32 C33 G48	E32-G55 CarbonylContact C-O 3.6Å; E32-G55 WeakPolarHBondContact CA-O 3.34Å; C33-G55 PolarHBondContact N-O 3.3Å; C33-G55 CarbonylContact O-C 3.54Å; C33-G55 WeakPolarHBondContact O-CA 3.5Å; C33-G55 PolarHBondContact O-N 2.79Å; G48-G55 CarbonylContact O-C 3.58Å; G48-G55 WeakPolarHBondContact O-CA 3.48Å
56	Q	88.2	Confident	83.6	Confident	77 Å²	77	50 Å²	50	36%	0.36	27%	0.274	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	144.6	175.6	-67.6	174.6	12.9	0	0	110	Q31 G48 Q58	Q31-Q56 WeakPolarHBondContact O-CA 3.06Å; G48-Q56 PolarHBondContact N-O 3.14Å; G48-Q56 PolarHBondContact O-N 3.22Å; Q56-Q58 PolarHBondContact O-N 2.84Å
57	C	88.9	Confident	83.6	Confident	0 Å²	0	46.3 Å²	46.3	0%	0	26%	0.26	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.2	124.7	172.4	-63.9	0	0	0	0	109.4	R27 T28 V29 G30 Q31 C33 C41 F45	R27-C57 VanDerWaalsContact CB-SG 3.55Å; T28-C57 WeakPolarHBondContact O-CB 3.34Å; V29-C57 CarbonylContact C-O 3.54Å; V29-C57 WeakPolarHBondContact CA-O 3.38Å; G30-C57 PolarHBondContact N-O 3.19Å; Q31-C57 PolarHBondContact O-N 3.17Å; C33-C57 VanDerWaalsContact CB-SG 3.56Å; C41-C57 WeakPolarHBondContact CA-SG 3.45Å; C41-C57 HydrophobicContact CB-CB 3.87Å; C41-C57 WeakPolarHBondContact CB-SG 3.44Å; C41-C57 WeakPolarHBondContact SG-CA 3.47Å; C41-C57 WeakPolarHBondContact SG-CB 3.04Å; C41-C57 CovalentContact SG-SG 2.03Å; C41-C57 PolarHBondContact SG-SG 2.81Å; F45-C57 HydrophobicContact CB-CB 4.36Å
58	Q	86.8	Confident	83.5	Confident	30 Å²	30	53.1 Å²	53.1	14%	0.14	28%	0.283	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.4	146.2	178.1	-66.2	-179.1	-10.2	0	0	109.3	Y46 Q56 C60 Y65	Y46-Q58 PolarHBondContact N-O 2.86Å; Y46-Q58 PolarHBondContact O-N 3.35Å; Q56-Q58 PolarHBondContact O-N 2.84Å; Q58-C60 PolarHBondContact O-N 3.02Å; Q58-Y65 PolarHBondContact NE2-OH 3.11Å
59	P	85.4	Confident	83.5	Confident	76 Å²	76	56.5 Å²	56.5	49%	0.494	30%	0.303	S	S	.	.	S	Bend	trans	-63.8	-30.6	175	26.9	-34.4	0	0	0	112.5	F45 Y46	F45-P59 HydrophobicContact CD1-CB 4.25Å; F45-P59 HydrophobicContact CE1-CB 4.4Å; Y46-P59 WeakPolarHBondContact CD2-O 3.36Å
60	C	85.6	Confident	83.6	Confident	27 Å²	27	58.7 Å²	58.7	18%	0.182	32%	0.315	C	S	.	.	S	Bend	trans	-150	140.4	172.3	62.9	0	0	0	0	108.3	Q58 A62 C74 K88	Q58-C60 PolarHBondContact O-N 3.02Å; C60-A62 PolarHBondContact O-N 3.33Å; C60-C74 HydrophobicContact CB-CB 3.64Å; C60-C74 WeakPolarHBondContact CB-SG 3.33Å; C60-C74 WeakPolarHBondContact SG-CB 3.31Å; C60-C74 CovalentContact SG-SG 2.01Å; C60-C74 PolarHBondContact SG-SG 3.21Å; C60-K88 PolarHBondContact O-NZ 3.34Å; C60-K88 PolarHBondContact SG-NZ 3.34Å
61	L	86.2	Confident	84.2	Confident	1 Å²	1	62.5 Å²	62.5	1%	0.005	33%	0.327	C	S	.	.	B	Isolated β-bridge	trans	-68.1	129.8	178	-62	176.5	0	0	0	109.4	F66 C67 E72 C74 C83 K88	L61-F66 VanDerWaalsContact CD1-O 3.28Å; L61-F66 WeakPolarHBondContact CD1-O 3.41Å; L61-C67 HydrophobicContact CD1-CB 4.11Å; L61-E72 WeakPolarHBondContact CB-O 3.17Å; L61-E72 HydrophobicContact CD1-CB 3.74Å; L61-E72 HydrophobicContact CG-CB 4.35Å; L61-E72 PolarHBondContact N-O 3.34Å; L61-C74 PolarHBondContact O-N 2.89Å; L61-C83 WeakPolarHBondContact CB-SG 3.37Å; L61-K88 VanDerWaalsContact C-NZ 3.33Å; L61-K88 PolarHBondContact O-NZ 2.8Å
62	A	82.2	Confident	84.6	Confident	10 Å²	10	59.3 Å²	59.3	8%	0.083	31%	0.307	C	S	.	.	P	Polyproline II helix	trans	-69.1	166.6	165.5	0	0	0	0	0	110.1	C60 Y65 C83 K88	C60-A62 PolarHBondContact O-N 3.33Å; A62-Y65 HydrophobicContact CB-CD2 3.78Å; A62-Y65 HydrophobicContact CB-CE2 3.8Å; A62-Y65 WeakPolarHBondContact O-CB 3.28Å; A62-Y65 VanDerWaalsContact O-CD2 3.31Å; A62-Y65 WeakPolarHBondContact O-CD2 3.32Å; A62-Y65 PolarHBondContact O-N 3.47Å; A62-C83 WeakPolarHBondContact O-CB 3.26Å; A62-K88 VanDerWaalsContact CA-NZ 3.27Å; A62-K88 HydrophobicContact CB-CD 3.69Å; A62-K88 VanDerWaalsContact N-NZ 3.14Å
63	G	82.2	Confident	85.1	Confident	14 Å²	14	52.1 Å²	52.1	14%	0.144	27%	0.269	C	S	.	.	T	Hydrogen-bonded Turn	trans	-65.4	156.2	174.7	0	0	0	0	0	112	Y65 C83 D85	G63-Y65 PolarHBondContact O-N 3.11Å; G63-C83 CarbonylContact C-O 3.53Å; G63-C83 WeakPolarHBondContact CA-O 3.08Å; G63-D85 WeakPolarHBondContact CA-OD2 3.39Å; G63-D85 PolarHBondContact N-OD2 3.42Å
64	G	82.3	Confident	85.6	Confident	49 Å²	49	48.6 Å²	48.6	51%	0.505	26%	0.262	S	S	.	.	T	Hydrogen-bonded Turn	trans	81.4	-24.3	-168.9	0	0	0	0	0	114.7	C83	G64-C83 PolarHBondContact N-O 2.79Å
65	Y	85.5	Confident	85.7	Confident	56 Å²	56	49 Å²	49	22%	0.22	26%	0.264	C	S	.	.	S	Bend	trans	-71.1	151	175.1	-74.8	-89.4	0	0	0	112.6	G48 Q58 A62 G63 C67 K82 C83	G48-Y65 VanDerWaalsContact C-CD1 3.47Å; G48-Y65 VanDerWaalsContact CA-CD1 3.45Å; G48-Y65 WeakPolarHBondContact O-CE1 3.06Å; Q58-Y65 PolarHBondContact NE2-OH 3.11Å; A62-Y65 HydrophobicContact CB-CD2 3.78Å; A62-Y65 HydrophobicContact CB-CE2 3.8Å; A62-Y65 WeakPolarHBondContact O-CB 3.28Å; A62-Y65 VanDerWaalsContact O-CD2 3.31Å; A62-Y65 WeakPolarHBondContact O-CD2 3.32Å; A62-Y65 PolarHBondContact O-N 3.47Å; G63-Y65 PolarHBondContact O-N 3.11Å; Y65-C67 PolarHBondContact O-N 2.68Å; Y65-K82 CarbonylContact O-C 3.53Å; Y65-K82 VanDerWaalsContact O-CA 3.26Å; Y65-K82 WeakPolarHBondContact O-CA 3.28Å; Y65-C83 PolarHBondContact O-N 2.9Å
66	F	86.8	Confident	85.6	Confident	61 Å²	61	51.2 Å²	51.2	27%	0.268	29%	0.287	S	S	.	.	B	Isolated β-bridge	trans	-72.9	123.5	-179	-170.5	-82.1	0	0	0	112	L61 W68 L81	L61-F66 VanDerWaalsContact CD1-O 3.28Å; L61-F66 WeakPolarHBondContact CD1-O 3.41Å; F66-W68 AromaticContact CE1-CD2 3.78Å; F66-W68 HydrophobicContact CE1-CD2 3.78Å; F66-W68 AromaticContact CE1-CE2 3.52Å; F66-W68 HydrophobicContact CE1-CE3 4.11Å; F66-W68 HydrophobicContact CE1-CG 4.4Å; F66-W68 AromaticContact CE1-CH2 3.93Å; F66-W68 HydrophobicContact CE1-CH2 3.93Å; F66-W68 AromaticContact CE1-CZ2 3.61Å; F66-W68 HydrophobicContact CE1-CZ2 3.61Å; F66-W68 HydrophobicContact CE1-CZ3 4.18Å; F66-W68 HydrophobicContact CZ-CD2 4.49Å; F66-W68 HydrophobicContact CZ-CE3 4.38Å; F66-W68 AromaticContact CZ-CH2 3.9Å; F66-W68 HydrophobicContact CZ-CH2 3.9Å; F66-W68 HydrophobicContact CZ-CZ2 4.02Å; F66-W68 HydrophobicContact CZ-CZ3 4.1Å; F66-L81 VanDerWaalsContact CA-O 3.28Å; F66-L81 WeakPolarHBondContact CA-O 3.36Å; F66-L81 HydrophobicContact CD2-CB 4.11Å; F66-L81 WeakPolarHBondContact CD2-O 3.42Å; F66-L81 HydrophobicContact CE2-CB 3.61Å; F66-L81 HydrophobicContact CE2-CD1 3.97Å; F66-L81 HydrophobicContact CE2-CG 4.25Å; F66-L81 HydrophobicContact CZ-CB 4.03Å; F66-L81 HydrophobicContact CZ-CD1 4.19Å; F66-L81 HydrophobicContact CZ-CD2 4.16Å; F66-L81 HydrophobicContact CZ-CG 4.36Å
67	C	87.3	Confident	85.6	Confident	0 Å²	0	53.5 Å²	53.5	0%	0	30%	0.296	C	S	.	.			trans	-124.2	151.9	179.9	53.3	0	0	0	0	111.9	L61 Y65 C73 C78 L81 K82 C83	L61-C67 HydrophobicContact CD1-CB 4.11Å; Y65-C67 PolarHBondContact O-N 2.68Å; C67-C73 VanDerWaalsContact CB-SG 3.52Å; C67-C78 HydrophobicContact CB-CB 3.84Å; C67-C78 WeakPolarHBondContact CB-SG 3.11Å; C67-C78 PolarHBondContact O-SG 3.3Å; C67-C78 WeakPolarHBondContact SG-CA 3.49Å; C67-C78 WeakPolarHBondContact SG-CB 2.93Å; C67-C78 CovalentContact SG-SG 2.02Å; C67-C78 PolarHBondContact SG-SG 3.3Å; C67-L81 PolarHBondContact N-O 2.97Å; C67-L81 VanDerWaalsContact N-O 3.11Å; C67-K82 PolarHBondContact SG-O 3.24Å; C67-C83 VanDerWaalsContact CB-SG 3.55Å; C67-C83 PolarHBondContact SG-N 3.28Å
68	W	86.9	Confident	85.6	Confident	164 Å²	164	55.2 Å²	55.2	62%	0.621	31%	0.308	S	S	*	.	S	Bend	trans	-103.5	-32.1	170.6	-65.7	115.7	0	0	0	112.3	F66 E72 L81	F66-W68 AromaticContact CE1-CD2 3.78Å; F66-W68 HydrophobicContact CE1-CD2 3.78Å; F66-W68 AromaticContact CE1-CE2 3.52Å; F66-W68 HydrophobicContact CE1-CE3 4.11Å; F66-W68 HydrophobicContact CE1-CG 4.4Å; F66-W68 AromaticContact CE1-CH2 3.93Å; F66-W68 HydrophobicContact CE1-CH2 3.93Å; F66-W68 AromaticContact CE1-CZ2 3.61Å; F66-W68 HydrophobicContact CE1-CZ2 3.61Å; F66-W68 HydrophobicContact CE1-CZ3 4.18Å; F66-W68 HydrophobicContact CZ-CD2 4.49Å; F66-W68 HydrophobicContact CZ-CE3 4.38Å; F66-W68 AromaticContact CZ-CH2 3.9Å; F66-W68 HydrophobicContact CZ-CH2 3.9Å; F66-W68 HydrophobicContact CZ-CZ2 4.02Å; F66-W68 HydrophobicContact CZ-CZ3 4.1Å; W68-E72 WeakPolarHBondContact CA-OE2 3.43Å; W68-E72 WeakPolarHBondContact CB-OE2 3.5Å; W68-E72 PolarHBondContact N-OE2 3.29Å; W68-L81 HydrophobicContact CE3-CD2 4.47Å; W68-L81 HydrophobicContact CZ3-CD2 4.47Å
69	T	86.8	Confident	85.8	Confident	70 Å²	70	56.9 Å²	56.9	43%	0.429	32%	0.323	S	S	.	.	S	Bend	trans	-133.3	151.1	-175.5	60.4	0	0	0	0	109.8	K71 E72	T69-K71 VanDerWaalsContact C-N 3.26Å; T69-K71 PolarHBondContact O-N 3.27Å; T69-E72 PolarHBondContact N-OE2 3.15Å; T69-E72 PolarHBondContact O-N 3.44Å; T69-E72 WeakPolarHBondContact OG1-CG 3.2Å; T69-E72 PolarHBondContact OG1-OE2 3.01Å
70	D	87.1	Confident	86	Confident	86 Å²	86	64.7 Å²	64.7	46%	0.46	34%	0.342	S	S	.	.	G	3₁₀ helix	trans	-61	-32.1	179.4	48.2	-82.8	0	0	0	113.7	E72 C73 G76	D70-E72 VanDerWaalsContact C-N 3.26Å; D70-E72 PolarHBondContact O-N 3.32Å; D70-C73 WeakPolarHBondContact O-CB 3.01Å; D70-C73 PolarHBondContact O-N 2.01Å; D70-G76 CarbonylContact O-C 3.41Å; D70-G76 WeakPolarHBondContact O-CA 2.99Å
71	K	85	Confident	86	Confident	169 Å²	169	67.9 Å²	67.9	74%	0.735	36%	0.357	S	S	*	.	G	3₁₀ helix	trans	-68.4	-20	180	-60.3	-179.1	-176.5	173.7	0	114.3	T69 C73	T69-K71 VanDerWaalsContact C-N 3.26Å; T69-K71 PolarHBondContact O-N 3.27Å; K71-C73 VanDerWaalsContact C-N 3.28Å
72	E	84.2	Confident	86.1	Confident	18 Å²	18	73.5 Å²	73.5	8%	0.084	38%	0.382	C	S	.	.	G	3₁₀ helix	trans	-72.3	-28.6	175.4	-68.1	170.1	87.3	0	0	111.3	Y46 L61 W68 T69 D70	Y46-E72 HydrophobicContact CD1-CB 4.23Å; Y46-E72 HydrophobicContact CD1-CG 3.57Å; Y46-E72 HydrophobicContact CD2-CB 4.36Å; Y46-E72 HydrophobicContact CD2-CG 4.49Å; Y46-E72 HydrophobicContact CE1-CB 4.36Å; Y46-E72 HydrophobicContact CE1-CG 3.52Å; Y46-E72 HydrophobicContact CE2-CB 4.48Å; Y46-E72 HydrophobicContact CE2-CG 4.45Å; Y46-E72 HydrophobicContact CG-CB 4.2Å; Y46-E72 HydrophobicContact CG-CG 4.05Å; L61-E72 WeakPolarHBondContact CB-O 3.17Å; L61-E72 HydrophobicContact CD1-CB 3.74Å; L61-E72 HydrophobicContact CG-CB 4.35Å; L61-E72 PolarHBondContact N-O 3.34Å; W68-E72 WeakPolarHBondContact CA-OE2 3.43Å; W68-E72 WeakPolarHBondContact CB-OE2 3.5Å; W68-E72 PolarHBondContact N-OE2 3.29Å; T69-E72 PolarHBondContact N-OE2 3.15Å; T69-E72 PolarHBondContact O-N 3.44Å; T69-E72 WeakPolarHBondContact OG1-CG 3.2Å; T69-E72 PolarHBondContact OG1-OE2 3.01Å; D70-E72 VanDerWaalsContact C-N 3.26Å; D70-E72 PolarHBondContact O-N 3.32Å
73	C	86.4	Confident	86.3	Confident	6 Å²	6	73.2 Å²	73.2	4%	0.041	38%	0.379	C	S	.	.	B	Isolated β-bridge	trans	-83.6	134.3	-177.1	-57.8	0	0	0	0	110.8	C67 D70 K71 S75 G76 C83	C67-C73 VanDerWaalsContact CB-SG 3.52Å; D70-C73 WeakPolarHBondContact O-CB 3.01Å; D70-C73 PolarHBondContact O-N 2.01Å; K71-C73 VanDerWaalsContact C-N 3.28Å; C73-S75 PolarHBondContact O-N 2.64Å; C73-S75 VanDerWaalsContact O-N 3.16Å; C73-G76 PolarHBondContact O-N 3.42Å; C73-C83 WeakPolarHBondContact CA-SG 2.96Å; C73-C83 HydrophobicContact CB-CB 3.62Å; C73-C83 WeakPolarHBondContact CB-SG 3.41Å; C73-C83 WeakPolarHBondContact SG-CA 3.38Å; C73-C83 WeakPolarHBondContact SG-CB 3.47Å; C73-C83 CovalentContact SG-SG 2.02Å; C73-C83 PolarHBondContact SG-SG 2.02Å
74	C	84.8	Confident	86.4	Confident	69 Å²	69	75.1 Å²	75.1	47%	0.466	39%	0.388	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.9	-24.8	174.7	-123.2	0	0	0	0	113.2	C60 L61 G76 K88	C60-C74 HydrophobicContact CB-CB 3.64Å; C60-C74 WeakPolarHBondContact CB-SG 3.33Å; C60-C74 WeakPolarHBondContact SG-CB 3.31Å; C60-C74 CovalentContact SG-SG 2.01Å; C60-C74 PolarHBondContact SG-SG 3.21Å; L61-C74 PolarHBondContact O-N 2.89Å; C74-G76 VanDerWaalsContact C-N 3.27Å; C74-K88 HydrophobicContact CB-CD 3.6Å; C74-K88 VanDerWaalsContact CB-NZ 3.28Å; C74-K88 WeakPolarHBondContact SG-CE 3.34Å
75	S	83.3	Confident	85.9	Confident	45 Å²	45	75.6 Å²	75.6	32%	0.315	38%	0.379	S	S	.	.	T	Hydrogen-bonded Turn	trans	-83.5	-2.1	174.6	-49.6	0	0	0	0	113.4	C73 K77 T84 P86	C73-S75 PolarHBondContact O-N 2.64Å; C73-S75 VanDerWaalsContact O-N 3.16Å; S75-K77 PolarHBondContact O-N 2.82Å; S75-T84 WeakPolarHBondContact CB-O 3.34Å; S75-T84 PolarHBondContact OG-O 3.39Å; S75-P86 VanDerWaalsContact OG-CD 3.22Å; S75-P86 WeakPolarHBondContact OG-CD 3.33Å
76	G	85.7	Confident	84.6	Confident	47 Å²	47	77.4 Å²	77.4	49%	0.485	40%	0.397	S	S	.	.	S	Bend	trans	66.2	19.7	-179	0	0	0	0	0	113.9	D70 C73 C74	D70-G76 CarbonylContact O-C 3.41Å; D70-G76 WeakPolarHBondContact O-CA 2.99Å; C73-G76 PolarHBondContact O-N 3.42Å; C74-G76 VanDerWaalsContact C-N 3.27Å
77	K	88.2	Confident	83.4	Confident	126 Å²	126	79.8 Å²	79.8	55%	0.548	41%	0.412	S	S	.	.			trans	-143.4	110.5	-178	-166.8	171.7	-176	175.7	0	111.8	S75 T84	S75-K77 PolarHBondContact O-N 2.82Å; K77-T84 PolarHBondContact O-N 3.19Å; K77-T84 PolarHBondContact O-OG1 2.95Å
78	C	89.2	Confident	81.9	Confident	35 Å²	35	81.9 Å²	81.9	24%	0.236	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.7	117.3	167.9	-173.2	0	0	0	0	108.8	C67	C67-C78 HydrophobicContact CB-CB 3.84Å; C67-C78 WeakPolarHBondContact CB-SG 3.11Å; C67-C78 PolarHBondContact O-SG 3.3Å; C67-C78 WeakPolarHBondContact SG-CA 3.49Å; C67-C78 WeakPolarHBondContact SG-CB 2.93Å; C67-C78 CovalentContact SG-SG 2.02Å; C67-C78 PolarHBondContact SG-SG 3.3Å
79	S	90	Very high	80.4	Confident	65 Å²	65	79 Å²	79	46%	0.455	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	130.6	179.2	-166.1	0	0	0	0	109.8	L81 K82	S79-L81 VanDerWaalsContact C-N 3.27Å; S79-L81 PolarHBondContact O-N 2.91Å; S79-K82 CarbonylContact C-O 3.54Å; S79-K82 PolarHBondContact N-O 3.31Å; S79-K82 CarbonylContact O-C 3.53Å; S79-K82 PolarHBondContact O-N 2.94Å
80	W	89.8	Confident	79.2	Confident	240 Å²	240	79.7 Å²	79.7	91%	0.909	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.7	41.7	-178.1	-156.4	-108.4	0	0	0	113.6	K82	W80-K82 PolarHBondContact O-N 3.43Å; W80-K82 VanDerWaalsContact O-N 3.11Å
81	L	86.9	Confident	77.8	Confident	94 Å²	94	79.3 Å²	79.3	49%	0.492	42%	0.422	S	S	.	.	T	Hydrogen-bonded Turn	trans	59.4	16.8	-175.7	-55.6	169.6	0	0	0	114.2	F66 C67 W68 S79	F66-L81 VanDerWaalsContact CA-O 3.28Å; F66-L81 WeakPolarHBondContact CA-O 3.36Å; F66-L81 HydrophobicContact CD2-CB 4.11Å; F66-L81 WeakPolarHBondContact CD2-O 3.42Å; F66-L81 HydrophobicContact CE2-CB 3.61Å; F66-L81 HydrophobicContact CE2-CD1 3.97Å; F66-L81 HydrophobicContact CE2-CG 4.25Å; F66-L81 HydrophobicContact CZ-CB 4.03Å; F66-L81 HydrophobicContact CZ-CD1 4.19Å; F66-L81 HydrophobicContact CZ-CD2 4.16Å; F66-L81 HydrophobicContact CZ-CG 4.36Å; C67-L81 PolarHBondContact N-O 2.97Å; C67-L81 VanDerWaalsContact N-O 3.11Å; W68-L81 HydrophobicContact CE3-CD2 4.47Å; W68-L81 HydrophobicContact CZ3-CD2 4.47Å; S79-L81 VanDerWaalsContact C-N 3.27Å; S79-L81 PolarHBondContact O-N 2.91Å
82	K	87.3	Confident	76.5	Confident	120 Å²	120	77.4 Å²	77.4	52%	0.522	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.8	143.5	177.3	-66.5	-175	178.8	-172.5	0	110.7	Y65 C67 S79 W80 T84	Y65-K82 CarbonylContact O-C 3.53Å; Y65-K82 VanDerWaalsContact O-CA 3.26Å; Y65-K82 WeakPolarHBondContact O-CA 3.28Å; C67-K82 PolarHBondContact SG-O 3.24Å; S79-K82 CarbonylContact C-O 3.54Å; S79-K82 PolarHBondContact N-O 3.31Å; S79-K82 CarbonylContact O-C 3.53Å; S79-K82 PolarHBondContact O-N 2.94Å; W80-K82 PolarHBondContact O-N 3.43Å; W80-K82 VanDerWaalsContact O-N 3.11Å; K82-T84 PolarHBondContact O-N 2.02Å
83	C	86.7	Confident	74.8	Confident	4 Å²	4	86.1 Å²	86.1	3%	0.027	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.6	136	171.6	-69.2	0	0	0	0	109.4	L61 A62 G63 G64 Y65 C67 C73	L61-C83 WeakPolarHBondContact CB-SG 3.37Å; A62-C83 WeakPolarHBondContact O-CB 3.26Å; G63-C83 CarbonylContact C-O 3.53Å; G63-C83 WeakPolarHBondContact CA-O 3.08Å; G64-C83 PolarHBondContact N-O 2.79Å; Y65-C83 PolarHBondContact O-N 2.9Å; C67-C83 VanDerWaalsContact CB-SG 3.55Å; C67-C83 PolarHBondContact SG-N 3.28Å; C73-C83 WeakPolarHBondContact CA-SG 2.96Å; C73-C83 HydrophobicContact CB-CB 3.62Å; C73-C83 WeakPolarHBondContact CB-SG 3.41Å; C73-C83 WeakPolarHBondContact SG-CA 3.38Å; C73-C83 WeakPolarHBondContact SG-CB 3.47Å; C73-C83 CovalentContact SG-SG 2.02Å; C73-C83 PolarHBondContact SG-SG 2.02Å
84	T	83.9	Confident	73.4	Confident	54 Å²	54	92.3 Å²	92.3	33%	0.331	48%	0.48	S	S	.	.			trans	-75.5	128.4	174.8	-52.8	0	0	0	0	108.1	S75 K77 K82 P86	S75-T84 WeakPolarHBondContact CB-O 3.34Å; S75-T84 PolarHBondContact OG-O 3.39Å; K77-T84 PolarHBondContact O-N 3.19Å; K77-T84 PolarHBondContact O-OG1 2.95Å; K82-T84 PolarHBondContact O-N 2.02Å; T84-P86 WeakPolarHBondContact O-CD 3.32Å
85	D	71.8	Confident	72.1	Confident	58 Å²	58	94.6 Å²	94.6	31%	0.31	49%	0.492	S	S	.	.			trans	-105.3	106.3	177.5	-140.8	-60.6	0	0	0	111.1	G63 K88	G63-D85 WeakPolarHBondContact CA-OD2 3.39Å; G63-D85 PolarHBondContact N-OD2 3.42Å; D85-K88 VanDerWaalsContact OD1-CB 3.32Å; D85-K88 WeakPolarHBondContact OD1-CB 3.05Å; D85-K88 PolarHBondContact OD1-N 3.32Å
86	P	58	Low	70.6	Confident	94 Å²	94	98.8 Å²	98.8	61%	0.61	54%	0.542	S	S	*	.	S	Bend	trans	-96.3	-29.3	171	27.1	-22.8	0	0	0	114	S75 T84	S75-P86 VanDerWaalsContact OG-CD 3.22Å; S75-P86 WeakPolarHBondContact OG-CD 3.33Å; T84-P86 WeakPolarHBondContact O-CD 3.32Å
87	I	61.4	Low	69.9	Low	112 Å²	112	101.4 Å²	101.4	57%	0.574	55%	0.545	S	S	*	.	S	Bend	trans	-149.4	-4.7	-167	-60.8	178.6	0	0	0	112.9	D89 V90 V91	I87-D89 PolarHBondContact O-N 3.32Å; I87-V90 HydrophobicContact CG2-CB 4.37Å; I87-V90 WeakPolarHBondContact O-CB 3.22Å; I87-V90 PolarHBondContact O-N 3.1Å; I87-V91 HydrophobicContact CG2-CG2 4.43Å
88	K	56.6	Low	68.9	Low	43 Å²	43	100.1 Å²	100.1	19%	0.187	55%	0.545	C	S	.	.	H	α-helix	trans	-75.5	-29	-156.9	-150.4	-173.6	171.6	-162	0	114.3	C60 L61 A62 C74 D85 V90	C60-K88 PolarHBondContact O-NZ 3.34Å; C60-K88 PolarHBondContact SG-NZ 3.34Å; L61-K88 VanDerWaalsContact C-NZ 3.33Å; L61-K88 PolarHBondContact O-NZ 2.8Å; A62-K88 VanDerWaalsContact CA-NZ 3.27Å; A62-K88 HydrophobicContact CB-CD 3.69Å; A62-K88 VanDerWaalsContact N-NZ 3.14Å; C74-K88 HydrophobicContact CB-CD 3.6Å; C74-K88 VanDerWaalsContact CB-NZ 3.28Å; C74-K88 WeakPolarHBondContact SG-CE 3.34Å; D85-K88 VanDerWaalsContact OD1-CB 3.32Å; D85-K88 WeakPolarHBondContact OD1-CB 3.05Å; D85-K88 PolarHBondContact OD1-N 3.32Å; K88-V90 PolarHBondContact O-N 2.92Å
89	D	54.5	Low	67.8	Low	103 Å²	103	103.7 Å²	103.7	55%	0.551	56%	0.562	S	S	*	*	H	α-helix	trans	-66.1	-24.3	169.3	-101.1	-86.7	0	0	0	113.8	I87 V91 R93	I87-D89 PolarHBondContact O-N 3.32Å; D89-V91 VanDerWaalsContact C-N 3.34Å; D89-R93 WeakPolarHBondContact O-CG 3.1Å; D89-R93 PolarHBondContact O-N 2.99Å
90	V	61.4	Low	66.5	Low	86 Å²	86	105.9 Å²	105.9	52%	0.521	57%	0.568	S	S	.	*	H	α-helix	trans	-74.3	-30	-173.8	-174.5	0	0	0	0	111.2	I87 K88 L94	I87-V90 HydrophobicContact CG2-CB 4.37Å; I87-V90 WeakPolarHBondContact O-CB 3.22Å; I87-V90 PolarHBondContact O-N 3.1Å; K88-V90 PolarHBondContact O-N 2.92Å; V90-L94 WeakPolarHBondContact O-CG 3.41Å
91	V	59.3	Low	65	Low	77 Å²	77	97.6 Å²	97.6	47%	0.467	55%	0.547	S	S	.	.	H	α-helix	trans	-93.9	-31.5	-177.3	-179.2	0	0	0	0	112.3	I87 D89 R93 L94 T95	I87-V91 HydrophobicContact CG2-CG2 4.43Å; D89-V91 VanDerWaalsContact C-N 3.34Å; V91-R93 PolarHBondContact O-N 2.91Å; V91-L94 PolarHBondContact O-N 2.86Å; V91-T95 PolarHBondContact O-N 3.16Å; V91-T95 PolarHBondContact O-OG1 2.88Å; V91-T95 VanDerWaalsContact O-OG1 3.1Å
92	E	56.4	Low	63.6	Low	130 Å²	130	97.8 Å²	97.8	61%	0.607	55%	0.55	S	S	*	*	H	α-helix	trans	-57.8	-35.1	169.2	-110.3	169.2	104.4	0	0	110.8	L94 G96	E92-L94 VanDerWaalsContact C-N 3.26Å; E92-L94 PolarHBondContact O-N 3.34Å; E92-G96 PolarHBondContact O-N 3.27Å
93	R	48.9	Very low	61.9	Low	201 Å²	201	96.2 Å²	96.2	76%	0.758	55%	0.553	S	S	*	*	H	α-helix	trans	-66.7	-12.8	170.9	-85.9	177.5	147.9	141.8	-3.1	116.5	D89 V91	D89-R93 WeakPolarHBondContact O-CG 3.1Å; D89-R93 PolarHBondContact O-N 2.99Å; V91-R93 PolarHBondContact O-N 2.91Å
94	L	58	Low	59.9	Low	136 Å²	136	103.3 Å²	103.3	71%	0.712	59%	0.593	S	S	*	*	H	α-helix	trans	-109.8	-7.8	-177.2	-67.5	174.2	0	0	0	113.3	V90 V91 E92	V90-L94 WeakPolarHBondContact O-CG 3.41Å; V91-L94 PolarHBondContact O-N 2.86Å; E92-L94 VanDerWaalsContact C-N 3.26Å; E92-L94 PolarHBondContact O-N 3.34Å
95	T	56.1	Low	57.9	Low	117 Å²	117	107.4 Å²	107.4	72%	0.718	62%	0.615	S	S	*	*	H	α-helix	trans	-137.8	-1.4	-173.2	-10.7	0	0	0	0	115.3	V91	V91-T95 PolarHBondContact O-N 3.16Å; V91-T95 PolarHBondContact O-OG1 2.88Å; V91-T95 VanDerWaalsContact O-OG1 3.1Å
96	G	53.1	Low	56.7	Low	132 Å²	132	111.9 Å²	111.9	100%	1.361	64%	0.642	S	S	*	*			trans	-74.4	0	160.5	0	0	0	0	0	110.8	E92	E92-G96 PolarHBondContact O-N 3.27Å

Retrieved 96 of 96 residues in 22.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).