G4VMC8_SCHMA Loading...

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4

AlphaFold DB , UniProt , Accession G4VMC8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 52 aa.

						>G4VMC8_SCHMA|G4VMC8
MITDVQLTVFANLAGSVLFLLVVLYHYVIVNQKTPKVNKRKIKGVEADSVPS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	78.2	Confident	92.2	Very high	228 Å²	228	110.2 Å²	110.2	100%	1.123	60%	0.598	S	S	*	*				0	125.3	0	-75.5	167	71.5	0	0	107.3	T3	M1-T3 PolarHBondContact O-N 3.19Å
2	I	83.5	Confident	92.5	Very high	110 Å²	110	110.2 Å²	110.2	56%	0.564	60%	0.597	S	S	*	*			trans	-62	129.5	162.6	-168.3	97.2	0	0	0	106.4	Q6 L7	I2-Q6 HydrophobicContact CD1-CB 3.81Å; I2-Q6 VanDerWaalsContact CD1-OE1 3.24Å; I2-Q6 HydrophobicContact CG1-CB 3.82Å; I2-L7 HydrophobicContact CG1-CD2 3.96Å; I2-L7 HydrophobicContact CG1-CG 4.04Å; I2-L7 HydrophobicContact CG2-CD1 4.38Å; I2-L7 HydrophobicContact CG2-CD2 4.25Å; I2-L7 HydrophobicContact CG2-CG 4.29Å
3	T	91.3	Very high	92.9	Very high	73 Å²	73	109.6 Å²	109.6	45%	0.448	59%	0.593	S	S	.	*			trans	-86.2	152.4	178	60.8	0	0	0	0	109.6	M1 V5 Q6 L7	M1-T3 PolarHBondContact O-N 3.19Å; T3-V5 PolarHBondContact O-N 2.73Å; T3-Q6 WeakPolarHBondContact O-CB 3.15Å; T3-Q6 PolarHBondContact O-N 2.59Å; T3-L7 PolarHBondContact O-N 2.96Å
4	D	94.2	Very high	93.1	Very high	130 Å²	130	104.6 Å²	104.6	70%	0.695	57%	0.574	S	S	*	*	H	α-helix	trans	-51.9	-35.1	179.7	-62.3	-39.5	0	0	0	112.1	Q6 L7 T8	D4-Q6 PolarHBondContact O-N 2.64Å; D4-L7 WeakPolarHBondContact O-CB 3.49Å; D4-L7 PolarHBondContact O-N 2.7Å; D4-T8 PolarHBondContact O-N 2.82Å; D4-T8 PolarHBondContact O-OG1 2.88Å; D4-T8 VanDerWaalsContact O-OG1 3.1Å
5	V	94.3	Very high	93.4	Very high	104 Å²	104	100.3 Å²	100.3	63%	0.63	56%	0.563	S	S	*	*	H	α-helix	trans	-59.5	-42.9	175.3	-177.7	0	0	0	0	112.2	T3 L7 T8 V9	T3-V5 PolarHBondContact O-N 2.73Å; V5-L7 VanDerWaalsContact C-N 3.35Å; V5-T8 PolarHBondContact O-N 2.61Å; V5-V9 VanDerWaalsContact O-CG2 3.31Å; V5-V9 WeakPolarHBondContact O-CG2 3.44Å; V5-V9 PolarHBondContact O-N 2.67Å
6	Q	95	Very high	93.7	Very high	100 Å²	100	97.3 Å²	97.3	47%	0.467	55%	0.55	S	S	.	*	H	α-helix	trans	-67.1	-37.7	178	-71.2	176	-24.1	0	0	111.5	I2 T3 D4 V9 F10	I2-Q6 HydrophobicContact CD1-CB 3.81Å; I2-Q6 VanDerWaalsContact CD1-OE1 3.24Å; I2-Q6 HydrophobicContact CG1-CB 3.82Å; T3-Q6 WeakPolarHBondContact O-CB 3.15Å; T3-Q6 PolarHBondContact O-N 2.59Å; D4-Q6 PolarHBondContact O-N 2.64Å; Q6-V9 PolarHBondContact O-N 2.68Å; Q6-F10 VanDerWaalsContact O-CB 3.3Å; Q6-F10 WeakPolarHBondContact O-CB 3.35Å; Q6-F10 PolarHBondContact O-N 2.7Å
7	L	94.5	Very high	93.9	Very high	89 Å²	89	95.7 Å²	95.7	47%	0.466	54%	0.543	S	S	.	.	H	α-helix	trans	-63.6	-42.8	174.1	-67.2	176	0	0	0	111.2	I2 T3 D4 V5 F10 A11	I2-L7 HydrophobicContact CG1-CD2 3.96Å; I2-L7 HydrophobicContact CG1-CG 4.04Å; I2-L7 HydrophobicContact CG2-CD1 4.38Å; I2-L7 HydrophobicContact CG2-CD2 4.25Å; I2-L7 HydrophobicContact CG2-CG 4.29Å; T3-L7 PolarHBondContact O-N 2.96Å; D4-L7 WeakPolarHBondContact O-CB 3.49Å; D4-L7 PolarHBondContact O-N 2.7Å; V5-L7 VanDerWaalsContact C-N 3.35Å; L7-F10 PolarHBondContact O-N 2.93Å; L7-A11 WeakPolarHBondContact O-CB 3.12Å; L7-A11 PolarHBondContact O-N 2.74Å
8	T	95.8	Very high	94	Very high	82 Å²	82	96.6 Å²	96.6	50%	0.503	55%	0.545	S	S	.	.	H	α-helix	trans	-63	-45.4	175.8	-55.8	0	0	0	0	112	D4 V5 F10 A11 N12	D4-T8 PolarHBondContact O-N 2.82Å; D4-T8 PolarHBondContact O-OG1 2.88Å; D4-T8 VanDerWaalsContact O-OG1 3.1Å; V5-T8 PolarHBondContact O-N 2.61Å; T8-F10 VanDerWaalsContact C-N 3.32Å; T8-F10 PolarHBondContact O-N 3.25Å; T8-A11 PolarHBondContact O-N 3.44Å; T8-N12 WeakPolarHBondContact O-CB 3.38Å; T8-N12 PolarHBondContact O-N 3.45Å; T8-N12 PolarHBondContact O-ND2 3.5Å
9	V	96.5	Very high	94.2	Very high	91 Å²	91	99.3 Å²	99.3	55%	0.552	55%	0.551	S	S	*	*	H	α-helix	trans	-61.8	-43.3	176.8	172.1	0	0	0	0	110.6	V5 Q6 N12 L13	V5-V9 VanDerWaalsContact O-CG2 3.31Å; V5-V9 WeakPolarHBondContact O-CG2 3.44Å; V5-V9 PolarHBondContact O-N 2.67Å; Q6-V9 PolarHBondContact O-N 2.68Å; V9-N12 PolarHBondContact O-N 3.38Å; V9-L13 WeakPolarHBondContact O-CB 3.02Å; V9-L13 PolarHBondContact O-N 2.88Å
10	F	94.9	Very high	94.3	Very high	145 Å²	145	100.2 Å²	100.2	64%	0.636	55%	0.554	S	S	*	*	H	α-helix	trans	-64.1	-42.4	177.3	-174.3	-101	0	0	0	112.3	Q6 L7 T8 L13 A14	Q6-F10 VanDerWaalsContact O-CB 3.3Å; Q6-F10 WeakPolarHBondContact O-CB 3.35Å; Q6-F10 PolarHBondContact O-N 2.7Å; L7-F10 PolarHBondContact O-N 2.93Å; T8-F10 VanDerWaalsContact C-N 3.32Å; T8-F10 PolarHBondContact O-N 3.25Å; F10-L13 PolarHBondContact O-N 2.81Å; F10-A14 VanDerWaalsContact O-CB 3.27Å; F10-A14 WeakPolarHBondContact O-CB 3.4Å; F10-A14 PolarHBondContact O-N 3.33Å
11	A	96.2	Very high	94.4	Very high	60 Å²	60	100.1 Å²	100.1	50%	0.496	55%	0.552	S	S	.	*	H	α-helix	trans	-63.8	-42.7	176.1	0	0	0	0	0	112.1	L7 T8 A14 G15	L7-A11 WeakPolarHBondContact O-CB 3.12Å; L7-A11 PolarHBondContact O-N 2.74Å; T8-A11 PolarHBondContact O-N 3.44Å; A11-A14 PolarHBondContact O-N 3.49Å; A11-G15 PolarHBondContact O-N 2.84Å
12	N	95.9	Very high	95.3	Very high	110 Å²	110	93.9 Å²	93.9	59%	0.588	53%	0.527	S	S	*	.	H	α-helix	trans	-64.8	-41.4	175.3	-75	-24.6	0	0	0	111.9	T8 V9 S16	T8-N12 WeakPolarHBondContact O-CB 3.38Å; T8-N12 PolarHBondContact O-N 3.45Å; T8-N12 PolarHBondContact O-ND2 3.5Å; V9-N12 PolarHBondContact O-N 3.38Å; N12-S16 WeakPolarHBondContact O-CB 3.38Å; N12-S16 PolarHBondContact O-N 3.29Å; N12-S16 PolarHBondContact O-OG 2.89Å
13	L	96.9	Very high	95.9	Very high	103 Å²	103	92.4 Å²	92.4	54%	0.539	52%	0.523	S	S	.	.	H	α-helix	trans	-65.4	-47.3	176.2	-176.3	63.3	0	0	0	111.1	V9 F10 G15 S16 V17	V9-L13 WeakPolarHBondContact O-CB 3.02Å; V9-L13 PolarHBondContact O-N 2.88Å; F10-L13 PolarHBondContact O-N 2.81Å; L13-G15 PolarHBondContact O-N 2.91Å; L13-S16 WeakPolarHBondContact CA-OG 3.1Å; L13-S16 PolarHBondContact O-N 3.23Å; L13-S16 PolarHBondContact O-OG 2.98Å; L13-V17 HydrophobicContact CD1-CG2 4.35Å; L13-V17 WeakPolarHBondContact O-CB 3.45Å; L13-V17 VanDerWaalsContact O-CG2 3.22Å; L13-V17 WeakPolarHBondContact O-CG2 3.38Å; L13-V17 PolarHBondContact O-N 3.33Å
14	A	96.8	Very high	96	Very high	40 Å²	40	93.5 Å²	93.5	33%	0.331	53%	0.525	S	S	.	.	H	α-helix	trans	-61.3	-43.7	176.5	0	0	0	0	0	111.7	F10 A11 V17 L18	F10-A14 VanDerWaalsContact O-CB 3.27Å; F10-A14 WeakPolarHBondContact O-CB 3.4Å; F10-A14 PolarHBondContact O-N 3.33Å; A11-A14 PolarHBondContact O-N 3.49Å; A14-V17 PolarHBondContact O-N 3.46Å; A14-L18 WeakPolarHBondContact O-CB 3.2Å; A14-L18 WeakPolarHBondContact O-CG 3.22Å; A14-L18 PolarHBondContact O-N 2.84Å
15	G	97.5	Very high	96	Very high	39 Å²	39	95 Å²	95	40%	0.402	52%	0.522	S	S	.	.	H	α-helix	trans	-62.8	-45.5	176.8	0	0	0	0	0	112.7	A11 L13 L18 F19	A11-G15 PolarHBondContact O-N 2.84Å; L13-G15 PolarHBondContact O-N 2.91Å; G15-L18 PolarHBondContact O-N 2.82Å; G15-F19 VanDerWaalsContact O-CB 3.29Å; G15-F19 WeakPolarHBondContact O-CB 3.31Å; G15-F19 PolarHBondContact O-N 3.37Å
16	S	97.6	Very high	95.9	Very high	52 Å²	52	96 Å²	96	36%	0.364	52%	0.52	S	S	.	.	H	α-helix	trans	-65.1	-42.3	176.9	58.3	0	0	0	0	112.3	N12 L13 F19 L20	N12-S16 WeakPolarHBondContact O-CB 3.38Å; N12-S16 PolarHBondContact O-N 3.29Å; N12-S16 PolarHBondContact O-OG 2.89Å; L13-S16 WeakPolarHBondContact CA-OG 3.1Å; L13-S16 PolarHBondContact O-N 3.23Å; L13-S16 PolarHBondContact O-OG 2.98Å; S16-F19 PolarHBondContact O-N 3.49Å; S16-L20 WeakPolarHBondContact O-CB 3.44Å; S16-L20 WeakPolarHBondContact O-CD1 3.35Å; S16-L20 PolarHBondContact O-N 3.29Å
17	V	97.4	Very high	95.8	Very high	71 Å²	71	98.3 Å²	98.3	43%	0.43	53%	0.525	S	S	.	.	H	α-helix	trans	-61.9	-46.7	175.7	171.2	0	0	0	0	111.3	L13 A14 F19 L20 L21	L13-V17 HydrophobicContact CD1-CG2 4.35Å; L13-V17 WeakPolarHBondContact O-CB 3.45Å; L13-V17 VanDerWaalsContact O-CG2 3.22Å; L13-V17 WeakPolarHBondContact O-CG2 3.38Å; L13-V17 PolarHBondContact O-N 3.33Å; A14-V17 PolarHBondContact O-N 3.46Å; V17-F19 VanDerWaalsContact C-N 3.35Å; V17-F19 PolarHBondContact O-N 3.42Å; V17-L20 PolarHBondContact O-N 3.5Å; V17-L21 HydrophobicContact CG1-CD1 4Å; V17-L21 HydrophobicContact CG1-CG 4.44Å; V17-L21 WeakPolarHBondContact O-CB 3.38Å; V17-L21 VanDerWaalsContact O-CG 3.31Å; V17-L21 WeakPolarHBondContact O-CG 3.21Å; V17-L21 PolarHBondContact O-N 3.46Å
18	L	96.4	Very high	95.6	Very high	111 Å²	111	97.4 Å²	97.4	58%	0.581	52%	0.523	S	S	*	.	H	α-helix	trans	-62.4	-42.4	176.4	-73.9	175.6	0	0	0	111.8	A14 G15 L21 V22	A14-L18 WeakPolarHBondContact O-CB 3.2Å; A14-L18 WeakPolarHBondContact O-CG 3.22Å; A14-L18 PolarHBondContact O-N 2.84Å; G15-L18 PolarHBondContact O-N 2.82Å; L18-L21 PolarHBondContact O-N 3.49Å; L18-V22 WeakPolarHBondContact O-CG2 3.38Å; L18-V22 PolarHBondContact O-N 2.93Å
19	F	96.5	Very high	95.3	Very high	149 Å²	149	96.9 Å²	96.9	65%	0.654	52%	0.517	S	S	*	.	H	α-helix	trans	-60.7	-48	176.2	-176.8	-100.7	0	0	0	111.8	G15 S16 V17 L21 V22 V23	G15-F19 VanDerWaalsContact O-CB 3.29Å; G15-F19 WeakPolarHBondContact O-CB 3.31Å; G15-F19 PolarHBondContact O-N 3.37Å; S16-F19 PolarHBondContact O-N 3.49Å; V17-F19 VanDerWaalsContact C-N 3.35Å; V17-F19 PolarHBondContact O-N 3.42Å; F19-L21 PolarHBondContact O-N 3.37Å; F19-V22 PolarHBondContact O-N 2.87Å; F19-V23 HydrophobicContact CD1-CG2 4.38Å; F19-V23 HydrophobicContact CE1-CG2 4.03Å; F19-V23 HydrophobicContact CE2-CG2 4.48Å; F19-V23 HydrophobicContact CZ-CG2 4.08Å; F19-V23 WeakPolarHBondContact O-CG2 3.33Å; F19-V23 PolarHBondContact O-N 3Å
20	L	96.3	Very high	94.8	Very high	117 Å²	117	97.4 Å²	97.4	61%	0.613	52%	0.52	S	S	*	.	H	α-helix	trans	-58.9	-44.1	175.2	-92	141.1	0	0	0	112.1	S16 V17 V22 V23 L24	S16-L20 WeakPolarHBondContact O-CB 3.44Å; S16-L20 WeakPolarHBondContact O-CD1 3.35Å; S16-L20 PolarHBondContact O-N 3.29Å; V17-L20 PolarHBondContact O-N 3.5Å; L20-V22 PolarHBondContact O-N 2.91Å; L20-V23 PolarHBondContact O-N 2.99Å; L20-L24 WeakPolarHBondContact O-CB 3.43Å; L20-L24 PolarHBondContact O-N 2.93Å
21	L	96.1	Very high	94.3	Very high	99 Å²	99	94.8 Å²	94.8	52%	0.518	51%	0.513	S	S	.	.	H	α-helix	trans	-62.9	-41	177.8	-76.2	172.1	0	0	0	112.3	V17 L18 F19 L24 Y25	V17-L21 HydrophobicContact CG1-CD1 4Å; V17-L21 HydrophobicContact CG1-CG 4.44Å; V17-L21 WeakPolarHBondContact O-CB 3.38Å; V17-L21 VanDerWaalsContact O-CG 3.31Å; V17-L21 WeakPolarHBondContact O-CG 3.21Å; V17-L21 PolarHBondContact O-N 3.46Å; L18-L21 PolarHBondContact O-N 3.49Å; F19-L21 PolarHBondContact O-N 3.37Å; L21-L24 PolarHBondContact O-N 2.91Å; L21-Y25 WeakPolarHBondContact O-CB 3.29Å; L21-Y25 PolarHBondContact O-N 3.48Å
22	V	96.8	Very high	93.1	Very high	97 Å²	97	97.2 Å²	97.2	59%	0.588	51%	0.514	S	S	*	.	H	α-helix	trans	-66.4	-45.1	177.5	171.4	0	0	0	0	111.2	L18 F19 L20 Y25 H26	L18-V22 WeakPolarHBondContact O-CG2 3.38Å; L18-V22 PolarHBondContact O-N 2.93Å; F19-V22 PolarHBondContact O-N 2.87Å; L20-V22 PolarHBondContact O-N 2.91Å; V22-Y25 PolarHBondContact O-N 3.46Å; V22-H26 WeakPolarHBondContact O-CB 3.42Å; V22-H26 PolarHBondContact O-N 2.88Å
23	V	96.2	Very high	91.6	Very high	78 Å²	78	100.2 Å²	100.2	47%	0.473	52%	0.521	S	S	.	.	H	α-helix	trans	-62.7	-45.2	176.4	172.7	0	0	0	0	110.6	F19 L20 H26 Y27	F19-V23 HydrophobicContact CD1-CG2 4.38Å; F19-V23 HydrophobicContact CE1-CG2 4.03Å; F19-V23 HydrophobicContact CE2-CG2 4.48Å; F19-V23 HydrophobicContact CZ-CG2 4.08Å; F19-V23 WeakPolarHBondContact O-CG2 3.33Å; F19-V23 PolarHBondContact O-N 3Å; L20-V23 PolarHBondContact O-N 2.99Å; V23-H26 PolarHBondContact O-N 3.33Å; V23-Y27 WeakPolarHBondContact O-CB 3.27Å; V23-Y27 PolarHBondContact O-N 2.89Å
24	L	94.9	Very high	89.9	Confident	97 Å²	97	100.6 Å²	100.6	51%	0.508	53%	0.528	S	S	.	.	H	α-helix	trans	-62.2	-44.8	177.2	-177.7	62.1	0	0	0	111.1	L20 L21 H26 Y27 V28	L20-L24 WeakPolarHBondContact O-CB 3.43Å; L20-L24 PolarHBondContact O-N 2.93Å; L21-L24 PolarHBondContact O-N 2.91Å; L24-H26 VanDerWaalsContact C-N 3.33Å; L24-H26 PolarHBondContact O-N 3.47Å; L24-Y27 PolarHBondContact O-N 2.95Å; L24-V28 HydrophobicContact CD1-CG2 4.18Å; L24-V28 HydrophobicContact CG-CG2 4.3Å; L24-V28 WeakPolarHBondContact O-CG2 3.34Å; L24-V28 PolarHBondContact O-N 2.82Å
25	Y	93.3	Very high	88	Confident	161 Å²	161	103.7 Å²	103.7	63%	0.631	55%	0.545	S	S	*	.	H	α-helix	trans	-58.6	-45.7	175.7	177.5	-104.4	0	0	0	111.5	L21 V22 V28 I29	L21-Y25 WeakPolarHBondContact O-CB 3.29Å; L21-Y25 PolarHBondContact O-N 3.48Å; V22-Y25 PolarHBondContact O-N 3.46Å; Y25-V28 PolarHBondContact O-N 3.4Å; Y25-I29 HydrophobicContact CD1-CD1 3.78Å; Y25-I29 HydrophobicContact CD2-CD1 4.39Å; Y25-I29 HydrophobicContact CE1-CD1 3.21Å; Y25-I29 HydrophobicContact CE1-CG1 4.38Å; Y25-I29 HydrophobicContact CE2-CD1 3.89Å; Y25-I29 HydrophobicContact CE2-CG1 4.46Å; Y25-I29 HydrophobicContact CG-CD1 4.35Å; Y25-I29 WeakPolarHBondContact O-CG1 3.45Å; Y25-I29 PolarHBondContact O-N 2.91Å
26	H	92.5	Very high	85.9	Confident	125 Å²	125	111 Å²	111	58%	0.579	57%	0.566	S	S	*	*	H	α-helix	trans	-63.5	-43.5	176.9	-158.3	76.4	0	0	0	111.6	V22 V23 L24 V28 I29 V30	V22-H26 WeakPolarHBondContact O-CB 3.42Å; V22-H26 PolarHBondContact O-N 2.88Å; V23-H26 PolarHBondContact O-N 3.33Å; L24-H26 VanDerWaalsContact C-N 3.33Å; L24-H26 PolarHBondContact O-N 3.47Å; H26-V28 PolarHBondContact O-N 2.83Å; H26-I29 PolarHBondContact O-N 2.9Å; H26-V30 WeakPolarHBondContact O-CG2 3.44Å; H26-V30 PolarHBondContact O-N 3.44Å
27	Y	92.2	Very high	84.1	Confident	148 Å²	148	114.3 Å²	114.3	58%	0.58	58%	0.584	S	S	*	*	H	α-helix	trans	-61.3	-43.9	175.7	-177.9	-96.4	0	0	0	111.9	V23 L24 I29 V30 N31	V23-Y27 WeakPolarHBondContact O-CB 3.27Å; V23-Y27 PolarHBondContact O-N 2.89Å; L24-Y27 PolarHBondContact O-N 2.95Å; Y27-I29 VanDerWaalsContact C-N 3.35Å; Y27-I29 PolarHBondContact O-N 3.39Å; Y27-V30 PolarHBondContact O-N 2.88Å; Y27-N31 HydrophobicContact CE1-CB 4.29Å; Y27-N31 WeakPolarHBondContact O-CB 3.3Å; Y27-N31 PolarHBondContact O-N 2.94Å
28	V	91.5	Very high	82	Confident	70 Å²	70	116.8 Å²	116.8	42%	0.424	59%	0.594	S	S	.	*	H	α-helix	trans	-65.7	-38.1	176.7	-176.3	0	0	0	0	110.2	L24 Y25 H26 N31 Q32	L24-V28 HydrophobicContact CD1-CG2 4.18Å; L24-V28 HydrophobicContact CG-CG2 4.3Å; L24-V28 WeakPolarHBondContact O-CG2 3.34Å; L24-V28 PolarHBondContact O-N 2.82Å; Y25-V28 PolarHBondContact O-N 3.4Å; H26-V28 PolarHBondContact O-N 2.83Å; V28-N31 PolarHBondContact O-N 3.33Å; V28-Q32 WeakPolarHBondContact O-CA 3.31Å; V28-Q32 WeakPolarHBondContact O-CB 3.34Å; V28-Q32 WeakPolarHBondContact O-CG 3.34Å; V28-Q32 PolarHBondContact O-N 3.36Å; V28-Q32 PolarHBondContact O-NE2 3.36Å
29	I	88.3	Confident	79.9	Confident	72 Å²	72	120.8 Å²	120.8	37%	0.369	61%	0.607	S	S	.	*	H	α-helix	trans	-63.8	-44	174.8	-72.7	176.4	0	0	0	112.5	Y25 H26 Y27 N31 Q32	Y25-I29 HydrophobicContact CD1-CD1 3.78Å; Y25-I29 HydrophobicContact CD2-CD1 4.39Å; Y25-I29 HydrophobicContact CE1-CD1 3.21Å; Y25-I29 HydrophobicContact CE1-CG1 4.38Å; Y25-I29 HydrophobicContact CE2-CD1 3.89Å; Y25-I29 HydrophobicContact CE2-CG1 4.46Å; Y25-I29 HydrophobicContact CG-CD1 4.35Å; Y25-I29 WeakPolarHBondContact O-CG1 3.45Å; Y25-I29 PolarHBondContact O-N 2.91Å; H26-I29 PolarHBondContact O-N 2.9Å; Y27-I29 VanDerWaalsContact C-N 3.35Å; Y27-I29 PolarHBondContact O-N 3.39Å; I29-N31 VanDerWaalsContact C-N 3.34Å; I29-Q32 WeakPolarHBondContact O-CG 3.41Å
30	V	87.2	Confident	78.1	Confident	102 Å²	102	123.1 Å²	123.1	62%	0.618	61%	0.611	S	S	*	*	H	α-helix	trans	-68.6	-38.1	178.1	172.5	0	0	0	0	110.7	H26 Y27	H26-V30 WeakPolarHBondContact O-CG2 3.44Å; H26-V30 PolarHBondContact O-N 3.44Å; Y27-V30 PolarHBondContact O-N 2.88Å
31	N	84.4	Confident	76	Confident	90 Å²	90	126.3 Å²	126.3	48%	0.481	62%	0.62	S	S	.	*	H	α-helix	trans	-92.4	-12.1	-175.4	-164.7	47.2	0	0	0	114.5	Y27 V28 I29 K33	Y27-N31 HydrophobicContact CE1-CB 4.29Å; Y27-N31 WeakPolarHBondContact O-CB 3.3Å; Y27-N31 PolarHBondContact O-N 2.94Å; V28-N31 PolarHBondContact O-N 3.33Å; I29-N31 VanDerWaalsContact C-N 3.34Å; N31-K33 PolarHBondContact O-N 3.47Å
32	Q	69.7	Low	74.3	Confident	110 Å²	110	128.9 Å²	128.9	51%	0.514	63%	0.633	S	S	.	*			trans	-72.3	70.1	165.5	66.5	-165.3	-92	0	0	107.8	V28 I29 T34	V28-Q32 WeakPolarHBondContact O-CA 3.31Å; V28-Q32 WeakPolarHBondContact O-CB 3.34Å; V28-Q32 WeakPolarHBondContact O-CG 3.34Å; V28-Q32 PolarHBondContact O-N 3.36Å; V28-Q32 PolarHBondContact O-NE2 3.36Å; I29-Q32 WeakPolarHBondContact O-CG 3.41Å; Q32-T34 PolarHBondContact O-N 3.39Å
33	K	64.6	Low	72.2	Confident	173 Å²	173	132.9 Å²	132.9	75%	0.752	64%	0.642	S	S	*	*			trans	-56.9	99.5	145.8	-55.4	-175.2	-171.8	-159.8	0	102.5	N31	N31-K33 PolarHBondContact O-N 3.47Å
34	T	62	Low	70.2	Confident	112 Å²	112	132.3 Å²	132.3	69%	0.687	65%	0.653	S	S	*	*			trans	-22.2	112	170.9	-66.3	0	0	0	0	107	Q32 K36	Q32-T34 PolarHBondContact O-N 3.39Å; T34-K36 PolarHBondContact O-N 3.33Å
35	P	56	Low	68.3	Low	104 Å²	104	134.3 Å²	134.3	68%	0.675	67%	0.669	S	S	*	*			trans	-52.6	111.2	170.3	20.9	-29	0	0	0	101.7	V37	P35-V37 PolarHBondContact O-N 2.94Å
36	K	55	Low	66.6	Low	193 Å²	193	134.3 Å²	134.3	84%	0.839	67%	0.674	S	S	*	*			trans	-61.7	88.4	169.2	-69.8	-172.9	-179.4	179.9	0	100.3	T34 N38	T34-K36 PolarHBondContact O-N 3.33Å; K36-N38 WeakPolarHBondContact O-CA 3.48Å; K36-N38 PolarHBondContact O-N 2.85Å
37	V	59.3	Low	65.2	Low	122 Å²	122	132.9 Å²	132.9	74%	0.739	68%	0.684	S	S	*	*			trans	-46.5	99.1	155.2	159.2	0	0	0	0	99.1	P35 K39	P35-V37 PolarHBondContact O-N 2.94Å; V37-K39 PolarHBondContact O-N 3.46Å
38	N	52.3	Low	63.6	Low	123 Å²	123	131.8 Å²	131.8	66%	0.658	69%	0.688	S	S	*	*			trans	-57.4	99.1	-176.9	-179	36.8	0	0	0	100.4	K36 R40	K36-N38 WeakPolarHBondContact O-CA 3.48Å; K36-N38 PolarHBondContact O-N 2.85Å; N38-R40 PolarHBondContact O-N 3.43Å
39	K	53.1	Low	62.2	Low	194 Å²	194	132.2 Å²	132.2	84%	0.843	69%	0.694	S	S	*	*			trans	-68.7	78.3	178.8	-166	177.2	-169.6	-179.3	0	100.2	V37 K41	V37-K39 PolarHBondContact O-N 3.46Å; K39-K41 PolarHBondContact O-N 2.86Å
40	R	58.7	Low	61.2	Low	198 Å²	198	135.1 Å²	135.1	75%	0.747	72%	0.715	S	S	*	*			trans	-52.4	106.3	-177.5	-82.6	-179.1	174.8	163.7	-1.3	100.6	N38 I42	N38-R40 PolarHBondContact O-N 3.43Å; R40-I42 HydrophobicContact CB-CG1 4.09Å; R40-I42 PolarHBondContact O-N 3.1Å
41	K	52.1	Low	59.8	Low	185 Å²	185	135.7 Å²	135.7	80%	0.804	72%	0.721	S	S	*	*			trans	-69.2	69	178.6	-155.4	175.9	-175	-80.6	0	103.1	K39 K43	K39-K41 PolarHBondContact O-N 2.86Å; K41-K43 PolarHBondContact O-N 3.05Å
42	I	61	Low	59	Low	152 Å²	152	140.1 Å²	140.1	78%	0.779	76%	0.759	S	S	*	*			trans	-75.4	56.3	164.6	-55.4	-178.7	0	0	0	105.4	R40	R40-I42 HydrophobicContact CB-CG1 4.09Å; R40-I42 PolarHBondContact O-N 3.1Å
43	K	52.3	Low	58.5	Low	181 Å²	181	141.7 Å²	141.7	79%	0.787	77%	0.771	S	S	*	*			trans	-137.3	53.5	171.2	-161.1	170.2	-177.1	176.2	0	106.5	K41	K41-K43 PolarHBondContact O-N 3.05Å
44	G	53.3	Low	58.1	Low	67 Å²	67	140 Å²	140	69%	0.691	77%	0.772	S	S	*	*			trans	-146.2	14.1	-179.5	0	0	0	0	0	112.7
45	V	56.1	Low	57.9	Low	139 Å²	139	141.6 Å²	141.6	84%	0.842	78%	0.777	S	S	*	*			trans	-118.6	56.1	164	-171.6	0	0	0	0	107.1
46	E	58.2	Low	58	Low	161 Å²	161	143.8 Å²	143.8	75%	0.752	78%	0.783	S	S	*	*			trans	-103.5	83.9	151.8	-155.4	164.3	109.9	0	0	102.9	D48	E46-D48 PolarHBondContact O-N 3.22Å
47	A	62	Low	58.2	Low	94 Å²	94	140.7 Å²	140.7	78%	0.777	78%	0.78	S	S	*	*			trans	-69.6	89.2	168.3	0	0	0	0	0	105.5	S49	A47-S49 PolarHBondContact O-N 3.27Å
48	D	58.8	Low	58.2	Low	125 Å²	125	141.9 Å²	141.9	67%	0.668	78%	0.782	S	S	*	*			trans	-55.4	117	167.8	-126.9	-50.6	0	0	0	108.4	E46	E46-D48 PolarHBondContact O-N 3.22Å
49	S	61.4	Low	58.6	Low	79 Å²	79	143.3 Å²	143.3	55%	0.552	79%	0.791	S	S	*	*			trans	28.3	108.8	134.6	70.9	0	0	0	0	117.2	A47	A47-S49 PolarHBondContact O-N 3.27Å
50	V	67	Low	59	Low	133 Å²	133	139.4 Å²	139.4	81%	0.806	79%	0.787	S	S	*	*			trans	-124.3	87.2	142.4	-175.5	0	0	0	0	107.9
51	P	59.6	Low	59	Low	114 Å²	114	134.5 Å²	134.5	74%	0.74	79%	0.791	S	S	*	*			trans	-76.2	125.5	157	31.2	-29	0	0	0	108.1
52	S	66.5	Low	59.6	Low	184 Å²	184	129.9 Å²	129.9	100%	1.287	79%	0.789	S	S	*	*			trans	-127.9	0	159.2	-64.8	0	0	0	0	107.7

Retrieved 52 of 52 residues in 10.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).