G4VMW7_SCHMA Loading...

Syntaxin-5

AlphaFold DB , UniProt , Accession G4VMW7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 69 aa.

						>G4VMW7_SCHMA|G4VMW7
MEALQQKILNLTSKFMHLQEVVSNIHVRDARSSSVSQQHIAVAFPGNCENIRPPAGLLGYVQTCRSHSL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.6	Low	87.7	Confident	206 Å²	206	124.6 Å²	124.6	100%	1.015	63%	0.634	S	S	*	*				0	-46.1	0	-75.5	-68.9	-93.2	0	0	111.8	A3 L4 Q5	M1-A3 VanDerWaalsContact C-N 3.32Å; M1-A3 PolarHBondContact O-N 3.18Å; M1-L4 PolarHBondContact O-N 2.95Å; M1-Q5 PolarHBondContact O-N 3.33Å
2	E	81.8	Confident	87.9	Confident	158 Å²	158	120.3 Å²	120.3	74%	0.738	62%	0.618	S	S	*	*	H	α-helix	trans	-55.5	-37.7	-179	-65.8	-179.1	165.2	0	0	115.1	L4 Q5 Q6	E2-L4 VanDerWaalsContact C-N 3.31Å; E2-L4 PolarHBondContact O-N 3.27Å; E2-Q5 PolarHBondContact O-N 3.23Å; E2-Q6 WeakPolarHBondContact O-CB 3.49Å; E2-Q6 PolarHBondContact O-N 3.43Å
3	A	85.4	Confident	87.9	Confident	74 Å²	74	117 Å²	117	61%	0.612	61%	0.612	S	S	*	*	H	α-helix	trans	-63.1	-33.2	-179.8	0	0	0	0	0	113.9	M1 K7	M1-A3 VanDerWaalsContact C-N 3.32Å; M1-A3 PolarHBondContact O-N 3.18Å; A3-K7 WeakPolarHBondContact O-CG 3.4Å; A3-K7 PolarHBondContact O-N 3.27Å
4	L	89.1	Confident	88	Confident	108 Å²	108	117.6 Å²	117.6	57%	0.565	61%	0.607	S	S	*	*	H	α-helix	trans	-74.9	-42.1	177	-179.8	61.2	0	0	0	110.6	M1 E2 Q6 K7 I8	M1-L4 PolarHBondContact O-N 2.95Å; E2-L4 VanDerWaalsContact C-N 3.31Å; E2-L4 PolarHBondContact O-N 3.27Å; L4-Q6 VanDerWaalsContact C-N 3.32Å; L4-Q6 PolarHBondContact O-N 3.3Å; L4-K7 PolarHBondContact O-N 2.96Å; L4-K7 VanDerWaalsContact O-N 3.14Å; L4-I8 HydrophobicContact CD1-CD1 4.42Å; L4-I8 HydrophobicContact CG-CD1 4.1Å; L4-I8 WeakPolarHBondContact O-CG1 3.43Å; L4-I8 PolarHBondContact O-N 3.49Å
5	Q	90.8	Very high	87.9	Confident	125 Å²	125	119.1 Å²	119.1	58%	0.584	61%	0.608	S	S	*	*	H	α-helix	trans	-59.9	-43	176.7	-173.5	178.3	-5.4	0	0	111.6	M1 E2 K7 I8 L9	M1-Q5 PolarHBondContact O-N 3.33Å; E2-Q5 PolarHBondContact O-N 3.23Å; Q5-K7 PolarHBondContact O-N 3.05Å; Q5-I8 PolarHBondContact O-N 3.43Å; Q5-L9 HydrophobicContact CG-CD1 4.28Å; Q5-L9 WeakPolarHBondContact O-CG 3.43Å; Q5-L9 PolarHBondContact O-N 2.95Å
6	Q	91.7	Very high	87.4	Confident	138 Å²	138	119.3 Å²	119.3	65%	0.645	61%	0.607	S	S	*	*	H	α-helix	trans	-58.4	-43.7	173	-83.5	-91	-22.1	0	0	112.5	E2 L4 L9 N10	E2-Q6 WeakPolarHBondContact O-CB 3.49Å; E2-Q6 PolarHBondContact O-N 3.43Å; L4-Q6 VanDerWaalsContact C-N 3.32Å; L4-Q6 PolarHBondContact O-N 3.3Å; Q6-L9 PolarHBondContact O-N 3.47Å; Q6-N10 WeakPolarHBondContact O-CB 3.46Å; Q6-N10 PolarHBondContact O-N 3.14Å
7	K	92.7	Very high	87.1	Confident	149 Å²	149	119.1 Å²	119.1	65%	0.648	60%	0.603	S	S	*	*	H	α-helix	trans	-64.9	-40.9	176.8	-75.2	-177.6	-178.1	-176	0	112.4	A3 L4 Q5 N10 L11	A3-K7 WeakPolarHBondContact O-CG 3.4Å; A3-K7 PolarHBondContact O-N 3.27Å; L4-K7 PolarHBondContact O-N 2.96Å; L4-K7 VanDerWaalsContact O-N 3.14Å; Q5-K7 PolarHBondContact O-N 3.05Å; K7-N10 PolarHBondContact O-N 3.46Å; K7-L11 PolarHBondContact O-N 2.92Å
8	I	93	Very high	86.4	Confident	93 Å²	93	118.4 Å²	118.4	48%	0.477	60%	0.601	S	S	.	*	H	α-helix	trans	-63.3	-50.3	177.3	-67.6	169.6	0	0	0	109.9	L4 Q5 N10 L11 T12	L4-I8 HydrophobicContact CD1-CD1 4.42Å; L4-I8 HydrophobicContact CG-CD1 4.1Å; L4-I8 WeakPolarHBondContact O-CG1 3.43Å; L4-I8 PolarHBondContact O-N 3.49Å; Q5-I8 PolarHBondContact O-N 3.43Å; I8-N10 VanDerWaalsContact C-N 3.29Å; I8-N10 PolarHBondContact O-N 3.29Å; I8-L11 WeakPolarHBondContact O-CB 3.36Å; I8-L11 PolarHBondContact O-N 2.89Å; I8-L11 VanDerWaalsContact O-N 3.11Å; I8-T12 PolarHBondContact O-N 3.05Å; I8-T12 PolarHBondContact O-OG1 3.11Å
9	L	93.3	Very high	85.8	Confident	106 Å²	106	118.3 Å²	118.3	56%	0.555	60%	0.598	S	S	*	*	H	α-helix	trans	-56.5	-41.9	178.3	-76.1	167.5	0	0	0	112.5	Q5 Q6 T12 S13	Q5-L9 HydrophobicContact CG-CD1 4.28Å; Q5-L9 WeakPolarHBondContact O-CG 3.43Å; Q5-L9 PolarHBondContact O-N 2.95Å; Q6-L9 PolarHBondContact O-N 3.47Å; L9-T12 PolarHBondContact O-N 3.07Å; L9-S13 WeakPolarHBondContact O-CB 3.27Å; L9-S13 PolarHBondContact O-N 3.46Å
10	N	92.7	Very high	85.3	Confident	90 Å²	90	118.4 Å²	118.4	48%	0.481	60%	0.596	S	S	.	*	H	α-helix	trans	-64.3	-43.5	177.2	-167.4	-13.3	0	0	0	111.9	Q6 K7 I8 S13 K14	Q6-N10 WeakPolarHBondContact O-CB 3.46Å; Q6-N10 PolarHBondContact O-N 3.14Å; K7-N10 PolarHBondContact O-N 3.46Å; I8-N10 VanDerWaalsContact C-N 3.29Å; I8-N10 PolarHBondContact O-N 3.29Å; N10-S13 PolarHBondContact O-N 2.95Å; N10-K14 WeakPolarHBondContact O-CG 3.48Å; N10-K14 PolarHBondContact O-N 3.44Å; N10-K14 VanDerWaalsContact OD1-CE 3.27Å; N10-K14 WeakPolarHBondContact OD1-CE 3.48Å
11	L	90.9	Very high	84.7	Confident	124 Å²	124	116 Å²	116	65%	0.649	59%	0.587	S	S	*	*	H	α-helix	trans	-62.6	-46.3	175.2	-91.1	159	0	0	0	112.1	K7 I8 S13 K14 F15	K7-L11 PolarHBondContact O-N 2.92Å; I8-L11 WeakPolarHBondContact O-CB 3.36Å; I8-L11 PolarHBondContact O-N 2.89Å; I8-L11 VanDerWaalsContact O-N 3.11Å; L11-S13 VanDerWaalsContact C-N 3.32Å; L11-S13 PolarHBondContact O-N 3.47Å; L11-K14 PolarHBondContact O-N 3.41Å; L11-F15 PolarHBondContact O-N 3.29Å
12	T	90.1	Very high	85.1	Confident	72 Å²	72	110.7 Å²	110.7	44%	0.442	57%	0.566	S	S	.	*	H	α-helix	trans	-62.8	-40.8	179.2	-44.2	0	0	0	0	111.3	I8 L9 F15 M16	I8-T12 PolarHBondContact O-N 3.05Å; I8-T12 PolarHBondContact O-OG1 3.11Å; L9-T12 PolarHBondContact O-N 3.07Å; T12-F15 PolarHBondContact O-N 2.98Å; T12-M16 WeakPolarHBondContact O-CG 3.47Å; T12-M16 PolarHBondContact O-N 3.43Å
13	S	88	Confident	84.5	Confident	78 Å²	78	107.6 Å²	107.6	55%	0.545	56%	0.562	S	S	.	*	H	α-helix	trans	-61.4	-45.8	175.8	174.9	0	0	0	0	112.1	L9 N10 L11 F15 M16 H17	L9-S13 WeakPolarHBondContact O-CB 3.27Å; L9-S13 PolarHBondContact O-N 3.46Å; N10-S13 PolarHBondContact O-N 2.95Å; L11-S13 VanDerWaalsContact C-N 3.32Å; L11-S13 PolarHBondContact O-N 3.47Å; S13-F15 VanDerWaalsContact C-N 3.31Å; S13-F15 PolarHBondContact O-N 3.02Å; S13-M16 PolarHBondContact O-N 3.36Å; S13-H17 PolarHBondContact O-N 2.95Å
14	K	88.4	Confident	83.3	Confident	126 Å²	126	108.7 Å²	108.7	55%	0.548	56%	0.558	S	S	.	*	H	α-helix	trans	-61.5	-39.3	175.7	-72.4	177.8	-179.7	-178.3	0	112.4	N10 L11 H17 L18	N10-K14 WeakPolarHBondContact O-CG 3.48Å; N10-K14 PolarHBondContact O-N 3.44Å; N10-K14 VanDerWaalsContact OD1-CE 3.27Å; N10-K14 WeakPolarHBondContact OD1-CE 3.48Å; L11-K14 PolarHBondContact O-N 3.41Å; K14-H17 PolarHBondContact O-N 2.95Å; K14-L18 WeakPolarHBondContact O-CB 3.4Å; K14-L18 WeakPolarHBondContact O-CG 3.5Å; K14-L18 PolarHBondContact O-N 2.95Å
15	F	86.4	Confident	82.2	Confident	140 Å²	140	108.6 Å²	108.6	61%	0.614	56%	0.556	S	S	*	*	H	α-helix	trans	-66.4	-45	178.2	-170.1	-93.7	0	0	0	112	L11 T12 S13 H17 L18 Q19	L11-F15 PolarHBondContact O-N 3.29Å; T12-F15 PolarHBondContact O-N 2.98Å; S13-F15 VanDerWaalsContact C-N 3.31Å; S13-F15 PolarHBondContact O-N 3.02Å; F15-H17 VanDerWaalsContact C-N 3.33Å; F15-H17 PolarHBondContact O-N 3.36Å; F15-L18 PolarHBondContact O-N 3.01Å; F15-Q19 PolarHBondContact O-N 3.47Å
16	M	81.3	Confident	80.6	Confident	122 Å²	122	110.2 Å²	110.2	60%	0.601	56%	0.564	S	S	*	*	H	α-helix	trans	-58	-45.3	174.6	-74.3	-74.1	-160.7	0	0	111.5	T12 S13 L18 Q19 E20	T12-M16 WeakPolarHBondContact O-CG 3.47Å; T12-M16 PolarHBondContact O-N 3.43Å; S13-M16 PolarHBondContact O-N 3.36Å; M16-L18 PolarHBondContact O-N 3.3Å; M16-Q19 PolarHBondContact O-N 3.45Å; M16-E20 PolarHBondContact O-N 3.26Å
17	H	80.7	Confident	79	Confident	116 Å²	116	108.5 Å²	108.5	54%	0.537	56%	0.562	S	S	.	*	H	α-helix	trans	-64.1	-41.7	177.6	-174.2	-69.9	0	0	0	112	S13 K14 F15 Q19 E20 V21	S13-H17 PolarHBondContact O-N 2.95Å; K14-H17 PolarHBondContact O-N 2.95Å; F15-H17 VanDerWaalsContact C-N 3.33Å; F15-H17 PolarHBondContact O-N 3.36Å; H17-Q19 VanDerWaalsContact C-N 3.31Å; H17-Q19 PolarHBondContact O-N 3.37Å; H17-E20 PolarHBondContact O-N 3.5Å; H17-V21 VanDerWaalsContact CE1-CG2 3.48Å; H17-V21 WeakPolarHBondContact CE1-CG2 3.3Å; H17-V21 VanDerWaalsContact O-CG2 3.3Å; H17-V21 WeakPolarHBondContact O-CG2 3.45Å; H17-V21 PolarHBondContact O-N 2.93Å
18	L	75.8	Confident	77.1	Confident	106 Å²	106	112.4 Å²	112.4	56%	0.555	57%	0.573	S	S	*	*	H	α-helix	trans	-61.2	-41.7	174.9	-84.6	162.6	0	0	0	111.6	K14 F15 M16 V21 V22	K14-L18 WeakPolarHBondContact O-CB 3.4Å; K14-L18 WeakPolarHBondContact O-CG 3.5Å; K14-L18 PolarHBondContact O-N 2.95Å; F15-L18 PolarHBondContact O-N 3.01Å; M16-L18 PolarHBondContact O-N 3.3Å; L18-V21 PolarHBondContact O-N 3.24Å; L18-V22 WeakPolarHBondContact O-CB 3.39Å; L18-V22 VanDerWaalsContact O-CG2 3.26Å; L18-V22 WeakPolarHBondContact O-CG2 3.26Å; L18-V22 PolarHBondContact O-N 3.37Å
19	Q	74.5	Confident	74.9	Confident	116 Å²	116	113.1 Å²	113.1	54%	0.542	58%	0.578	S	S	.	*	H	α-helix	trans	-63.1	-41.8	177.9	-172.4	178	-0.4	0	0	111.8	F15 M16 H17 V22 S23	F15-Q19 PolarHBondContact O-N 3.47Å; M16-Q19 PolarHBondContact O-N 3.45Å; H17-Q19 VanDerWaalsContact C-N 3.31Å; H17-Q19 PolarHBondContact O-N 3.37Å; Q19-V22 PolarHBondContact O-N 3.28Å; Q19-S23 WeakPolarHBondContact O-CB 3.21Å; Q19-S23 PolarHBondContact O-N 2.79Å
20	E	75.5	Confident	72.9	Confident	120 Å²	120	110 Å²	110	56%	0.561	57%	0.567	S	S	*	*	H	α-helix	trans	-63.7	-46.8	174.9	-175.3	179.3	-175.9	0	0	111.6	M16 H17 V22 S23 N24	M16-E20 PolarHBondContact O-N 3.26Å; H17-E20 PolarHBondContact O-N 3.5Å; E20-V22 VanDerWaalsContact C-N 3.35Å; E20-V22 PolarHBondContact O-N 3.19Å; E20-S23 PolarHBondContact O-N 3.2Å; E20-N24 WeakPolarHBondContact O-CB 3.35Å; E20-N24 VanDerWaalsContact O-CG 3.26Å; E20-N24 PolarHBondContact O-N 3.03Å; E20-N24 PolarHBondContact O-ND2 3.43Å
21	V	73.4	Confident	70.8	Confident	68 Å²	68	115.9 Å²	115.9	41%	0.412	58%	0.583	S	S	.	*	H	α-helix	trans	-58.7	-47.6	177.1	171.5	0	0	0	0	110.6	H17 L18 S23 N24 I25	H17-V21 VanDerWaalsContact CE1-CG2 3.48Å; H17-V21 WeakPolarHBondContact CE1-CG2 3.3Å; H17-V21 VanDerWaalsContact O-CG2 3.3Å; H17-V21 WeakPolarHBondContact O-CG2 3.45Å; H17-V21 PolarHBondContact O-N 2.93Å; L18-V21 PolarHBondContact O-N 3.24Å; V21-S23 VanDerWaalsContact C-N 3.35Å; V21-S23 PolarHBondContact O-N 3.47Å; V21-N24 CarbonylContact O-C 3.52Å; V21-N24 PolarHBondContact O-N 3.35Å; V21-N24 VanDerWaalsContact O-N 3.08Å; V21-I25 WeakPolarHBondContact O-CG1 3.45Å; V21-I25 PolarHBondContact O-N 3.48Å
22	V	72.4	Confident	68.7	Low	95 Å²	95	115.6 Å²	115.6	58%	0.576	59%	0.591	S	S	*	*	H	α-helix	trans	-63.1	-41	178.6	171.9	0	0	0	0	111.3	L18 Q19 E20 N24 I25	L18-V22 WeakPolarHBondContact O-CB 3.39Å; L18-V22 VanDerWaalsContact O-CG2 3.26Å; L18-V22 WeakPolarHBondContact O-CG2 3.26Å; L18-V22 PolarHBondContact O-N 3.37Å; Q19-V22 PolarHBondContact O-N 3.28Å; E20-V22 VanDerWaalsContact C-N 3.35Å; E20-V22 PolarHBondContact O-N 3.19Å; V22-N24 PolarHBondContact O-N 3.08Å; V22-I25 WeakPolarHBondContact O-CB 3.41Å; V22-I25 PolarHBondContact O-N 3.47Å
23	S	68.6	Low	66.5	Low	94 Å²	94	115.5 Å²	115.5	66%	0.657	59%	0.593	S	S	*	*	H	α-helix	trans	-64.7	-28.2	174.5	-171.3	0	0	0	0	112.7	Q19 E20 V21	Q19-S23 WeakPolarHBondContact O-CB 3.21Å; Q19-S23 PolarHBondContact O-N 2.79Å; E20-S23 PolarHBondContact O-N 3.2Å; V21-S23 VanDerWaalsContact C-N 3.35Å; V21-S23 PolarHBondContact O-N 3.47Å
24	N	60.7	Low	64.5	Low	96 Å²	96	116.3 Å²	116.3	51%	0.513	60%	0.599	S	S	.	*	H	α-helix	trans	-86.3	-9.7	177.9	-73.2	-26.4	0	0	0	113.4	E20 V21 V22 H26	E20-N24 WeakPolarHBondContact O-CB 3.35Å; E20-N24 VanDerWaalsContact O-CG 3.26Å; E20-N24 PolarHBondContact O-N 3.03Å; E20-N24 PolarHBondContact O-ND2 3.43Å; V21-N24 CarbonylContact O-C 3.52Å; V21-N24 PolarHBondContact O-N 3.35Å; V21-N24 VanDerWaalsContact O-N 3.08Å; V22-N24 PolarHBondContact O-N 3.08Å; N24-H26 PolarHBondContact O-N 2.88Å; N24-H26 PolarHBondContact O-ND1 2.89Å
25	I	65.7	Low	62.3	Low	106 Å²	106	117.5 Å²	117.5	54%	0.544	62%	0.616	S	S	.	*			trans	-67.1	88.8	168	-63.6	170.3	0	0	0	107.4	V21 V22 V27	V21-I25 WeakPolarHBondContact O-CG1 3.45Å; V21-I25 PolarHBondContact O-N 3.48Å; V22-I25 WeakPolarHBondContact O-CB 3.41Å; V22-I25 PolarHBondContact O-N 3.47Å; I25-V27 VanDerWaalsContact C-N 3.31Å; I25-V27 HydrophobicContact CG2-CG2 4.25Å; I25-V27 PolarHBondContact O-N 2.9Å
26	H	56.4	Low	60.3	Low	160 Å²	160	115.1 Å²	115.1	74%	0.741	62%	0.617	S	S	*	*			trans	-71.2	94	165.3	-77.3	73.6	0	0	0	107.2	N24 R28	N24-H26 PolarHBondContact O-N 2.88Å; N24-H26 PolarHBondContact O-ND1 2.89Å; H26-R28 VanDerWaalsContact C-N 3.27Å; H26-R28 PolarHBondContact O-N 3.23Å
27	V	59.2	Low	58.8	Low	101 Å²	101	117.7 Å²	117.7	61%	0.612	63%	0.628	S	S	*	*			trans	-59.2	101.9	158.6	-178.1	0	0	0	0	104.8	I25 D29 I40	I25-V27 VanDerWaalsContact C-N 3.31Å; I25-V27 HydrophobicContact CG2-CG2 4.25Å; I25-V27 PolarHBondContact O-N 2.9Å; V27-D29 VanDerWaalsContact C-N 3.27Å; V27-D29 PolarHBondContact O-N 3.16Å; V27-I40 HydrophobicContact CG1-CD1 3.92Å
28	R	51.5	Low	57	Low	232 Å²	232	117.3 Å²	117.3	88%	0.875	63%	0.626	S	S	*	*			trans	-57.7	99.6	173.5	-86.4	-174	174.8	-178.1	-0.8	106.6	H26 A30	H26-R28 VanDerWaalsContact C-N 3.27Å; H26-R28 PolarHBondContact O-N 3.23Å; R28-A30 PolarHBondContact O-N 2.93Å
29	D	47.3	Very low	55.8	Low	107 Å²	107	119.8 Å²	119.8	57%	0.572	64%	0.635	S	S	*	*			trans	-66.2	103.1	175.1	-150.6	-3.7	0	0	0	105.9	V27 R31	V27-D29 VanDerWaalsContact C-N 3.27Å; V27-D29 PolarHBondContact O-N 3.16Å; D29-R31 PolarHBondContact O-N 2.97Å; D29-R31 WeakPolarHBondContact OD1-CD 3.34Å; D29-R31 WeakPolarHBondContact OD1-CG 3.32Å; D29-R31 IonicContact OD1-NE 3.75Å
30	A	51.5	Low	54.6	Low	40 Å²	40	119.7 Å²	119.7	33%	0.331	64%	0.637	S	S	.	*	T	Hydrogen-bonded Turn	trans	-70.5	30.7	-178.3	0	0	0	0	0	112.3	R28 Q38	R28-A30 PolarHBondContact O-N 2.93Å; A30-Q38 HydrophobicContact CB-CB 4.09Å
31	R	49.4	Very low	53.5	Low	215 Å²	215	118.4 Å²	118.4	81%	0.811	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.7	-7.3	-174.5	-76	-176.1	174.4	-160.9	-1.2	114.1	D29	D29-R31 PolarHBondContact O-N 2.97Å; D29-R31 WeakPolarHBondContact OD1-CD 3.34Å; D29-R31 WeakPolarHBondContact OD1-CG 3.32Å; D29-R31 IonicContact OD1-NE 3.75Å
32	S	47	Very low	52.6	Low	117 Å²	117	119.8 Å²	119.8	82%	0.818	66%	0.655	S	S	*	*	S	Bend	trans	-93.6	3.4	-174.2	63.9	0	0	0	0	115.7
33	S	43.8	Very low	51.7	Low	70 Å²	70	119.9 Å²	119.9	49%	0.49	67%	0.666	S	S	.	*	S	Bend	trans	-140.3	109	172.5	43.1	0	0	0	0	111.7
34	S	45.4	Very low	51	Low	95 Å²	95	122.7 Å²	122.7	66%	0.664	67%	0.667	S	S	*	*	S	Bend	trans	50.8	109.3	156.1	58.7	0	0	0	0	118.7	S36	S34-S36 PolarHBondContact O-N 2.05Å
35	V	42.1	Very low	50.6	Low	151 Å²	151	124.2 Å²	124.2	92%	0.915	68%	0.682	S	S	*	*	S	Bend	trans	36.5	75.5	134.6	-168.6	0	0	0	0	115.4
36	S	45.2	Very low	50.4	Low	91 Å²	91	120.2 Å²	120.2	64%	0.636	67%	0.666	S	S	*	*	S	Bend	trans	170.5	141.3	146.4	49.2	0	0	0	0	106.7	S34 Q38	S34-S36 PolarHBondContact O-N 2.05Å; S36-Q38 VanDerWaalsContact C-N 3.33Å; S36-Q38 PolarHBondContact O-N 3.06Å
37	Q	49.2	Very low	50.8	Low	176 Å²	176	118 Å²	118	82%	0.822	66%	0.66	S	S	*	*			trans	-58.2	96.9	173.6	-77.9	167.8	-53.4	0	0	109.1	H39	Q37-H39 PolarHBondContact O-CD2 3.03Å; Q37-H39 PolarHBondContact O-N 2.99Å
38	Q	43.1	Very low	51.3	Low	107 Å²	107	115.6 Å²	115.6	50%	0.5	65%	0.647	S	S	.	*			trans	-74.6	95.9	170.5	-68.2	-168.8	1.5	0	0	107.2	A30 S36 I40	A30-Q38 HydrophobicContact CB-CB 4.09Å; S36-Q38 VanDerWaalsContact C-N 3.33Å; S36-Q38 PolarHBondContact O-N 3.06Å; Q38-I40 PolarHBondContact O-N 2.89Å
39	H	49	Very low	52.3	Low	159 Å²	159	111.2 Å²	111.2	74%	0.736	64%	0.637	S	S	*	*			trans	-58.8	122	171.5	-71.8	-95	0	0	0	108.7	Q37 A41	Q37-H39 PolarHBondContact O-CD2 3.03Å; Q37-H39 PolarHBondContact O-N 2.99Å; H39-A41 PolarHBondContact O-N 3.32Å
40	I	49.8	Very low	53.3	Low	113 Å²	113	112 Å²	112	58%	0.579	64%	0.64	S	S	*	*			trans	-71	97.4	167.8	-58.3	176.5	0	0	0	106.4	V27 Q38 V42	V27-I40 HydrophobicContact CG1-CD1 3.92Å; Q38-I40 PolarHBondContact O-N 2.89Å; I40-V42 HydrophobicContact CG2-CG2 4.19Å; I40-V42 PolarHBondContact O-N 3.06Å
41	A	53	Low	54.2	Low	94 Å²	94	114 Å²	114	78%	0.777	65%	0.645	S	S	*	*			trans	-76.9	102.7	172.2	0	0	0	0	0	108.8	H39 A43	H39-A41 PolarHBondContact O-N 3.32Å; A41-A43 PolarHBondContact O-N 3.24Å
42	V	55.2	Low	55.2	Low	97 Å²	97	115 Å²	115	59%	0.588	65%	0.649	S	S	*	*			trans	-80.3	104.7	170.3	-178.4	0	0	0	0	107.6	I40 F44	I40-V42 HydrophobicContact CG2-CG2 4.19Å; I40-V42 PolarHBondContact O-N 3.06Å; V42-F44 HydrophobicContact CB-CE2 4.22Å; V42-F44 HydrophobicContact CG1-CD2 4.24Å; V42-F44 HydrophobicContact CG1-CE2 3.88Å; V42-F44 HydrophobicContact CG1-CZ 4.08Å; V42-F44 PolarHBondContact O-N 3.35Å; V42-F44 VanDerWaalsContact O-N 3.16Å
43	A	51.9	Low	56	Low	97 Å²	97	110.8 Å²	110.8	80%	0.802	62%	0.618	S	S	*	*			trans	-74.5	101.4	172	0	0	0	0	0	108.8	A41	A41-A43 PolarHBondContact O-N 3.24Å
44	F	55.2	Low	57.3	Low	153 Å²	153	111.8 Å²	111.8	67%	0.671	62%	0.624	S	S	*	*			trans	-70.6	132.2	166.7	-70.7	-88.2	0	0	0	108.4	V42 G46	V42-F44 HydrophobicContact CB-CE2 4.22Å; V42-F44 HydrophobicContact CG1-CD2 4.24Å; V42-F44 HydrophobicContact CG1-CE2 3.88Å; V42-F44 HydrophobicContact CG1-CZ 4.08Å; V42-F44 PolarHBondContact O-N 3.35Å; V42-F44 VanDerWaalsContact O-N 3.16Å; F44-G46 PolarHBondContact O-N 3.4Å
45	P	52.8	Low	58.7	Low	128 Å²	128	112.7 Å²	112.7	83%	0.831	64%	0.636	S	S	*	*	S	Bend	trans	-62.1	108.3	172.8	25.5	-31.4	0	0	0	108.1
46	G	60	Low	59.9	Low	21 Å²	21	109.5 Å²	109.5	22%	0.216	63%	0.634	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-159.9	150	-179	0	0	0	0	0	108.3	F44 C48 R65	F44-G46 PolarHBondContact O-N 3.4Å; G46-C48 PolarHBondContact O-N 2.78Å; G46-R65 WeakPolarHBondContact CA-O 3.07Å
47	N	65.4	Low	60.8	Low	115 Å²	115	111 Å²	111	62%	0.615	63%	0.634	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-68.9	110.6	173.3	-72.5	-14.3	0	0	0	107.4	R65	N47-R65 PolarHBondContact O-N 2.96Å
48	C	70.5	Confident	61.5	Low	50 Å²	50	111.5 Å²	111.5	34%	0.338	64%	0.642	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-97	128.2	174.3	-55.7	0	0	0	0	109.2	G46 Q62 T63 C64	G46-C48 PolarHBondContact O-N 2.78Å; C48-Q62 HydrophobicContact CB-CG 3.78Å; C48-T63 WeakPolarHBondContact CA-O 3.12Å; C48-C64 HydrophobicContact CB-CB 4.1Å; C48-C64 WeakPolarHBondContact CB-SG 3.24Å; C48-C64 WeakPolarHBondContact SG-CB 3.41Å; C48-C64 CovalentContact SG-SG 2.05Å; C48-C64 PolarHBondContact SG-SG 3Å
49	E	71.1	Confident	62.7	Low	140 Å²	140	109.1 Å²	109.1	65%	0.654	65%	0.646	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-114.9	140.6	175.2	-66.8	-178.7	166.3	0	0	109.3	I51 T63	E49-I51 PolarHBondContact O-N 2.96Å; E49-T63 PolarHBondContact N-O 3.26Å; E49-T63 PolarHBondContact O-N 2.79Å; E49-T63 PolarHBondContact O-OG1 2.79Å
50	N	68.9	Low	63.6	Low	122 Å²	122	110.4 Å²	110.4	65%	0.652	65%	0.645	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-79.6	112.4	173.7	-72.3	-34.6	0	0	0	108.4
51	I	71.1	Confident	64.3	Low	83 Å²	83	108 Å²	108	43%	0.426	64%	0.636	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-93.1	140.7	170.3	59	165.2	0	0	0	109.3	E49 V61 T63	E49-I51 PolarHBondContact O-N 2.96Å; I51-V61 HydrophobicContact CD1-CB 4.29Å; I51-V61 HydrophobicContact CD1-CG1 3.82Å; I51-V61 HydrophobicContact CG1-CB 3.88Å; I51-V61 HydrophobicContact CG1-CG1 3.83Å; I51-V61 VanDerWaalsContact CG1-O 3.24Å; I51-V61 WeakPolarHBondContact CG1-O 3.42Å; I51-V61 PolarHBondContact N-O 3.28Å; I51-T63 HydrophobicContact CD1-CG2 3.57Å; I51-T63 HydrophobicContact CG1-CG2 4.01Å
52	R	68.6	Low	65	Low	236 Å²	236	108.6 Å²	108.6	89%	0.891	62%	0.623	S	S	*	*	P	Polyproline II helix	trans	-65.7	124.7	176.4	-168	175.3	-175.9	175.3	1.3	108.1
53	P	64.4	Low	65.6	Low	28 Å²	28	107 Å²	107	18%	0.182	61%	0.614	C	S	.	*	P	Polyproline II helix	trans	-61	149.9	174.8	26.5	-34.5	0	0	0	109.9	L57 G59 V61	P53-L57 HydrophobicContact CB-CB 4.27Å; P53-G59 WeakPolarHBondContact CG-O 3.44Å; P53-V61 HydrophobicContact CB-CG2 4.2Å
54	P	71	Confident	66.3	Low	92 Å²	92	106 Å²	106	60%	0.597	60%	0.599	S	S	*	*	P	Polyproline II helix	trans	-57.5	150.5	174	22.5	-29.9	0	0	0	110.7	G56 L57	P54-G56 PolarHBondContact O-N 3.02Å; P54-L57 HydrophobicContact CG-CD1 4.19Å; P54-L57 PolarHBondContact O-N 3.39Å
55	A	74.1	Confident	66.7	Low	113 Å²	113	108.4 Å²	108.4	93%	0.934	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.8	127.7	-174.9	0	0	0	0	0	111.3
56	G	68.5	Low	67	Low	84 Å²	84	107 Å²	107	87%	0.866	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	109.3	-7.4	179.7	0	0	0	0	0	115.8	P54	P54-G56 PolarHBondContact O-N 3.02Å
57	L	64.4	Low	66.6	Low	122 Å²	122	112.3 Å²	112.3	64%	0.639	62%	0.616	S	S	*	*			trans	-106.5	123.5	174.3	-75.6	165.6	0	0	0	111.6	P53 P54	P53-L57 HydrophobicContact CB-CB 4.27Å; P54-L57 HydrophobicContact CG-CD1 4.19Å; P54-L57 PolarHBondContact O-N 3.39Å
58	L	63.9	Low	65.8	Low	188 Å²	188	112.4 Å²	112.4	98%	0.984	63%	0.626	S	S	*	*			trans	-78.9	117.3	169.7	-68.9	169.7	0	0	0	109
59	G	68.9	Low	64.6	Low	57 Å²	57	121.8 Å²	121.8	59%	0.588	67%	0.672	S	S	*	*	S	Bend	trans	153.5	-170	176.6	0	0	0	0	0	114	P53	P53-G59 WeakPolarHBondContact CG-O 3.44Å
60	Y	67.7	Low	64.3	Low	185 Å²	185	120.9 Å²	120.9	73%	0.725	67%	0.672	S	S	*	*			trans	-125.7	137	169.7	55.3	-86.7	0	0	0	108.7
61	V	64.3	Low	64.1	Low	64 Å²	64	120.8 Å²	120.8	39%	0.388	67%	0.673	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-107	115.7	172.3	177.9	0	0	0	0	106.6	I51 P53	I51-V61 HydrophobicContact CD1-CB 4.29Å; I51-V61 HydrophobicContact CD1-CG1 3.82Å; I51-V61 HydrophobicContact CG1-CB 3.88Å; I51-V61 HydrophobicContact CG1-CG1 3.83Å; I51-V61 VanDerWaalsContact CG1-O 3.24Å; I51-V61 WeakPolarHBondContact CG1-O 3.42Å; I51-V61 PolarHBondContact N-O 3.28Å; P53-V61 HydrophobicContact CB-CG2 4.2Å
62	Q	67	Low	63.7	Low	105 Å²	105	122.9 Å²	122.9	49%	0.491	69%	0.687	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.4	116	178.4	-174.1	172.3	-24.1	0	0	108.5	C48	C48-Q62 HydrophobicContact CB-CG 3.78Å
63	T	68.3	Low	63.4	Low	65 Å²	65	116.3 Å²	116.3	40%	0.399	68%	0.675	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.3	122.7	173.9	47.8	0	0	0	0	109	C48 E49 I51	C48-T63 WeakPolarHBondContact CA-O 3.12Å; E49-T63 PolarHBondContact N-O 3.26Å; E49-T63 PolarHBondContact O-N 2.79Å; E49-T63 PolarHBondContact O-OG1 2.79Å; I51-T63 HydrophobicContact CD1-CG2 3.57Å; I51-T63 HydrophobicContact CG1-CG2 4.01Å
64	C	66.2	Low	63.3	Low	74 Å²	74	121.8 Å²	121.8	50%	0.5	71%	0.706	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-103.7	127.9	177	-62.4	0	0	0	0	110	C48	C48-C64 HydrophobicContact CB-CB 4.1Å; C48-C64 WeakPolarHBondContact CB-SG 3.24Å; C48-C64 WeakPolarHBondContact SG-CB 3.41Å; C48-C64 CovalentContact SG-SG 2.05Å; C48-C64 PolarHBondContact SG-SG 3Å
65	R	62.7	Low	62.8	Low	204 Å²	204	123.8 Å²	123.8	77%	0.77	71%	0.713	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-91.4	114.5	174.4	-139.8	174.5	-178.1	174.2	-0.7	108.4	G46 N47	G46-R65 WeakPolarHBondContact CA-O 3.07Å; N47-R65 PolarHBondContact O-N 2.96Å
66	S	60.8	Low	62	Low	99 Å²	99	124.6 Å²	124.6	69%	0.692	70%	0.698	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-72.7	129.4	169.1	51	0	0	0	0	108.9	S68	S66-S68 PolarHBondContact O-N 3.33Å
67	H	50.6	Low	61.5	Low	133 Å²	133	127.7 Å²	127.7	62%	0.616	69%	0.685	S	S	*	*			trans	-78.6	115.2	163.2	-71.6	-106.7	0	0	0	106.3	L69	H67-L69 PolarHBondContact O-N 3.23Å
68	S	49.7	Very low	61.3	Low	116 Å²	116	128.2 Å²	128.2	81%	0.811	69%	0.689	S	S	*	*			trans	-65.8	125.1	170.8	53.3	0	0	0	0	108.7	S66	S66-S68 PolarHBondContact O-N 3.33Å
69	L	45.5	Very low	61.1	Low	248 Å²	248	122.7 Å²	122.7	100%	1.298	66%	0.662	S	S	*	*			trans	-62.8	0	171.7	-79.7	161.3	0	0	0	111.5	H67	H67-L69 PolarHBondContact O-N 3.23Å

Retrieved 69 of 69 residues in 39.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).