G4VNZ2_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession G4VNZ2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 96 aa.

						>G4VNZ2_SCHMA|G4VNZ2
MGAKRPRGRRSSVPKANRKRNKAMIERSLSLLNNHALTFRNELKAHSESNKEDKIPYLGLEDCTEQVISKETEDTSYSEQRIEDAIAEFSLLKCPR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	55.6	Low	69.2	Low	240 Å²	240	171 Å²	171	100%	1.182	87%	0.87	S	S	*	*				0	105.5	0	-66.1	-65.5	-95.6	0	0	108.4	A3	M1-A3 PolarHBondContact O-N 3.33Å
2	G	71.9	Confident	69.9	Low	79 Å²	79	163.5 Å²	163.5	81%	0.814	85%	0.845	S	S	*	*			trans	-66.2	123.5	-171.4	0	0	0	0	0	112.7	K4	G2-K4 PolarHBondContact O-N 3.45Å
3	A	74.8	Confident	70.4	Confident	97 Å²	97	155.8 Å²	155.8	80%	0.802	81%	0.809	S	S	*	*			trans	-62.6	115.6	174.2	0	0	0	0	0	109.6	M1 R5	M1-A3 PolarHBondContact O-N 3.33Å; A3-R5 PolarHBondContact O-N 3.28Å; A3-R5 VanDerWaalsContact O-N 3.09Å
4	K	71.2	Confident	71.6	Confident	206 Å²	206	150.1 Å²	150.1	90%	0.896	79%	0.787	S	S	*	*			trans	-62.6	112.6	173.3	-71.4	-179.9	179.5	175.5	0	107.9	G2	G2-K4 PolarHBondContact O-N 3.45Å
5	R	74.8	Confident	72.6	Confident	231 Å²	231	152.9 Å²	152.9	87%	0.872	79%	0.79	S	S	*	*			trans	-55.5	129.1	172.9	-70.8	-177.4	172.9	175.2	-2.2	108.4	A3 R7	A3-R5 PolarHBondContact O-N 3.28Å; A3-R5 VanDerWaalsContact O-N 3.09Å; R5-R7 PolarHBondContact O-N 2.97Å
6	P	68.7	Low	73.6	Confident	123 Å²	123	147.9 Å²	147.9	80%	0.799	78%	0.778	S	S	*	*			trans	-57.7	118.8	176	21.5	-29.5	0	0	0	107.5	G8	P6-G8 PolarHBondContact O-N 3.26Å
7	R	69.7	Low	74.6	Confident	242 Å²	242	143.9 Å²	143.9	91%	0.913	76%	0.758	S	S	*	*			trans	-56.4	107.3	173.2	-73.8	-175	172.5	-161.2	-2.2	105.6	R5 R9	R5-R7 PolarHBondContact O-N 2.97Å; R7-R9 PolarHBondContact O-N 2.76Å
8	G	67	Low	75.4	Confident	66 Å²	66	143.4 Å²	143.4	68%	0.68	74%	0.744	S	S	*	*			trans	-45.5	116.7	-178.6	0	0	0	0	0	107.7	P6 R10	P6-G8 PolarHBondContact O-N 3.26Å; G8-R10 VanDerWaalsContact C-N 3.28Å; G8-R10 PolarHBondContact O-N 2.83Å
9	R	67.2	Low	76.4	Confident	246 Å²	246	144.7 Å²	144.7	93%	0.928	74%	0.743	S	S	*	*			trans	-56.9	102.7	177.1	-134.6	-177.2	-173.8	-163.7	2.7	103.8	R7 S11	R7-R9 PolarHBondContact O-N 2.76Å; R9-S11 PolarHBondContact O-N 3.11Å
10	R	69.3	Low	77.2	Confident	238 Å²	238	146.4 Å²	146.4	90%	0.898	74%	0.74	S	S	*	*			trans	-52.9	114.9	175.1	-72.4	-177.1	176.6	-177.3	-1.8	103.9	G8 S12	G8-R10 VanDerWaalsContact C-N 3.28Å; G8-R10 PolarHBondContact O-N 2.83Å; R10-S12 PolarHBondContact O-N 2.7Å
11	S	70.5	Confident	78	Confident	113 Å²	113	143.1 Å²	143.1	79%	0.79	72%	0.724	S	S	*	*			trans	-61.1	93.8	176.4	49	0	0	0	0	105.4	R9 V13	R9-S11 PolarHBondContact O-N 3.11Å; S11-V13 VanDerWaalsContact C-N 3.34Å; S11-V13 PolarHBondContact O-N 3.33Å
12	S	77.5	Confident	79.9	Confident	81 Å²	81	137.8 Å²	137.8	57%	0.566	69%	0.694	S	S	*	*			trans	-71.4	102.7	-178.2	166.1	0	0	0	0	105	R10 R18	R10-S12 PolarHBondContact O-N 2.7Å; S12-R18 PolarHBondContact OG-NH2 2.86Å
13	V	77.6	Confident	81	Confident	63 Å²	63	136.6 Å²	136.6	38%	0.382	68%	0.677	S	S	.	*			trans	-46.7	126.5	169.3	178.5	0	0	0	0	107.5	S11 N17 R18	S11-V13 VanDerWaalsContact C-N 3.34Å; S11-V13 PolarHBondContact O-N 3.33Å; V13-N17 HydrophobicContact CG1-CB 3.43Å; V13-N17 VanDerWaalsContact CG1-CB 3.43Å; V13-R18 HydrophobicContact CB-CG 3.92Å; V13-R18 HydrophobicContact CG1-CG 3.81Å; V13-R18 PolarHBondContact O-NE 2.97Å
14	P	86.1	Confident	82.1	Confident	76 Å²	76	137.4 Å²	137.4	49%	0.494	67%	0.666	S	S	.	*			trans	-51.7	144.5	179.4	-28.5	34.6	0	0	0	111.2	A16 N17 R18	P14-A16 PolarHBondContact O-N 3.39Å; P14-A16 VanDerWaalsContact O-N 3.11Å; P14-N17 PolarHBondContact O-N 2.94Å; P14-R18 PolarHBondContact O-N 2.93Å
15	K	86.9	Confident	83.3	Confident	193 Å²	193	132.3 Å²	132.3	84%	0.839	65%	0.647	S	S	*	*	H	α-helix	trans	-51.6	-39.1	-178.1	-71	-176.4	177.7	179.4	0	112.4	R18 K19	K15-R18 PolarHBondContact O-N 3.03Å; K15-K19 PolarHBondContact O-N 3.08Å
16	A	88.6	Confident	84.3	Confident	72 Å²	72	126.1 Å²	126.1	60%	0.595	63%	0.628	S	S	*	*	H	α-helix	trans	-60.7	-46.1	176.3	0	0	0	0	0	112.7	P14 R18 K19 R20	P14-A16 PolarHBondContact O-N 3.39Å; P14-A16 VanDerWaalsContact O-N 3.11Å; A16-R18 VanDerWaalsContact C-N 3.35Å; A16-R18 PolarHBondContact O-N 3.44Å; A16-K19 PolarHBondContact O-N 2.91Å; A16-R20 PolarHBondContact O-N 2.78Å
17	N	90.9	Very high	85.6	Confident	81 Å²	81	129.2 Å²	129.2	43%	0.433	62%	0.624	S	S	.	*	H	α-helix	trans	-65.9	-37.6	177.2	-73.5	-3.4	0	0	0	111.6	V13 P14 K19 R20 N21	V13-N17 HydrophobicContact CG1-CB 3.43Å; V13-N17 VanDerWaalsContact CG1-CB 3.43Å; P14-N17 PolarHBondContact O-N 2.94Å; N17-K19 VanDerWaalsContact C-N 3.34Å; N17-K19 PolarHBondContact O-N 3.43Å; N17-R20 PolarHBondContact O-N 2.71Å; N17-N21 WeakPolarHBondContact O-CB 3.34Å; N17-N21 PolarHBondContact O-N 3.02Å; N17-N21 PolarHBondContact O-OD1 2.92Å
18	R	89.5	Confident	86.8	Confident	135 Å²	135	120.3 Å²	120.3	51%	0.509	60%	0.598	S	S	.	*	H	α-helix	trans	-60.8	-43	173.8	-62.6	-174.5	-166.9	-168.5	0	111.8	S12 V13 P14 K15 A16 K22	S12-R18 PolarHBondContact OG-NH2 2.86Å; V13-R18 HydrophobicContact CB-CG 3.92Å; V13-R18 HydrophobicContact CG1-CG 3.81Å; V13-R18 PolarHBondContact O-NE 2.97Å; P14-R18 PolarHBondContact O-N 2.93Å; K15-R18 PolarHBondContact O-N 3.03Å; A16-R18 VanDerWaalsContact C-N 3.35Å; A16-R18 PolarHBondContact O-N 3.44Å; R18-K22 VanDerWaalsContact O-CB 3.24Å; R18-K22 WeakPolarHBondContact O-CB 3.31Å; R18-K22 PolarHBondContact O-N 3.37Å
19	K	92.8	Very high	88.2	Confident	168 Å²	168	121.4 Å²	121.4	73%	0.73	59%	0.588	S	S	*	*	H	α-helix	trans	-63.1	-45.5	177.7	-171.7	178.7	179.7	-178.1	0	111.4	K15 A16 N17 K22 A23	K15-K19 PolarHBondContact O-N 3.08Å; A16-K19 PolarHBondContact O-N 2.91Å; N17-K19 VanDerWaalsContact C-N 3.34Å; N17-K19 PolarHBondContact O-N 3.43Å; K19-K22 PolarHBondContact O-N 3.36Å; K19-A23 PolarHBondContact O-N 3.33Å
20	R	94	Very high	89.5	Confident	177 Å²	177	112.6 Å²	112.6	67%	0.668	57%	0.565	S	S	*	*	H	α-helix	trans	-62.4	-47.5	176.8	-176.3	178.4	177.8	166.7	-0.2	112.1	A16 N17 A23 M24	A16-R20 PolarHBondContact O-N 2.78Å; N17-R20 PolarHBondContact O-N 2.71Å; R20-A23 PolarHBondContact O-N 2.76Å; R20-M24 PolarHBondContact O-N 3.3Å
21	N	93.8	Very high	90.7	Very high	78 Å²	78	105.4 Å²	105.4	42%	0.417	54%	0.543	S	S	.	.	H	α-helix	trans	-64.4	-41.9	179.7	-69.2	2.8	0	0	0	111.2	N17 M24 I25	N17-N21 WeakPolarHBondContact O-CB 3.34Å; N17-N21 PolarHBondContact O-N 3.02Å; N17-N21 PolarHBondContact O-OD1 2.92Å; N21-M24 PolarHBondContact O-N 2.99Å; N21-I25 VanDerWaalsContact O-CG1 3.25Å; N21-I25 WeakPolarHBondContact O-CG1 3.42Å; N21-I25 PolarHBondContact O-N 3.21Å
22	K	95.6	Very high	91.8	Very high	128 Å²	128	105.5 Å²	105.5	56%	0.557	53%	0.534	S	S	*	.	H	α-helix	trans	-57.6	-50	174.6	179.1	175.8	171.1	178.3	0	111.4	R18 K19 M24 I25 E26	R18-K22 VanDerWaalsContact O-CB 3.24Å; R18-K22 WeakPolarHBondContact O-CB 3.31Å; R18-K22 PolarHBondContact O-N 3.37Å; K19-K22 PolarHBondContact O-N 3.36Å; K22-M24 VanDerWaalsContact C-N 3.3Å; K22-M24 PolarHBondContact O-N 2.94Å; K22-I25 PolarHBondContact O-N 3.09Å; K22-E26 WeakPolarHBondContact CE-OE1 3.44Å; K22-E26 HydrophobicContact CG-CG 4.39Å; K22-E26 IonicContact NZ-OE1 3.67Å; K22-E26 WeakPolarHBondContact O-CB 3.46Å; K22-E26 WeakPolarHBondContact O-CG 3.48Å; K22-E26 PolarHBondContact O-N 2.87Å
23	A	95.3	Very high	92.4	Very high	54 Å²	54	106.4 Å²	106.4	45%	0.446	53%	0.533	S	S	.	.	H	α-helix	trans	-62.2	-36.7	178.8	0	0	0	0	0	112.8	K19 R20 R27	K19-A23 PolarHBondContact O-N 3.33Å; R20-A23 PolarHBondContact O-N 2.76Å; A23-R27 WeakPolarHBondContact O-CB 2.76Å; A23-R27 PolarHBondContact O-N 3.1Å
24	M	96.8	Very high	93	Very high	115 Å²	115	107.5 Å²	107.5	57%	0.567	54%	0.537	S	S	*	.	H	α-helix	trans	-65.4	-45.5	175.1	-174.2	-176.6	-65.1	0	0	111.7	R20 N21 K22 R27 S28	R20-M24 PolarHBondContact O-N 3.3Å; N21-M24 PolarHBondContact O-N 2.99Å; K22-M24 VanDerWaalsContact C-N 3.3Å; K22-M24 PolarHBondContact O-N 2.94Å; M24-R27 PolarHBondContact O-N 2.92Å; M24-S28 PolarHBondContact O-N 3.43Å; M24-S28 PolarHBondContact O-OG 3.42Å
25	I	96	Very high	93.2	Very high	98 Å²	98	110.2 Å²	110.2	50%	0.503	54%	0.542	S	S	.	.	H	α-helix	trans	-62.4	-47.7	177.4	-68.4	164.7	0	0	0	110.2	N21 K22 R27 S28 L29	N21-I25 VanDerWaalsContact O-CG1 3.25Å; N21-I25 WeakPolarHBondContact O-CG1 3.42Å; N21-I25 PolarHBondContact O-N 3.21Å; K22-I25 PolarHBondContact O-N 3.09Å; I25-R27 VanDerWaalsContact C-N 3.32Å; I25-R27 PolarHBondContact O-N 3.36Å; I25-S28 WeakPolarHBondContact CA-OG 3.34Å; I25-S28 PolarHBondContact O-N 3.08Å; I25-S28 VanDerWaalsContact O-N 3.15Å; I25-S28 PolarHBondContact O-OG 3.47Å; I25-L29 HydrophobicContact CG2-CD1 3.94Å; I25-L29 HydrophobicContact CG2-CG 4.38Å; I25-L29 WeakPolarHBondContact O-CG 3.36Å; I25-L29 PolarHBondContact O-N 3.05Å
26	E	96.6	Very high	93.3	Very high	102 Å²	102	103.8 Å²	103.8	48%	0.477	53%	0.526	S	S	.	.	H	α-helix	trans	-58.9	-42.2	177.7	-73.9	171.4	163.4	0	0	111.9	K22 L29 S30	K22-E26 WeakPolarHBondContact CE-OE1 3.44Å; K22-E26 HydrophobicContact CG-CG 4.39Å; K22-E26 IonicContact NZ-OE1 3.67Å; K22-E26 WeakPolarHBondContact O-CB 3.46Å; K22-E26 WeakPolarHBondContact O-CG 3.48Å; K22-E26 PolarHBondContact O-N 2.87Å; E26-L29 PolarHBondContact O-N 3.38Å; E26-S30 WeakPolarHBondContact O-CB 3.42Å; E26-S30 PolarHBondContact O-N 2.89Å
27	R	96.1	Very high	93.4	Very high	188 Å²	188	105.1 Å²	105.1	71%	0.709	52%	0.522	S	S	*	.	H	α-helix	trans	-62.8	-45.4	174.5	-173.2	179.9	-180	-160.2	-0.2	111.9	A23 M24 I25 L29 S30 L31	A23-R27 WeakPolarHBondContact O-CB 2.76Å; A23-R27 PolarHBondContact O-N 3.1Å; M24-R27 PolarHBondContact O-N 2.92Å; I25-R27 VanDerWaalsContact C-N 3.32Å; I25-R27 PolarHBondContact O-N 3.36Å; R27-L29 VanDerWaalsContact C-N 3.34Å; R27-L29 PolarHBondContact O-N 3.43Å; R27-S30 PolarHBondContact O-N 3.38Å; R27-L31 WeakPolarHBondContact O-CG 3.5Å; R27-L31 PolarHBondContact O-N 3.27Å
28	S	95.6	Very high	93.2	Very high	54 Å²	54	104.5 Å²	104.5	38%	0.378	52%	0.521	S	S	.	.	H	α-helix	trans	-63.6	-39.2	178.2	59.6	0	0	0	0	112.6	M24 I25 L31 L32	M24-S28 PolarHBondContact O-N 3.43Å; M24-S28 PolarHBondContact O-OG 3.42Å; I25-S28 WeakPolarHBondContact CA-OG 3.34Å; I25-S28 PolarHBondContact O-N 3.08Å; I25-S28 VanDerWaalsContact O-N 3.15Å; I25-S28 PolarHBondContact O-OG 3.47Å; S28-L31 PolarHBondContact O-N 3.39Å; S28-L32 WeakPolarHBondContact O-CG 3.49Å; S28-L32 PolarHBondContact O-N 3.26Å
29	L	96.1	Very high	93.2	Very high	90 Å²	90	104.1 Å²	104.1	47%	0.471	52%	0.524	S	S	.	.	H	α-helix	trans	-66.2	-41	176	-74.2	173.1	0	0	0	111.7	I25 E26 R27 L31 L32 N33	I25-L29 HydrophobicContact CG2-CD1 3.94Å; I25-L29 HydrophobicContact CG2-CG 4.38Å; I25-L29 WeakPolarHBondContact O-CG 3.36Å; I25-L29 PolarHBondContact O-N 3.05Å; E26-L29 PolarHBondContact O-N 3.38Å; R27-L29 VanDerWaalsContact C-N 3.34Å; R27-L29 PolarHBondContact O-N 3.43Å; L29-L31 VanDerWaalsContact C-N 3.34Å; L29-L31 PolarHBondContact O-N 3.37Å; L29-L32 PolarHBondContact O-N 3.32Å; L29-N33 WeakPolarHBondContact O-CB 3.45Å; L29-N33 PolarHBondContact O-N 3.05Å; L29-N33 PolarHBondContact O-ND2 2.91Å
30	S	94.7	Very high	93.1	Very high	61 Å²	61	104.8 Å²	104.8	43%	0.427	52%	0.522	S	S	.	.	H	α-helix	trans	-61.4	-42.6	175.3	177	0	0	0	0	111.8	E26 R27 N33 N34	E26-S30 WeakPolarHBondContact O-CB 3.42Å; E26-S30 PolarHBondContact O-N 2.89Å; R27-S30 PolarHBondContact O-N 3.38Å; S30-N33 PolarHBondContact O-N 3.35Å; S30-N34 WeakPolarHBondContact O-CB 3.41Å; S30-N34 PolarHBondContact O-N 3.46Å; S30-N34 PolarHBondContact O-ND2 2.85Å
31	L	92.9	Very high	92.9	Very high	87 Å²	87	101.3 Å²	101.3	46%	0.455	52%	0.516	S	S	.	.	H	α-helix	trans	-62.6	-47.7	175.8	-69.5	172.2	0	0	0	111.6	R27 S28 L29 N33 N34 H35	R27-L31 WeakPolarHBondContact O-CG 3.5Å; R27-L31 PolarHBondContact O-N 3.27Å; S28-L31 PolarHBondContact O-N 3.39Å; L29-L31 VanDerWaalsContact C-N 3.34Å; L29-L31 PolarHBondContact O-N 3.37Å; L31-N33 PolarHBondContact O-N 2.94Å; L31-N34 PolarHBondContact O-N 3.45Å; L31-H35 PolarHBondContact O-CD2 3.47Å; L31-H35 PolarHBondContact O-N 3.27Å
32	L	94	Very high	92.7	Very high	114 Å²	114	102.7 Å²	102.7	60%	0.597	52%	0.52	S	S	*	.	H	α-helix	trans	-60.5	-43.9	178.3	-74.4	169.3	0	0	0	112.3	S28 L29 H35 A36	S28-L32 WeakPolarHBondContact O-CG 3.49Å; S28-L32 PolarHBondContact O-N 3.26Å; L29-L32 PolarHBondContact O-N 3.32Å; L32-H35 PolarHBondContact O-N 3.46Å; L32-A36 WeakPolarHBondContact O-CB 3.48Å; L32-A36 PolarHBondContact O-N 2.9Å
33	N	91.4	Very high	92.3	Very high	101 Å²	101	101 Å²	101	54%	0.54	52%	0.517	S	S	.	.	H	α-helix	trans	-65	-40.3	177.6	-75.6	-18.4	0	0	0	111.8	L29 S30 L31 A36 L37	L29-N33 WeakPolarHBondContact O-CB 3.45Å; L29-N33 PolarHBondContact O-N 3.05Å; L29-N33 PolarHBondContact O-ND2 2.91Å; S30-N33 PolarHBondContact O-N 3.35Å; L31-N33 PolarHBondContact O-N 2.94Å; N33-A36 PolarHBondContact O-N 3.33Å; N33-L37 WeakPolarHBondContact O-CG 3.43Å; N33-L37 PolarHBondContact O-N 3Å
34	N	89.4	Confident	92	Very high	86 Å²	86	103.9 Å²	103.9	46%	0.46	52%	0.519	S	S	.	.	H	α-helix	trans	-63.2	-45.9	175.6	-70.9	-15.6	0	0	0	111.1	S30 L31 A36 L37 T38	S30-N34 WeakPolarHBondContact O-CB 3.41Å; S30-N34 PolarHBondContact O-N 3.46Å; S30-N34 PolarHBondContact O-ND2 2.85Å; L31-N34 PolarHBondContact O-N 3.45Å; N34-A36 PolarHBondContact O-N 3.04Å; N34-L37 PolarHBondContact O-N 3.31Å; N34-T38 PolarHBondContact O-N 3.4Å; N34-T38 PolarHBondContact O-OG1 3.37Å; N34-T38 VanDerWaalsContact O-OG1 3.09Å
35	H	90.2	Very high	91.4	Very high	132 Å²	132	101 Å²	101	61%	0.611	51%	0.514	S	S	*	.	H	α-helix	trans	-61.6	-41.8	176.9	-77	-65.7	0	0	0	112.6	L31 L32 L37 T38 F39	L31-H35 PolarHBondContact O-CD2 3.47Å; L31-H35 PolarHBondContact O-N 3.27Å; L32-H35 PolarHBondContact O-N 3.46Å; H35-L37 VanDerWaalsContact C-N 3.32Å; H35-L37 PolarHBondContact O-N 3.34Å; H35-T38 PolarHBondContact O-N 3.12Å; H35-F39 VanDerWaalsContact O-CB 3.3Å; H35-F39 WeakPolarHBondContact O-CB 3.4Å; H35-F39 PolarHBondContact O-N 3.03Å
36	A	89.8	Confident	90.6	Very high	59 Å²	59	102.2 Å²	102.2	49%	0.488	52%	0.517	S	S	.	.	H	α-helix	trans	-63.3	-38.9	177.2	0	0	0	0	0	112.2	L32 N33 N34 R40	L32-A36 WeakPolarHBondContact O-CB 3.48Å; L32-A36 PolarHBondContact O-N 2.9Å; N33-A36 PolarHBondContact O-N 3.33Å; N34-A36 PolarHBondContact O-N 3.04Å; A36-R40 WeakPolarHBondContact O-CB 3.27Å; A36-R40 PolarHBondContact O-N 3.43Å
37	L	89	Confident	89.7	Confident	99 Å²	99	100.3 Å²	100.3	52%	0.518	52%	0.515	S	S	.	.	H	α-helix	trans	-68.3	-45.6	175.4	-71.4	173.6	0	0	0	111.8	N33 N34 H35 R40 N41	N33-L37 WeakPolarHBondContact O-CG 3.43Å; N33-L37 PolarHBondContact O-N 3Å; N34-L37 PolarHBondContact O-N 3.31Å; H35-L37 VanDerWaalsContact C-N 3.32Å; H35-L37 PolarHBondContact O-N 3.34Å; L37-R40 PolarHBondContact O-N 2.94Å; L37-N41 WeakPolarHBondContact O-CB 3.34Å; L37-N41 PolarHBondContact O-N 2.91Å; L37-N41 PolarHBondContact O-ND2 3Å
38	T	88.7	Confident	88.7	Confident	69 Å²	69	96 Å²	96	42%	0.423	50%	0.503	S	S	.	.	H	α-helix	trans	-59.4	-49.4	176.5	-59.5	0	0	0	0	111	N34 H35 R40 N41 E42	N34-T38 PolarHBondContact O-N 3.4Å; N34-T38 PolarHBondContact O-OG1 3.37Å; N34-T38 VanDerWaalsContact O-OG1 3.09Å; H35-T38 PolarHBondContact O-N 3.12Å; T38-R40 VanDerWaalsContact C-N 3.33Å; T38-R40 PolarHBondContact O-N 3Å; T38-N41 PolarHBondContact O-N 3.49Å; T38-N41 VanDerWaalsContact O-N 3.1Å; T38-E42 HydrophobicContact CG2-CG 4.42Å; T38-E42 WeakPolarHBondContact CG2-OE1 3.41Å; T38-E42 WeakPolarHBondContact O-CG 3.4Å; T38-E42 PolarHBondContact O-N 3.33Å
39	F	88.6	Confident	87.2	Confident	126 Å²	126	96.7 Å²	96.7	55%	0.553	51%	0.508	S	S	*	.	H	α-helix	trans	-58.3	-43.5	177.6	178.7	-107.5	0	0	0	112.2	H35 N41 E42 L43	H35-F39 VanDerWaalsContact O-CB 3.3Å; H35-F39 WeakPolarHBondContact O-CB 3.4Å; H35-F39 PolarHBondContact O-N 3.03Å; F39-N41 VanDerWaalsContact C-N 3.34Å; F39-N41 PolarHBondContact O-N 3.27Å; F39-E42 PolarHBondContact O-N 3.45Å; F39-L43 HydrophobicContact CD1-CD1 3.92Å; F39-L43 HydrophobicContact CD1-CG 4.5Å; F39-L43 HydrophobicContact CE1-CD1 3.35Å; F39-L43 HydrophobicContact CE1-CG 4.13Å; F39-L43 HydrophobicContact CE2-CD1 4.34Å; F39-L43 HydrophobicContact CE2-CG 4.29Å; F39-L43 HydrophobicContact CZ-CD1 3.6Å; F39-L43 HydrophobicContact CZ-CD2 4.32Å; F39-L43 HydrophobicContact CZ-CG 4.02Å; F39-L43 WeakPolarHBondContact O-CB 3.43Å; F39-L43 WeakPolarHBondContact O-CG 3.3Å; F39-L43 PolarHBondContact O-N 3.05Å
40	R	90.3	Very high	85.4	Confident	183 Å²	183	97.8 Å²	97.8	69%	0.691	51%	0.514	S	S	*	.	H	α-helix	trans	-63.8	-39.5	176.3	-176.2	177.1	178.9	170.1	0.5	112.3	A36 L37 T38 K44	A36-R40 WeakPolarHBondContact O-CB 3.27Å; A36-R40 PolarHBondContact O-N 3.43Å; L37-R40 PolarHBondContact O-N 2.94Å; T38-R40 VanDerWaalsContact C-N 3.33Å; T38-R40 PolarHBondContact O-N 3Å; R40-K44 WeakPolarHBondContact O-CB 3.32Å; R40-K44 PolarHBondContact O-N 3.49Å
41	N	90.8	Very high	83.6	Confident	103 Å²	103	102.9 Å²	102.9	55%	0.551	53%	0.528	S	S	*	.	H	α-helix	trans	-68.8	-40.8	178.5	-70	-18.5	0	0	0	111.5	L37 T38 F39 K44 A45	L37-N41 WeakPolarHBondContact O-CB 3.34Å; L37-N41 PolarHBondContact O-N 2.91Å; L37-N41 PolarHBondContact O-ND2 3Å; T38-N41 PolarHBondContact O-N 3.49Å; T38-N41 VanDerWaalsContact O-N 3.1Å; F39-N41 VanDerWaalsContact C-N 3.34Å; F39-N41 PolarHBondContact O-N 3.27Å; N41-K44 PolarHBondContact O-N 2.97Å; N41-A45 WeakPolarHBondContact O-CB 3.32Å; N41-A45 PolarHBondContact O-N 3.41Å
42	E	89.3	Confident	81.8	Confident	107 Å²	107	107.2 Å²	107.2	50%	0.5	55%	0.546	S	S	.	.	H	α-helix	trans	-62.6	-46.7	174.3	-73.3	172.7	-176	0	0	111.1	T38 F39 K44 A45 H46	T38-E42 HydrophobicContact CG2-CG 4.42Å; T38-E42 WeakPolarHBondContact CG2-OE1 3.41Å; T38-E42 WeakPolarHBondContact O-CG 3.4Å; T38-E42 PolarHBondContact O-N 3.33Å; F39-E42 PolarHBondContact O-N 3.45Å; E42-K44 VanDerWaalsContact C-N 3.3Å; E42-K44 PolarHBondContact O-N 3.24Å; E42-A45 PolarHBondContact O-N 3.49Å; E42-H46 PolarHBondContact O-CD2 2.9Å; E42-H46 PolarHBondContact O-N 3.16Å
43	L	87.3	Confident	79.9	Confident	93 Å²	93	108.5 Å²	108.5	49%	0.487	55%	0.554	S	S	.	*	H	α-helix	trans	-57.8	-42.4	174	-77.6	-179.7	0	0	0	112.3	F39 H46 S47	F39-L43 HydrophobicContact CD1-CD1 3.92Å; F39-L43 HydrophobicContact CD1-CG 4.5Å; F39-L43 HydrophobicContact CE1-CD1 3.35Å; F39-L43 HydrophobicContact CE1-CG 4.13Å; F39-L43 HydrophobicContact CE2-CD1 4.34Å; F39-L43 HydrophobicContact CE2-CG 4.29Å; F39-L43 HydrophobicContact CZ-CD1 3.6Å; F39-L43 HydrophobicContact CZ-CD2 4.32Å; F39-L43 HydrophobicContact CZ-CG 4.02Å; F39-L43 WeakPolarHBondContact O-CB 3.43Å; F39-L43 WeakPolarHBondContact O-CG 3.3Å; F39-L43 PolarHBondContact O-N 3.05Å; L43-H46 PolarHBondContact O-N 3.04Å; L43-S47 WeakPolarHBondContact O-CB 3.25Å; L43-S47 PolarHBondContact O-N 2.83Å
44	K	88.5	Confident	78	Confident	115 Å²	115	112 Å²	112	50%	0.5	56%	0.564	S	S	.	*	H	α-helix	trans	-64.1	-46.3	176.7	-173.4	179.6	171.2	-174.3	0	111.1	R40 N41 E42 H46 S47 E48	R40-K44 WeakPolarHBondContact O-CB 3.32Å; R40-K44 PolarHBondContact O-N 3.49Å; N41-K44 PolarHBondContact O-N 2.97Å; E42-K44 VanDerWaalsContact C-N 3.3Å; E42-K44 PolarHBondContact O-N 3.24Å; K44-H46 VanDerWaalsContact C-N 3.31Å; K44-H46 PolarHBondContact O-N 3.46Å; K44-S47 WeakPolarHBondContact CA-OG 3.44Å; K44-S47 PolarHBondContact O-N 3.27Å; K44-S47 PolarHBondContact O-OG 2.74Å; K44-E48 VanDerWaalsContact CE-CD 3.42Å; K44-E48 WeakPolarHBondContact CE-OE1 3.38Å; K44-E48 HydrophobicContact CG-CG 4.4Å; K44-E48 IonicContact NZ-OE1 3.59Å; K44-E48 WeakPolarHBondContact O-CG 3.42Å; K44-E48 PolarHBondContact O-N 3.11Å
45	A	84.1	Confident	76	Confident	55 Å²	55	115.2 Å²	115.2	46%	0.455	58%	0.58	S	S	.	*	H	α-helix	trans	-59.4	-40.8	177.1	0	0	0	0	0	112.1	N41 E42 E48 S49	N41-A45 WeakPolarHBondContact O-CB 3.32Å; N41-A45 PolarHBondContact O-N 3.41Å; E42-A45 PolarHBondContact O-N 3.49Å; A45-E48 PolarHBondContact O-N 3.13Å; A45-S49 WeakPolarHBondContact O-CB 3.5Å; A45-S49 PolarHBondContact O-N 3.36Å; A45-S49 PolarHBondContact O-OG 3.25Å
46	H	78.8	Confident	73.8	Confident	123 Å²	123	114 Å²	114	57%	0.569	58%	0.584	S	S	*	*	H	α-helix	trans	-66.3	-34.5	172.9	-76.6	-64.6	0	0	0	113	E42 L43 K44 S49 N50	E42-H46 PolarHBondContact O-CD2 2.9Å; E42-H46 PolarHBondContact O-N 3.16Å; L43-H46 PolarHBondContact O-N 3.04Å; K44-H46 VanDerWaalsContact C-N 3.31Å; K44-H46 PolarHBondContact O-N 3.46Å; H46-S49 WeakPolarHBondContact CA-OG 3.44Å; H46-S49 PolarHBondContact O-OG 3.03Å; H46-N50 PolarHBondContact O-ND2 2.7Å
47	S	78.7	Confident	71.7	Confident	61 Å²	61	119.7 Å²	119.7	43%	0.427	59%	0.594	S	S	.	*	H	α-helix	trans	-74.3	-27.8	177.2	75.1	0	0	0	0	113.7	L43 K44	L43-S47 WeakPolarHBondContact O-CB 3.25Å; L43-S47 PolarHBondContact O-N 2.83Å; K44-S47 WeakPolarHBondContact CA-OG 3.44Å; K44-S47 PolarHBondContact O-N 3.27Å; K44-S47 PolarHBondContact O-OG 2.74Å
48	E	74.6	Confident	69.6	Low	98 Å²	98	123.3 Å²	123.3	46%	0.458	61%	0.613	S	S	.	*	H	α-helix	trans	-88.8	-40.9	-178.9	-71	177.9	164.7	0	0	111.8	K44 A45 N50 K51	K44-E48 VanDerWaalsContact CE-CD 3.42Å; K44-E48 WeakPolarHBondContact CE-OE1 3.38Å; K44-E48 HydrophobicContact CG-CG 4.4Å; K44-E48 IonicContact NZ-OE1 3.59Å; K44-E48 WeakPolarHBondContact O-CG 3.42Å; K44-E48 PolarHBondContact O-N 3.11Å; A45-E48 PolarHBondContact O-N 3.13Å; E48-N50 PolarHBondContact O-N 3.33Å; E48-K51 WeakPolarHBondContact O-CB 3.49Å; E48-K51 PolarHBondContact O-N 3.37Å
49	S	64.1	Low	67.3	Low	69 Å²	69	123.3 Å²	123.3	48%	0.483	63%	0.627	S	S	.	*	H	α-helix	trans	-59.1	-32.8	174.4	49.1	0	0	0	0	113	A45 H46 K51	A45-S49 WeakPolarHBondContact O-CB 3.5Å; A45-S49 PolarHBondContact O-N 3.36Å; A45-S49 PolarHBondContact O-OG 3.25Å; H46-S49 WeakPolarHBondContact CA-OG 3.44Å; H46-S49 PolarHBondContact O-OG 3.03Å; S49-K51 PolarHBondContact O-N 2.96Å
50	N	58	Low	65.3	Low	112 Å²	112	123.6 Å²	123.6	60%	0.599	63%	0.633	S	S	*	*	H	α-helix	trans	-71.9	-9.4	175.6	-80.2	-48.1	0	0	0	114.5	H46 E48	H46-N50 PolarHBondContact O-ND2 2.7Å; E48-N50 PolarHBondContact O-N 3.33Å
51	K	57.8	Low	63.2	Low	169 Å²	169	121.6 Å²	121.6	74%	0.735	63%	0.632	S	S	*	*	H	α-helix	trans	-89.5	-19.4	-179.8	-68.6	-177.5	-177.8	-179	0	113.9	E48 S49	E48-K51 WeakPolarHBondContact O-CB 3.49Å; E48-K51 PolarHBondContact O-N 3.37Å; S49-K51 PolarHBondContact O-N 2.96Å
52	E	54.9	Low	61	Low	178 Å²	178	122 Å²	122	83%	0.832	63%	0.634	S	S	*	*	H	α-helix	trans	-90.6	-20.6	-177.3	-63.7	-160	160.7	0	0	113.6
53	D	54.3	Low	59.1	Low	141 Å²	141	121.7 Å²	121.7	75%	0.754	64%	0.642	S	S	*	*	S	Bend	trans	-107	18	-174.3	-79	-24.9	0	0	0	116.1
54	K	51.2	Low	57.1	Low	173 Å²	173	123.8 Å²	123.8	75%	0.752	66%	0.659	S	S	*	*			trans	-120.4	83.9	169.1	-67.3	-168.4	-177.6	-175.5	0	112.5
55	I	47.8	Very low	55	Low	155 Å²	155	125.5 Å²	125.5	80%	0.795	67%	0.669	S	S	*	*			trans	-6.5	133.8	132.7	-58.8	169.2	0	0	0	112.7	Y57	I55-Y57 PolarHBondContact O-N 3.37Å
56	P	43.6	Very low	52.8	Low	107 Å²	107	131 Å²	131	70%	0.695	69%	0.685	S	S	*	*	S	Bend	trans	-64.8	131	-164	25.7	-34.8	0	0	0	114.1	L58	P56-L58 PolarHBondContact O-N 3.15Å
57	Y	45.8	Very low	51	Low	178 Å²	178	130.1 Å²	130.1	70%	0.698	69%	0.688	S	S	*	*			trans	39.2	73	134.8	-149.2	-98.9	0	0	0	116.6	I55 E61	I55-Y57 PolarHBondContact O-N 3.37Å; Y57-E61 PolarHBondContact OH-OE1 3Å
58	L	45.3	Very low	49.3	Very low	175 Å²	175	135.7 Å²	135.7	92%	0.916	71%	0.711	S	S	*	*	S	Bend	trans	-118.1	94.8	154.8	-79.4	167.2	0	0	0	108.3	P56	P56-L58 PolarHBondContact O-N 3.15Å
59	G	39.7	Very low	47.5	Very low	69 Å²	69	135.2 Å²	135.2	71%	0.711	72%	0.719	S	S	*	*	S	Bend	trans	73.8	60.7	152.8	0	0	0	0	0	118
60	L	45.7	Very low	46.4	Very low	131 Å²	131	140.5 Å²	140.5	69%	0.686	73%	0.733	S	S	*	*			trans	-127	25.6	167.2	-113.5	147	0	0	0	112.8	C63	L60-C63 HydrophobicContact CD2-CB 4.03Å; L60-C63 WeakPolarHBondContact CD2-SG 3.45Å
61	E	46.5	Very low	45.5	Very low	142 Å²	142	142.7 Å²	142.7	66%	0.664	74%	0.74	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.5	131.3	143.1	-70.4	175	-166.2	0	0	105.7	Y57	Y57-E61 PolarHBondContact OH-OE1 3Å
62	D	45.9	Very low	45	Very low	112 Å²	112	140.4 Å²	140.4	60%	0.599	74%	0.74	S	S	*	*	T	Hydrogen-bonded Turn	trans	95.5	32	178.5	-51.8	-21.6	0	0	0	119.3	T64	D62-T64 PolarHBondContact O-N 3.38Å
63	C	47.9	Very low	44.7	Very low	100 Å²	100	140.1 Å²	140.1	68%	0.676	74%	0.739	S	S	*	*	S	Bend	trans	-74.7	0.7	158.2	-104.9	0	0	0	0	114.6	L60	L60-C63 HydrophobicContact CD2-CB 4.03Å; L60-C63 WeakPolarHBondContact CD2-SG 3.45Å
64	T	46.2	Very low	44.4	Very low	137 Å²	137	138.1 Å²	138.1	84%	0.84	73%	0.728	S	S	*	*	S	Bend	trans	-117.1	-0.2	177.1	44.4	0	0	0	0	115.2	D62	D62-T64 PolarHBondContact O-N 3.38Å
65	E	43.6	Very low	44.6	Very low	151 Å²	151	135.6 Å²	135.6	71%	0.706	73%	0.727	S	S	*	*			trans	-135.4	44.4	175.7	-65	-169.1	-173.6	0	0	112.3	V67	E65-V67 PolarHBondContact O-N 2.87Å
66	Q	39	Very low	45	Very low	169 Å²	169	131.9 Å²	131.9	79%	0.79	72%	0.715	S	S	*	*			trans	-75.7	81.9	155.8	-77.7	-173.7	28.3	0	0	108.5	I68	Q66-I68 PolarHBondContact O-N 2.95Å
67	V	41.5	Very low	45.7	Very low	106 Å²	106	134 Å²	134	64%	0.642	71%	0.71	S	S	*	*			trans	-42.9	110.3	155.4	175.3	0	0	0	0	106.8	E65 S69	E65-V67 PolarHBondContact O-N 2.87Å; V67-S69 VanDerWaalsContact C-N 3.27Å; V67-S69 PolarHBondContact O-N 3.5Å; V67-S69 PolarHBondContact O-OG 3.42Å
68	I	42.4	Very low	46.9	Very low	177 Å²	177	128.4 Å²	128.4	91%	0.908	70%	0.697	S	S	*	*			trans	-49.1	99.4	168.2	-61.4	166.7	0	0	0	106	Q66	Q66-I68 PolarHBondContact O-N 2.95Å
69	S	35.9	Very low	48.2	Very low	88 Å²	88	126.2 Å²	126.2	62%	0.615	68%	0.682	S	S	*	*			trans	-135.1	116.8	179.4	37.4	0	0	0	0	107.1	V67	V67-S69 VanDerWaalsContact C-N 3.27Å; V67-S69 PolarHBondContact O-N 3.5Å; V67-S69 PolarHBondContact O-OG 3.42Å
70	K	41.6	Very low	50	Low	181 Å²	181	129.3 Å²	129.3	79%	0.787	68%	0.678	S	S	*	*	S	Bend	trans	76.7	127.3	173.7	-52.8	-177.1	179.6	-174.9	0	114.8
71	E	38.4	Very low	51.6	Low	158 Å²	158	131.5 Å²	131.5	74%	0.738	68%	0.677	S	S	*	*			cis	177.6	134.3	-8.4	-117.2	156.1	-156.8	0	0	100.5
72	T	48.8	Very low	53.2	Low	120 Å²	120	129.4 Å²	129.4	74%	0.736	67%	0.67	S	S	*	*			trans	45.7	107.5	158.7	58.4	0	0	0	0	116
73	E	47.4	Very low	54.9	Low	172 Å²	172	130.3 Å²	130.3	80%	0.804	67%	0.671	S	S	*	*				-166.9	137.8	91.8	-89.5	158.2	-170.2	0	0	109
74	D	48.8	Very low	56.7	Low	100 Å²	100	130.8 Å²	130.8	54%	0.535	67%	0.666	S	S	.	*			trans	79.1	36.9	151.8	-60.3	-9.5	0	0	0	120.2	S76 Y77	D74-S76 PolarHBondContact O-N 2.89Å; D74-Y77 WeakPolarHBondContact O-CB 3.5Å; D74-Y77 PolarHBondContact O-N 3.33Å; D74-Y77 VanDerWaalsContact O-N 3.08Å
75	T	55.6	Low	58.5	Low	120 Å²	120	126.9 Å²	126.9	74%	0.736	65%	0.648	S	S	*	*	H	α-helix	trans	-60.5	-26	158	25.2	0	0	0	0	112.9	Y77 S78	T75-Y77 PolarHBondContact O-N 2.99Å; T75-S78 PolarHBondContact O-N 3.36Å; T75-S78 PolarHBondContact O-OG 2.88Å; T75-S78 VanDerWaalsContact O-OG 3.08Å
76	S	55.9	Low	60.3	Low	76 Å²	76	124.7 Å²	124.7	53%	0.531	64%	0.64	S	S	.	*	H	α-helix	trans	-66.2	-27.2	172	59.1	0	0	0	0	112.9	D74 S78	D74-S76 PolarHBondContact O-N 2.89Å; S76-S78 VanDerWaalsContact C-N 3.28Å; S76-S78 PolarHBondContact O-N 3.12Å
77	Y	58	Low	62.3	Low	151 Å²	151	119.1 Å²	119.1	59%	0.592	62%	0.623	S	S	*	*	H	α-helix	trans	-74.5	-20.2	-177.7	-158	-94.4	0	0	0	112.5	D74 T75	D74-Y77 WeakPolarHBondContact O-CB 3.5Å; D74-Y77 PolarHBondContact O-N 3.33Å; D74-Y77 VanDerWaalsContact O-N 3.08Å; T75-Y77 PolarHBondContact O-N 2.99Å
78	S	72	Confident	64.3	Low	61 Å²	61	120.6 Å²	120.6	43%	0.427	62%	0.623	S	S	.	*	H	α-helix	trans	-87.8	-39.2	176.8	71.8	0	0	0	0	112.8	T75 S76 I82	T75-S78 PolarHBondContact O-N 3.36Å; T75-S78 PolarHBondContact O-OG 2.88Å; T75-S78 VanDerWaalsContact O-OG 3.08Å; S76-S78 VanDerWaalsContact C-N 3.28Å; S76-S78 PolarHBondContact O-N 3.12Å; S78-I82 WeakPolarHBondContact O-CD1 3.38Å; S78-I82 VanDerWaalsContact O-CG1 3.27Å; S78-I82 WeakPolarHBondContact O-CG1 3.45Å; S78-I82 PolarHBondContact O-N 3.28Å
79	E	72	Confident	66	Low	130 Å²	130	119.7 Å²	119.7	61%	0.607	61%	0.613	S	S	*	*	H	α-helix	trans	-67.7	-44.1	-176.8	-70.6	-176.3	168.4	0	0	112.4	R81 I82 E83	E79-R81 PolarHBondContact O-N 3.34Å; E79-I82 PolarHBondContact O-N 3.22Å; E79-I82 VanDerWaalsContact O-N 3.12Å; E79-E83 PolarHBondContact O-N 3.49Å
80	Q	77.9	Confident	67.9	Low	134 Å²	134	119.6 Å²	119.6	63%	0.626	61%	0.612	S	S	*	*	H	α-helix	trans	-60.8	-40.8	178.1	-97.1	173.3	-15.1	0	0	113.1	I82 E83 D84	Q80-I82 VanDerWaalsContact C-N 3.29Å; Q80-I82 PolarHBondContact O-N 2.92Å; Q80-E83 PolarHBondContact O-N 3.03Å; Q80-D84 WeakPolarHBondContact O-CB 3.39Å; Q80-D84 VanDerWaalsContact O-CG 3.31Å; Q80-D84 PolarHBondContact O-N 3.04Å
81	R	78.6	Confident	69.4	Low	176 Å²	176	117.9 Å²	117.9	66%	0.664	61%	0.611	S	S	*	*	H	α-helix	trans	-65	-34.1	176.2	-91.1	-170.8	169.1	-157.1	-1.9	112.9	E79 A85	E79-R81 PolarHBondContact O-N 3.34Å; R81-A85 VanDerWaalsContact O-CB 3.32Å; R81-A85 WeakPolarHBondContact O-CB 3.38Å; R81-A85 PolarHBondContact O-N 2.96Å
82	I	80.5	Confident	71	Confident	98 Å²	98	116 Å²	116	50%	0.503	61%	0.605	S	S	.	*	H	α-helix	trans	-69.4	-44.9	177.6	-67	164.7	0	0	0	109.4	S78 E79 Q80 A85 I86	S78-I82 WeakPolarHBondContact O-CD1 3.38Å; S78-I82 VanDerWaalsContact O-CG1 3.27Å; S78-I82 WeakPolarHBondContact O-CG1 3.45Å; S78-I82 PolarHBondContact O-N 3.28Å; E79-I82 PolarHBondContact O-N 3.22Å; E79-I82 VanDerWaalsContact O-N 3.12Å; Q80-I82 VanDerWaalsContact C-N 3.29Å; Q80-I82 PolarHBondContact O-N 2.92Å; I82-A85 PolarHBondContact O-N 3.24Å; I82-I86 HydrophobicContact CG2-CD1 3.86Å; I82-I86 VanDerWaalsContact O-CG1 3.25Å; I82-I86 WeakPolarHBondContact O-CG1 3.41Å; I82-I86 PolarHBondContact O-N 2.9Å
83	E	82.1	Confident	71.9	Confident	132 Å²	132	119.2 Å²	119.2	62%	0.617	61%	0.609	S	S	*	*	H	α-helix	trans	-62.5	-43.7	176.4	-69.9	-174.3	171.1	0	0	112.2	E79 Q80 A85 I86 A87	E79-E83 PolarHBondContact O-N 3.49Å; Q80-E83 PolarHBondContact O-N 3.03Å; E83-A85 PolarHBondContact O-N 3.48Å; E83-I86 PolarHBondContact O-N 3.11Å; E83-A87 WeakPolarHBondContact O-CB 3.25Å; E83-A87 PolarHBondContact O-N 3.33Å
84	D	84.6	Confident	72.7	Confident	110 Å²	110	116.5 Å²	116.5	59%	0.588	61%	0.607	S	S	*	*	H	α-helix	trans	-60.8	-43.6	175.8	-75.1	-18.4	0	0	0	111.7	Q80 I86 A87 E88	Q80-D84 WeakPolarHBondContact O-CB 3.39Å; Q80-D84 VanDerWaalsContact O-CG 3.31Å; Q80-D84 PolarHBondContact O-N 3.04Å; D84-I86 VanDerWaalsContact C-N 3.35Å; D84-I86 PolarHBondContact O-N 3.32Å; D84-A87 PolarHBondContact O-N 3.46Å; D84-E88 WeakPolarHBondContact O-CB 3.34Å; D84-E88 PolarHBondContact O-N 3.37Å
85	A	83.5	Confident	73.4	Confident	55 Å²	55	117.9 Å²	117.9	46%	0.455	62%	0.622	S	S	.	*	H	α-helix	trans	-64.9	-37.2	177.5	0	0	0	0	0	112.5	R81 I82 E83 F89	R81-A85 VanDerWaalsContact O-CB 3.32Å; R81-A85 WeakPolarHBondContact O-CB 3.38Å; R81-A85 PolarHBondContact O-N 2.96Å; I82-A85 PolarHBondContact O-N 3.24Å; E83-A85 PolarHBondContact O-N 3.48Å; A85-F89 WeakPolarHBondContact O-CB 2.74Å; A85-F89 PolarHBondContact O-N 2.86Å
86	I	81.6	Confident	73.2	Confident	104 Å²	104	127.4 Å²	127.4	53%	0.533	64%	0.644	S	S	.	*	H	α-helix	trans	-67.4	-41.1	175.1	-68.4	165.8	0	0	0	110.6	I82 E83 D84 S90	I82-I86 HydrophobicContact CG2-CD1 3.86Å; I82-I86 VanDerWaalsContact O-CG1 3.25Å; I82-I86 WeakPolarHBondContact O-CG1 3.41Å; I82-I86 PolarHBondContact O-N 2.9Å; E83-I86 PolarHBondContact O-N 3.11Å; D84-I86 VanDerWaalsContact C-N 3.35Å; D84-I86 PolarHBondContact O-N 3.32Å; I86-S90 WeakPolarHBondContact O-CB 3.42Å; I86-S90 PolarHBondContact O-N 2.69Å; I86-S90 PolarHBondContact O-OG 3.06Å
87	A	82.3	Confident	74	Confident	52 Å²	52	130 Å²	130	43%	0.43	65%	0.65	S	S	.	*	H	α-helix	trans	-66	-44.7	177	0	0	0	0	0	111.7	E83 D84 F89 S90 L91	E83-A87 WeakPolarHBondContact O-CB 3.25Å; E83-A87 PolarHBondContact O-N 3.33Å; D84-A87 PolarHBondContact O-N 3.46Å; A87-F89 VanDerWaalsContact C-N 3.35Å; A87-F89 PolarHBondContact O-N 3.02Å; A87-S90 WeakPolarHBondContact O-CB 3.47Å; A87-S90 PolarHBondContact O-N 2.88Å; A87-S90 VanDerWaalsContact O-N 3.16Å; A87-L91 WeakPolarHBondContact O-CG 3.24Å; A87-L91 PolarHBondContact O-N 2.82Å; A87-L91 VanDerWaalsContact O-N 3.13Å
88	E	81.6	Confident	74.9	Confident	138 Å²	138	128.9 Å²	128.9	65%	0.645	65%	0.653	S	S	*	*	H	α-helix	trans	-60.4	-44.5	176.6	-171.5	179.5	177.8	0	0	111.2	D84 S90 L91 L92	D84-E88 WeakPolarHBondContact O-CB 3.34Å; D84-E88 PolarHBondContact O-N 3.37Å; E88-S90 VanDerWaalsContact C-N 3.28Å; E88-S90 PolarHBondContact O-N 2.9Å; E88-L91 PolarHBondContact O-N 2.77Å; E88-L91 VanDerWaalsContact O-N 3.11Å; E88-L92 PolarHBondContact O-N 3.03Å
89	F	78.7	Confident	75	Confident	158 Å²	158	132.7 Å²	132.7	69%	0.693	67%	0.666	S	S	*	*	H	α-helix	trans	-62.9	-35.8	176.4	-168.9	-96.8	0	0	0	112.5	A85 A87 L91 L92	A85-F89 WeakPolarHBondContact O-CB 2.74Å; A85-F89 PolarHBondContact O-N 2.86Å; A87-F89 VanDerWaalsContact C-N 3.35Å; A87-F89 PolarHBondContact O-N 3.02Å; F89-L91 VanDerWaalsContact C-N 3.27Å; F89-L91 PolarHBondContact O-N 2.85Å; F89-L92 HydrophobicContact CD2-CD1 4.19Å; F89-L92 WeakPolarHBondContact O-CB 3.35Å; F89-L92 PolarHBondContact O-N 3.18Å
90	S	75.4	Confident	75.2	Confident	86 Å²	86	132.8 Å²	132.8	60%	0.601	67%	0.669	S	S	*	*	H	α-helix	trans	-68.1	-26.8	176.5	-59.3	0	0	0	0	112.9	I86 A87 E88	I86-S90 WeakPolarHBondContact O-CB 3.42Å; I86-S90 PolarHBondContact O-N 2.69Å; I86-S90 PolarHBondContact O-OG 3.06Å; A87-S90 WeakPolarHBondContact O-CB 3.47Å; A87-S90 PolarHBondContact O-N 2.88Å; A87-S90 VanDerWaalsContact O-N 3.16Å; E88-S90 VanDerWaalsContact C-N 3.28Å; E88-S90 PolarHBondContact O-N 2.9Å
91	L	74.6	Confident	75	Confident	145 Å²	145	132.8 Å²	132.8	76%	0.759	67%	0.672	S	S	*	*	H	α-helix	trans	-81.6	-17.9	176.1	-68.9	175	0	0	0	113.4	A87 E88 F89 K93	A87-L91 WeakPolarHBondContact O-CG 3.24Å; A87-L91 PolarHBondContact O-N 2.82Å; A87-L91 VanDerWaalsContact O-N 3.13Å; E88-L91 PolarHBondContact O-N 2.77Å; E88-L91 VanDerWaalsContact O-N 3.11Å; F89-L91 VanDerWaalsContact C-N 3.27Å; F89-L91 PolarHBondContact O-N 2.85Å; L91-K93 PolarHBondContact O-N 2.96Å
92	L	71.8	Confident	74.8	Confident	119 Å²	119	129.9 Å²	129.9	62%	0.623	67%	0.672	S	S	*	*			trans	-68.7	71.7	168.9	-67.8	168.9	0	0	0	109.6	E88 F89 C94	E88-L92 PolarHBondContact O-N 3.03Å; F89-L92 HydrophobicContact CD2-CD1 4.19Å; F89-L92 WeakPolarHBondContact O-CB 3.35Å; F89-L92 PolarHBondContact O-N 3.18Å; L92-C94 PolarHBondContact O-N 3.09Å; L92-C94 VanDerWaalsContact O-N 3.12Å
93	K	67.4	Low	74.4	Confident	187 Å²	187	132.1 Å²	132.1	81%	0.813	68%	0.684	S	S	*	*			trans	-63.5	113.8	164.9	-75.7	-175.8	178.7	175.9	0	107.4	L91	L91-K93 PolarHBondContact O-N 2.96Å
94	C	63.1	Low	73.8	Confident	115 Å²	115	132.2 Å²	132.2	78%	0.777	69%	0.689	S	S	*	*			trans	-50.1	130.1	168.8	-68.7	0	0	0	0	109.2	L92 R96	L92-C94 PolarHBondContact O-N 3.09Å; L92-C94 VanDerWaalsContact O-N 3.12Å; C94-R96 PolarHBondContact O-N 3.37Å
95	P	63.4	Low	72.9	Confident	129 Å²	129	134 Å²	134	84%	0.838	70%	0.698	S	S	*	*			trans	-56.7	133.9	174.7	22.1	-30.2	0	0	0	109.2
96	R	51.4	Low	71.9	Confident	320 Å²	320	141.2 Å²	141.2	100%	1.208	72%	0.72	S	S	*	*			trans	-56.5	0	177.6	-81.6	-174.3	169.3	-175.8	-2.6	112.3	C94	C94-R96 PolarHBondContact O-N 3.37Å

Retrieved 96 of 96 residues in 24 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).