G4VP55_SCHMA Loading...

Ovule protein

AlphaFold DB , UniProt , Accession G4VP55, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 74 aa.

						>G4VP55_SCHMA|G4VP55
MNINCDSTLYGLPVSVFIKLLSSLSSGSEMLIVNCVTKFNAIQFASVYLCRSHSSLVVSYFRKSSSCHFFPYII
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	24.1	Very low	36.1	Very low	220 Å²	220	107.7 Å²	107.7	100%	1.084	59%	0.594	S	S	*	*				0	110.5	0	-161.5	-178.8	-146.3	0	0	106.8	I3	M1-I3 PolarHBondContact O-N 3.47Å
2	N	21.2	Very low	37.8	Very low	155 Å²	155	101.6 Å²	101.6	83%	0.829	56%	0.56	S	S	*	*			trans	-73.6	94.4	-178.5	-122.7	13.8	0	0	0	108.8	N4	N2-N4 PolarHBondContact O-N 2.84Å
3	I	24.5	Very low	39.6	Very low	119 Å²	119	98.4 Å²	98.4	61%	0.61	55%	0.546	S	S	*	.			trans	-82.2	98.9	168.3	-50.6	-179.7	0	0	0	105.4	M1 C5	M1-I3 PolarHBondContact O-N 3.47Å; I3-C5 VanDerWaalsContact C-N 3.34Å; I3-C5 WeakPolarHBondContact CG2-SG 3.25Å; I3-C5 PolarHBondContact O-N 3.18Å
4	N	25.6	Very low	41.2	Very low	111 Å²	111	96.3 Å²	96.3	59%	0.594	54%	0.537	S	S	*	.			trans	-64.6	95.7	171.7	-147.9	37.7	0	0	0	107.5	N2 D6	N2-N4 PolarHBondContact O-N 2.84Å; N4-D6 PolarHBondContact OD1-OD2 2.78Å
5	C	33	Very low	42.7	Very low	61 Å²	61	94.8 Å²	94.8	41%	0.412	54%	0.536	S	S	.	.			trans	-98.9	32.2	-176.6	-72.1	0	0	0	0	112	I3 S7	I3-C5 VanDerWaalsContact C-N 3.34Å; I3-C5 WeakPolarHBondContact CG2-SG 3.25Å; I3-C5 PolarHBondContact O-N 3.18Å; C5-S7 PolarHBondContact O-N 3Å
6	D	33.5	Very low	44	Very low	136 Å²	136	92.4 Å²	92.4	73%	0.727	52%	0.524	S	S	*	.	S	Bend	trans	-63.7	-2.8	-171	-83.8	-33.3	0	0	0	115.7	N4	N4-D6 PolarHBondContact OD1-OD2 2.78Å
7	S	36.7	Very low	45.4	Very low	92 Å²	92	89.3 Å²	89.3	64%	0.643	50%	0.503	S	S	*	.	S	Bend	trans	-161	3.3	174.4	40.8	0	0	0	0	114.8	C5	C5-S7 PolarHBondContact O-N 3Å
8	T	39.5	Very low	46.5	Very low	48 Å²	48	90.1 Å²	90.1	29%	0.294	51%	0.505	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.7	124.3	-179.3	59.3	0	0	0	0	109.9	Y10 L12	T8-Y10 PolarHBondContact O-N 2.8Å; T8-L12 CarbonylContact C-O 3.58Å; T8-L12 WeakPolarHBondContact CA-O 3.02Å; T8-L12 WeakPolarHBondContact CB-O 3.44Å
9	L	49.5	Very low	47.6	Very low	78 Å²	78	93.4 Å²	93.4	41%	0.408	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77	106	164.7	-147	99.9	0	0	0	105.7	G11 L12	L9-G11 VanDerWaalsContact C-N 3.27Å; L9-G11 PolarHBondContact O-N 3.08Å; L9-G11 VanDerWaalsContact O-N 3.13Å; L9-L12 PolarHBondContact N-O 2.81Å; L9-L12 VanDerWaalsContact N-O 3.08Å; L9-L12 PolarHBondContact O-N 2.96Å; L9-L12 VanDerWaalsContact O-N 3.1Å
10	Y	54.6	Low	48.6	Very low	120 Å²	120	90.4 Å²	90.4	47%	0.471	50%	0.496	S	S	.	.	T	Hydrogen-bonded Turn	trans	55.4	34	174	-52.2	-79	0	0	0	115.4	T8	T8-Y10 PolarHBondContact O-N 2.8Å
11	G	54.9	Low	49.5	Very low	45 Å²	45	88.2 Å²	88.2	46%	0.464	48%	0.484	S	S	.	.	T	Hydrogen-bonded Turn	trans	92.5	-5.6	177.9	0	0	0	0	0	115.3	L9	L9-G11 VanDerWaalsContact C-N 3.27Å; L9-G11 PolarHBondContact O-N 3.08Å; L9-G11 VanDerWaalsContact O-N 3.13Å
12	L	56.6	Low	51.7	Low	34 Å²	34	82.1 Å²	82.1	18%	0.178	46%	0.463	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.4	138.5	170.2	-68.1	168.9	0	0	0	110.5	T8 L9 V14 V16 V33	T8-L12 CarbonylContact C-O 3.58Å; T8-L12 WeakPolarHBondContact CA-O 3.02Å; T8-L12 WeakPolarHBondContact CB-O 3.44Å; L9-L12 PolarHBondContact N-O 2.81Å; L9-L12 VanDerWaalsContact N-O 3.08Å; L9-L12 PolarHBondContact O-N 2.96Å; L9-L12 VanDerWaalsContact O-N 3.1Å; L12-V14 PolarHBondContact O-N 2.79Å; L12-V16 HydrophobicContact CD2-CG1 4.45Å; L12-V33 HydrophobicContact CD1-CB 4.17Å; L12-V33 HydrophobicContact CD1-CG1 3.9Å; L12-V33 HydrophobicContact CD1-CG2 4.24Å; L12-V33 HydrophobicContact CD2-CB 4.35Å
13	P	61.4	Low	54.1	Low	60 Å²	60	78.1 Å²	78.1	39%	0.39	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-57.7	137.5	166.4	-20.4	31.3	0	0	0	110.3	S15 V16 F17	P13-S15 PolarHBondContact O-N 2.79Å; P13-S15 VanDerWaalsContact O-N 3.11Å; P13-V16 HydrophobicContact CB-CG2 4.18Å; P13-V16 HydrophobicContact CG-CG2 4.14Å; P13-V16 WeakPolarHBondContact O-CB 3.45Å; P13-V16 PolarHBondContact O-N 2.9Å; P13-F17 PolarHBondContact O-N 3.46Å
14	V	61.5	Low	56.2	Low	69 Å²	69	72.8 Å²	72.8	42%	0.418	42%	0.42	S	S	.	.	H	α-helix	trans	-53.7	-34.4	178.2	176.2	0	0	0	0	111.9	L12 V16 F17 I18	L12-V14 PolarHBondContact O-N 2.79Å; V14-V16 VanDerWaalsContact C-N 3.3Å; V14-V16 PolarHBondContact O-N 3.36Å; V14-F17 WeakPolarHBondContact O-CB 3.39Å; V14-F17 PolarHBondContact O-N 2.76Å; V14-F17 VanDerWaalsContact O-N 3.14Å; V14-I18 HydrophobicContact CG1-CD1 3.95Å; V14-I18 HydrophobicContact CG1-CG1 4.29Å; V14-I18 WeakPolarHBondContact O-CG1 3.43Å; V14-I18 PolarHBondContact O-N 3.15Å
15	S	63.8	Low	58.1	Low	74 Å²	74	72.5 Å²	72.5	52%	0.517	43%	0.426	S	S	.	.	H	α-helix	trans	-61.4	-33.9	176.8	58	0	0	0	0	113.7	P13 K19	P13-S15 PolarHBondContact O-N 2.79Å; P13-S15 VanDerWaalsContact O-N 3.11Å; S15-K19 WeakPolarHBondContact O-CG 3.03Å; S15-K19 PolarHBondContact O-N 2.65Å; S15-K19 VanDerWaalsContact O-N 3.12Å
16	V	63.1	Low	59.8	Low	57 Å²	57	74.1 Å²	74.1	35%	0.345	44%	0.438	S	S	.	.	H	α-helix	trans	-67.9	-44.6	174.7	177	0	0	0	0	109.3	L12 P13 V14 I18 K19 L20	L12-V16 HydrophobicContact CD2-CG1 4.45Å; P13-V16 HydrophobicContact CB-CG2 4.18Å; P13-V16 HydrophobicContact CG-CG2 4.14Å; P13-V16 WeakPolarHBondContact O-CB 3.45Å; P13-V16 PolarHBondContact O-N 2.9Å; V14-V16 VanDerWaalsContact C-N 3.3Å; V14-V16 PolarHBondContact O-N 3.36Å; V16-I18 PolarHBondContact O-N 3.31Å; V16-K19 PolarHBondContact O-N 2.87Å; V16-L20 HydrophobicContact CG1-CD1 4.02Å; V16-L20 HydrophobicContact CG1-CG 4.49Å; V16-L20 VanDerWaalsContact O-CG 3.28Å; V16-L20 WeakPolarHBondContact O-CG 3.34Å; V16-L20 PolarHBondContact O-N 2.8Å
17	F	67.6	Low	61.7	Low	39 Å²	39	69.3 Å²	69.3	17%	0.171	42%	0.421	C	S	.	.	H	α-helix	trans	-60	-48	177.1	-171.5	-103	0	0	0	111.7	P13 V14 K19 L20 L21 L49 L56 V58	P13-F17 PolarHBondContact O-N 3.46Å; V14-F17 WeakPolarHBondContact O-CB 3.39Å; V14-F17 PolarHBondContact O-N 2.76Å; V14-F17 VanDerWaalsContact O-N 3.14Å; F17-K19 VanDerWaalsContact C-N 3.32Å; F17-K19 PolarHBondContact O-N 3.4Å; F17-L20 WeakPolarHBondContact O-CB 3.32Å; F17-L20 PolarHBondContact O-N 3.47Å; F17-L20 VanDerWaalsContact O-N 3.13Å; F17-L21 HydrophobicContact CD1-CD1 3.87Å; F17-L21 HydrophobicContact CD1-CG 4.14Å; F17-L21 HydrophobicContact CE1-CD1 3.49Å; F17-L21 VanDerWaalsContact CE1-CD1 3.49Å; F17-L21 HydrophobicContact CE1-CD2 4.25Å; F17-L21 HydrophobicContact CE1-CG 3.98Å; F17-L21 HydrophobicContact CZ-CD1 4.18Å; F17-L21 HydrophobicContact CZ-CD2 4.14Å; F17-L21 HydrophobicContact CZ-CG 4.37Å; F17-L21 WeakPolarHBondContact O-CG 3.4Å; F17-L21 PolarHBondContact O-N 3.46Å; F17-L49 HydrophobicContact CE2-CD2 4.02Å; F17-L56 HydrophobicContact CE1-CD2 4.44Å; F17-L56 HydrophobicContact CZ-CD2 4.12Å; F17-V58 HydrophobicContact CE2-CG1 4.19Å; F17-V58 HydrophobicContact CE2-CG2 3.87Å; F17-V58 HydrophobicContact CZ-CG2 3.63Å
18	I	66.5	Low	63.3	Low	103 Å²	103	68.4 Å²	68.4	53%	0.528	42%	0.415	S	S	.	.	H	α-helix	trans	-57.6	-43.8	176.9	-66.7	170.3	0	0	0	111.7	V14 V16 L20 L21 S22	V14-I18 HydrophobicContact CG1-CD1 3.95Å; V14-I18 HydrophobicContact CG1-CG1 4.29Å; V14-I18 WeakPolarHBondContact O-CG1 3.43Å; V14-I18 PolarHBondContact O-N 3.15Å; V16-I18 PolarHBondContact O-N 3.31Å; I18-L20 VanDerWaalsContact C-N 3.34Å; I18-L20 PolarHBondContact O-N 2.77Å; I18-L21 PolarHBondContact O-N 3.24Å; I18-S22 PolarHBondContact O-N 3.34Å
19	K	67	Low	64.6	Low	153 Å²	153	69.6 Å²	69.6	67%	0.665	42%	0.417	S	S	*	.	H	α-helix	trans	-60.4	-43.9	176.8	-79.1	-178.3	177.2	-176.7	0	111.8	S15 V16 F17 L21 S22 S23	S15-K19 WeakPolarHBondContact O-CG 3.03Å; S15-K19 PolarHBondContact O-N 2.65Å; S15-K19 VanDerWaalsContact O-N 3.12Å; V16-K19 PolarHBondContact O-N 2.87Å; F17-K19 VanDerWaalsContact C-N 3.32Å; F17-K19 PolarHBondContact O-N 3.4Å; K19-L21 VanDerWaalsContact C-N 3.32Å; K19-L21 PolarHBondContact O-N 3.13Å; K19-S22 PolarHBondContact O-N 2.81Å; K19-S22 VanDerWaalsContact O-N 3.17Å; K19-S22 PolarHBondContact O-OG 3.03Å; K19-S23 PolarHBondContact O-N 3.47Å; K19-S23 VanDerWaalsContact O-N 3.15Å
20	L	67.6	Low	65.4	Low	34 Å²	34	71.5 Å²	71.5	18%	0.178	43%	0.425	C	S	.	.	H	α-helix	trans	-63.3	-38.8	176.8	-66.6	166.5	0	0	0	111.8	V16 F17 I18 S22 S23 L24 L31 L49	V16-L20 HydrophobicContact CG1-CD1 4.02Å; V16-L20 HydrophobicContact CG1-CG 4.49Å; V16-L20 VanDerWaalsContact O-CG 3.28Å; V16-L20 WeakPolarHBondContact O-CG 3.34Å; V16-L20 PolarHBondContact O-N 2.8Å; F17-L20 WeakPolarHBondContact O-CB 3.32Å; F17-L20 PolarHBondContact O-N 3.47Å; F17-L20 VanDerWaalsContact O-N 3.13Å; I18-L20 VanDerWaalsContact C-N 3.34Å; I18-L20 PolarHBondContact O-N 2.77Å; L20-S22 VanDerWaalsContact C-N 3.3Å; L20-S22 PolarHBondContact O-N 2.79Å; L20-S23 PolarHBondContact O-N 2.76Å; L20-S23 PolarHBondContact O-OG 2.82Å; L20-L24 WeakPolarHBondContact O-CD1 3.49Å; L20-L24 PolarHBondContact O-N 2.94Å; L20-L31 HydrophobicContact CB-CD1 4.21Å; L20-L31 HydrophobicContact CD1-CD1 3.45Å; L20-L31 VanDerWaalsContact CD1-CD1 3.45Å; L20-L31 HydrophobicContact CD2-CD1 3.47Å; L20-L31 VanDerWaalsContact CD2-CD1 3.47Å; L20-L31 HydrophobicContact CD2-CD2 4.09Å; L20-L31 HydrophobicContact CD2-CG 4.44Å; L20-L31 HydrophobicContact CG-CD1 3.86Å; L20-L49 HydrophobicContact CB-CD1 4.01Å
21	L	68	Low	65.7	Low	44 Å²	44	67.2 Å²	67.2	23%	0.23	41%	0.41	C	S	.	.	H	α-helix	trans	-65.5	-35.2	174.2	-62.3	-168.7	0	0	0	113	F17 I18 K19 S23 L24 L49 R51 L56	F17-L21 HydrophobicContact CD1-CD1 3.87Å; F17-L21 HydrophobicContact CD1-CG 4.14Å; F17-L21 HydrophobicContact CE1-CD1 3.49Å; F17-L21 VanDerWaalsContact CE1-CD1 3.49Å; F17-L21 HydrophobicContact CE1-CD2 4.25Å; F17-L21 HydrophobicContact CE1-CG 3.98Å; F17-L21 HydrophobicContact CZ-CD1 4.18Å; F17-L21 HydrophobicContact CZ-CD2 4.14Å; F17-L21 HydrophobicContact CZ-CG 4.37Å; F17-L21 WeakPolarHBondContact O-CG 3.4Å; F17-L21 PolarHBondContact O-N 3.46Å; I18-L21 PolarHBondContact O-N 3.24Å; K19-L21 VanDerWaalsContact C-N 3.32Å; K19-L21 PolarHBondContact O-N 3.13Å; L21-S23 VanDerWaalsContact C-N 3.33Å; L21-L24 HydrophobicContact CD2-CD1 4.28Å; L21-L24 PolarHBondContact O-N 3.17Å; L21-L49 HydrophobicContact CD2-CD2 4.49Å; L21-R51 PolarHBondContact O-NH1 3.41Å; L21-L56 HydrophobicContact CD1-CD2 3.55Å; L21-L56 HydrophobicContact CD2-CD1 3.57Å; L21-L56 HydrophobicContact CD2-CD2 3.19Å; L21-L56 HydrophobicContact CD2-CG 3.97Å; L21-L56 HydrophobicContact CG-CD2 3.97Å
22	S	70.7	Confident	66.1	Low	92 Å²	92	70.8 Å²	70.8	64%	0.643	42%	0.418	S	S	*	.	H	α-helix	trans	-70.4	-28.6	178.3	72.4	0	0	0	0	113.1	I18 K19 L20	I18-S22 PolarHBondContact O-N 3.34Å; K19-S22 PolarHBondContact O-N 2.81Å; K19-S22 VanDerWaalsContact O-N 3.17Å; K19-S22 PolarHBondContact O-OG 3.03Å; L20-S22 VanDerWaalsContact C-N 3.3Å; L20-S22 PolarHBondContact O-N 2.79Å
23	S	69.7	Low	66.3	Low	71 Å²	71	70 Å²	70	50%	0.497	41%	0.414	S	S	.	.	H	α-helix	trans	-80.3	-22.5	176.4	56.4	0	0	0	0	113.5	K19 L20 L21 S25	K19-S23 PolarHBondContact O-N 3.47Å; K19-S23 VanDerWaalsContact O-N 3.15Å; L20-S23 PolarHBondContact O-N 2.76Å; L20-S23 PolarHBondContact O-OG 2.82Å; L21-S23 VanDerWaalsContact C-N 3.33Å; S23-S25 PolarHBondContact O-N 3.28Å
24	L	68.9	Low	65.9	Low	7 Å²	7	71.6 Å²	71.6	4%	0.037	42%	0.419	C	S	.	.			trans	-74.1	89.1	175.6	-80.3	156.6	0	0	0	110.3	L20 L21 E29 L49 R51 L56	L20-L24 WeakPolarHBondContact O-CD1 3.49Å; L20-L24 PolarHBondContact O-N 2.94Å; L21-L24 HydrophobicContact CD2-CD1 4.28Å; L21-L24 PolarHBondContact O-N 3.17Å; L24-E29 HydrophobicContact CD2-CB 3.63Å; L24-L49 HydrophobicContact CD1-CB 3.54Å; L24-L49 HydrophobicContact CD1-CD1 3.6Å; L24-L49 HydrophobicContact CD1-CG 4.15Å; L24-R51 HydrophobicContact CB-CB 4.32Å; L24-R51 WeakPolarHBondContact O-CD 3.41Å; L24-R51 PolarHBondContact O-NH1 2.98Å; L24-L56 HydrophobicContact CD1-CD1 4.45Å
25	S	66.4	Low	65.7	Low	105 Å²	105	68.9 Å²	68.9	73%	0.734	40%	0.403	S	S	*	.	S	Bend	trans	-72.9	-41.1	177.3	54.9	0	0	0	0	112.4	S23	S23-S25 PolarHBondContact O-N 3.28Å
26	S	68.2	Low	65.2	Low	95 Å²	95	69.7 Å²	69.7	66%	0.664	41%	0.405	S	S	*	.	S	Bend	trans	-169.9	146.1	169.8	56.8	0	0	0	0	109.5
27	G	73.9	Confident	64.9	Low	36 Å²	36	68.5 Å²	68.5	37%	0.371	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	106.4	-161.1	176.1	0	0	0	0	0	114.3	R51	G27-R51 PolarHBondContact N-O 3.35Å; G27-R51 PolarHBondContact O-N 3.12Å
28	S	69.9	Low	64.2	Low	72 Å²	72	74.7 Å²	74.7	50%	0.503	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	132.4	-176.7	57.9	0	0	0	0	112.2	Y48 L49	S28-Y48 WeakPolarHBondContact CB-OH 3.35Å; S28-Y48 PolarHBondContact OG-OH 3.49Å; S28-L49 CarbonylContact C-O 3.56Å; S28-L49 VanDerWaalsContact CA-O 3.25Å; S28-L49 WeakPolarHBondContact CA-O 3.45Å
29	E	67.1	Low	64	Low	74 Å²	74	78.3 Å²	78.3	35%	0.346	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	131	173.7	-166.7	174.3	175.8	0	0	109.3	L24 L31 L49	L24-E29 HydrophobicContact CD2-CB 3.63Å; E29-L31 HydrophobicContact CG-CD2 4.27Å; E29-L31 HydrophobicContact CG-CG 4.43Å; E29-L49 PolarHBondContact N-O 2.93Å; E29-L49 PolarHBondContact O-N 3.11Å; E29-L49 VanDerWaalsContact O-O 3.11Å
30	M	65.3	Low	63.4	Low	118 Å²	118	77.5 Å²	77.5	58%	0.581	44%	0.44	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.2	123	172.7	-173.7	179.1	176.9	0	0	108.8	S46 Y48	M30-S46 VanDerWaalsContact CE-CB 3.4Å; M30-S46 WeakPolarHBondContact CE-OG 3.12Å; M30-Y48 HydrophobicContact CB-CD2 4.18Å
31	L	62.7	Low	62.7	Low	29 Å²	29	78.1 Å²	78.1	15%	0.152	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	129.6	178.3	-62.7	166.7	0	0	0	109.2	L20 E29 V33 S46 V47 L49	L20-L31 HydrophobicContact CB-CD1 4.21Å; L20-L31 HydrophobicContact CD1-CD1 3.45Å; L20-L31 VanDerWaalsContact CD1-CD1 3.45Å; L20-L31 HydrophobicContact CD2-CD1 3.47Å; L20-L31 VanDerWaalsContact CD2-CD1 3.47Å; L20-L31 HydrophobicContact CD2-CD2 4.09Å; L20-L31 HydrophobicContact CD2-CG 4.44Å; L20-L31 HydrophobicContact CG-CD1 3.86Å; E29-L31 HydrophobicContact CG-CD2 4.27Å; E29-L31 HydrophobicContact CG-CG 4.43Å; L31-V33 HydrophobicContact CB-CG1 4.25Å; L31-S46 CarbonylContact O-C 3.57Å; L31-S46 WeakPolarHBondContact O-CA 3.44Å; L31-V47 PolarHBondContact N-O 2.95Å; L31-V47 PolarHBondContact O-N 2.93Å; L31-L49 HydrophobicContact CD1-CD1 3.43Å; L31-L49 VanDerWaalsContact CD1-CD1 3.43Å; L31-L49 HydrophobicContact CD1-CG 4.3Å; L31-L49 HydrophobicContact CG-CD1 4.5Å
32	I	62	Low	62	Low	121 Å²	121	81 Å²	81	62%	0.621	46%	0.464	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.3	117	167.1	-60.6	172.5	0	0	0	106.6	F44	I32-F44 HydrophobicContact CG2-CD1 4.31Å
33	V	60.6	Low	61.4	Low	16 Å²	16	79.9 Å²	79.9	10%	0.097	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	131.8	179	-56.1	0	0	0	0	109.2	L12 L31 C35 A45 V47	L12-V33 HydrophobicContact CD1-CB 4.17Å; L12-V33 HydrophobicContact CD1-CG1 3.9Å; L12-V33 HydrophobicContact CD1-CG2 4.24Å; L12-V33 HydrophobicContact CD2-CB 4.35Å; L31-V33 HydrophobicContact CB-CG1 4.25Å; V33-C35 PolarHBondContact O-N 2.97Å; V33-A45 HydrophobicContact CG2-CB 4.01Å; V33-A45 PolarHBondContact N-O 3.41Å; V33-A45 PolarHBondContact O-N 3.45Å; V33-V47 HydrophobicContact CG1-CB 4.49Å; V33-V47 HydrophobicContact CG1-CG2 4.16Å; V33-V47 HydrophobicContact CG2-CG2 3.57Å
34	N	53.8	Low	60.9	Low	94 Å²	94	83.1 Å²	83.1	50%	0.503	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.8	108.9	172.7	-69.2	-21.2	0	0	0	107.7	I42 F44	N34-I42 HydrophobicContact CB-CG2 4.03Å; N34-F44 WeakPolarHBondContact OD1-CD1 3.35Å; N34-F44 WeakPolarHBondContact OD1-CE1 3.28Å
35	C	57.7	Low	60.6	Low	13 Å²	13	82.8 Å²	82.8	9%	0.088	45%	0.453	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.8	118.5	171	-62.6	0	0	0	0	108.3	V33 Q43	V33-C35 PolarHBondContact O-N 2.97Å; C35-Q43 PolarHBondContact N-O 2.83Å; C35-Q43 PolarHBondContact O-N 3.48Å
36	V	53.6	Low	60.4	Low	91 Å²	91	79.1 Å²	79.1	55%	0.552	43%	0.427	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.3	119.1	166.5	-175.8	0	0	0	0	107.6	I42	V36-I42 HydrophobicContact CG2-CG1 4.43Å
37	T	55.2	Low	60.3	Low	32 Å²	32	75.1 Å²	75.1	20%	0.196	40%	0.399	C	S	.	.	P	Polyproline II helix	trans	-74.6	167.5	177.3	63.1	0	0	0	0	111.3	F39 N40 A41 Q43	T37-F39 PolarHBondContact O-N 3.38Å; T37-F39 PolarHBondContact OG1-N 2.95Å; T37-N40 PolarHBondContact O-N 2.87Å; T37-A41 WeakPolarHBondContact CG2-O 3.45Å; T37-A41 PolarHBondContact N-O 3.3Å; T37-A41 WeakPolarHBondContact OG1-CB 3.04Å; T37-A41 PolarHBondContact OG1-N 3.23Å; T37-A41 PolarHBondContact OG1-O 3.39Å; T37-Q43 HydrophobicContact CG2-CB 4.42Å; T37-Q43 HydrophobicContact CG2-CG 3.8Å
38	K	52.7	Low	60	Low	168 Å²	168	77.3 Å²	77.3	73%	0.73	40%	0.396	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.3	-20.2	171.3	-69.6	-173.2	177.7	-177.1	0	113.8
39	F	62.6	Low	60	Low	180 Å²	180	73.9 Å²	73.9	79%	0.789	37%	0.372	S	S	*	.	T	Hydrogen-bonded Turn	trans	-96.5	15.7	179.1	-57.5	-73.1	0	0	0	113.2	T37 A41	T37-F39 PolarHBondContact O-N 3.38Å; T37-F39 PolarHBondContact OG1-N 2.95Å; F39-A41 PolarHBondContact O-N 3.16Å
40	N	55.2	Low	60.1	Low	136 Å²	136	72.1 Å²	72.1	73%	0.727	37%	0.368	S	S	*	.	S	Bend	trans	56.8	9.2	-172.8	-66.9	-18.4	0	0	0	115.2	T37 I42	T37-N40 PolarHBondContact O-N 2.87Å; N40-I42 PolarHBondContact O-N 2.96Å
41	A	53.4	Low	60.2	Low	47 Å²	47	71.6 Å²	71.6	39%	0.388	36%	0.359	S	S	.	.			trans	-74.3	123.8	171	0	0	0	0	0	108.8	T37 F39 Q43	T37-A41 WeakPolarHBondContact CG2-O 3.45Å; T37-A41 PolarHBondContact N-O 3.3Å; T37-A41 WeakPolarHBondContact OG1-CB 3.04Å; T37-A41 PolarHBondContact OG1-N 3.23Å; T37-A41 PolarHBondContact OG1-O 3.39Å; F39-A41 PolarHBondContact O-N 3.16Å; A41-Q43 PolarHBondContact O-N 2.81Å
42	I	52.8	Low	60.4	Low	104 Å²	104	73.5 Å²	73.5	53%	0.533	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.5	122.7	171.1	-60.2	172.5	0	0	0	107.6	N34 V36 N40	N34-I42 HydrophobicContact CB-CG2 4.03Å; V36-I42 HydrophobicContact CG2-CG1 4.43Å; N40-I42 PolarHBondContact O-N 2.96Å
43	Q	58.7	Low	60.8	Low	69 Å²	69	77 Å²	77	32%	0.322	39%	0.389	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	133.6	170.9	-66.4	-169.4	-10	0	0	109.5	C35 T37 A41 R62	C35-Q43 PolarHBondContact N-O 2.83Å; C35-Q43 PolarHBondContact O-N 3.48Å; T37-Q43 HydrophobicContact CG2-CB 4.42Å; T37-Q43 HydrophobicContact CG2-CG 3.8Å; A41-Q43 PolarHBondContact O-N 2.81Å; Q43-R62 VanDerWaalsContact OE1-CZ 3.22Å
44	F	58.2	Low	61.3	Low	138 Å²	138	80.3 Å²	80.3	61%	0.605	41%	0.413	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-80.2	126.6	174.6	-59.6	-83.8	0	0	0	109.2	I32 N34	I32-F44 HydrophobicContact CG2-CD1 4.31Å; N34-F44 WeakPolarHBondContact OD1-CD1 3.35Å; N34-F44 WeakPolarHBondContact OD1-CE1 3.28Å
45	A	61.8	Low	61.8	Low	0 Å²	0	77.5 Å²	77.5	0%	0	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.3	142.6	164.1	0	0	0	0	0	109	V33 Y60 F61	V33-A45 HydrophobicContact CG2-CB 4.01Å; V33-A45 PolarHBondContact N-O 3.41Å; V33-A45 PolarHBondContact O-N 3.45Å; A45-Y60 HydrophobicContact CB-CD2 4.12Å; A45-Y60 HydrophobicContact CB-CE1 4.42Å; A45-Y60 HydrophobicContact CB-CE2 3.25Å; A45-Y60 VanDerWaalsContact CB-CZ 3.43Å; A45-Y60 WeakPolarHBondContact CB-OH 3.36Å; A45-F61 WeakPolarHBondContact CA-O 3.21Å
46	S	63.3	Low	62.2	Low	29 Å²	29	78.4 Å²	78.4	20%	0.203	40%	0.404	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.8	122.6	168.7	-55.2	0	0	0	0	108.5	M30 L31 F61	M30-S46 VanDerWaalsContact CE-CB 3.4Å; M30-S46 WeakPolarHBondContact CE-OG 3.12Å; L31-S46 CarbonylContact O-C 3.57Å; L31-S46 WeakPolarHBondContact O-CA 3.44Å; S46-F61 PolarHBondContact N-O 3.22Å; S46-F61 PolarHBondContact O-N 3.13Å
47	V	67.1	Low	62.8	Low	11 Å²	11	76.4 Å²	76.4	7%	0.067	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.8	112.3	171.3	178.8	0	0	0	0	106.8	L31 V33 L49 V58 S59 Y60	L31-V47 PolarHBondContact N-O 2.95Å; L31-V47 PolarHBondContact O-N 2.93Å; V33-V47 HydrophobicContact CG1-CB 4.49Å; V33-V47 HydrophobicContact CG1-CG2 4.16Å; V33-V47 HydrophobicContact CG2-CG2 3.57Å; V47-L49 HydrophobicContact CG1-CD2 3.91Å; V47-L49 HydrophobicContact CG1-CG 4.1Å; V47-V58 HydrophobicContact CG1-CG1 3.86Å; V47-S59 CarbonylContact C-O 3.57Å; V47-S59 WeakPolarHBondContact CA-O 3.47Å; V47-Y60 HydrophobicContact CG2-CD2 4Å
48	Y	66.5	Low	63.3	Low	81 Å²	81	75.7 Å²	75.7	32%	0.318	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.1	126.2	170.2	180	-100.6	0	0	0	108.9	S28 M30 C50 V58 S59	S28-Y48 WeakPolarHBondContact CB-OH 3.35Å; S28-Y48 PolarHBondContact OG-OH 3.49Å; M30-Y48 HydrophobicContact CB-CD2 4.18Å; Y48-C50 HydrophobicContact CD1-CB 4.32Å; Y48-C50 HydrophobicContact CE1-CB 3.58Å; Y48-V58 CarbonylContact O-C 3.5Å; Y48-V58 WeakPolarHBondContact O-CA 3.42Å; Y48-S59 PolarHBondContact N-O 3.1Å; Y48-S59 PolarHBondContact O-N 3.47Å
49	L	71	Confident	63.8	Low	0 Å²	0	68.5 Å²	68.5	0%	0	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.5	128.4	175.3	-60.5	173.9	0	0	0	107.9	F17 L20 L21 L24 S28 E29 L31 V47 V57 V58	F17-L49 HydrophobicContact CE2-CD2 4.02Å; L20-L49 HydrophobicContact CB-CD1 4.01Å; L21-L49 HydrophobicContact CD2-CD2 4.49Å; L24-L49 HydrophobicContact CD1-CB 3.54Å; L24-L49 HydrophobicContact CD1-CD1 3.6Å; L24-L49 HydrophobicContact CD1-CG 4.15Å; S28-L49 CarbonylContact C-O 3.56Å; S28-L49 VanDerWaalsContact CA-O 3.25Å; S28-L49 WeakPolarHBondContact CA-O 3.45Å; E29-L49 PolarHBondContact N-O 2.93Å; E29-L49 PolarHBondContact O-N 3.11Å; E29-L49 VanDerWaalsContact O-O 3.11Å; L31-L49 HydrophobicContact CD1-CD1 3.43Å; L31-L49 VanDerWaalsContact CD1-CD1 3.43Å; L31-L49 HydrophobicContact CD1-CG 4.3Å; L31-L49 HydrophobicContact CG-CD1 4.5Å; V47-L49 HydrophobicContact CG1-CD2 3.91Å; V47-L49 HydrophobicContact CG1-CG 4.1Å; L49-V57 CarbonylContact C-O 3.56Å; L49-V57 WeakPolarHBondContact CA-O 3.43Å; L49-V58 HydrophobicContact CD2-CB 4Å; L49-V58 HydrophobicContact CD2-CG1 3.74Å; L49-V58 HydrophobicContact CD2-CG2 3.37Å
50	C	68.1	Low	63.7	Low	38 Å²	38	61.5 Å²	61.5	26%	0.257	33%	0.327	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.1	113.4	174.3	178.5	0	0	0	0	108.9	Y48 V57	Y48-C50 HydrophobicContact CD1-CB 4.32Å; Y48-C50 HydrophobicContact CE1-CB 3.58Å; C50-V57 HydrophobicContact CB-CB 4.28Å; C50-V57 PolarHBondContact N-O 3.08Å; C50-V57 PolarHBondContact O-N 3.14Å
51	R	66.7	Low	64	Low	106 Å²	106	59.4 Å²	59.4	40%	0.4	31%	0.311	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.1	110.8	176.3	-170.9	-178.3	-178.1	165.6	1.2	109.6	L21 L24 G27 S55 L56	L21-R51 PolarHBondContact O-NH1 3.41Å; L24-R51 HydrophobicContact CB-CB 4.32Å; L24-R51 WeakPolarHBondContact O-CD 3.41Å; L24-R51 PolarHBondContact O-NH1 2.98Å; G27-R51 PolarHBondContact N-O 3.35Å; G27-R51 PolarHBondContact O-N 3.12Å; R51-S55 CarbonylContact C-O 3.48Å; R51-S55 WeakPolarHBondContact CA-O 3.39Å; R51-L56 HydrophobicContact CB-CD1 4.3Å
52	S	68.5	Low	64.3	Low	69 Å²	69	61.4 Å²	61.4	48%	0.483	31%	0.309	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.1	167.3	161.8	-172.1	0	0	0	0	110	S54 S55	S52-S54 PolarHBondContact O-N 2.95Å; S52-S55 PolarHBondContact N-O 3.27Å; S52-S55 PolarHBondContact O-N 2.94Å; S52-S55 VanDerWaalsContact O-N 3.08Å; S52-S55 VanDerWaalsContact O-O 3.11Å
53	H	70.4	Confident	64.4	Low	195 Å²	195	66.9 Å²	66.9	90%	0.903	33%	0.329	S	S	*	.	T	Hydrogen-bonded Turn	trans	-44.3	-39.2	-172.1	-70.5	-68.8	0	0	0	115
54	S	69.6	Low	64.1	Low	86 Å²	86	67.9 Å²	67.9	60%	0.601	34%	0.343	S	S	*	.	T	Hydrogen-bonded Turn	trans	-126.7	10.6	-179.6	56.8	0	0	0	0	113.3	S52	S52-S54 PolarHBondContact O-N 2.95Å
55	S	65.5	Low	63.5	Low	34 Å²	34	63.6 Å²	63.6	24%	0.238	33%	0.33	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.6	135.1	-169.8	-58.6	0	0	0	0	111.7	R51 S52	R51-S55 CarbonylContact C-O 3.48Å; R51-S55 WeakPolarHBondContact CA-O 3.39Å; S52-S55 PolarHBondContact N-O 3.27Å; S52-S55 PolarHBondContact O-N 2.94Å; S52-S55 VanDerWaalsContact O-N 3.08Å; S52-S55 VanDerWaalsContact O-O 3.11Å
56	L	65.2	Low	62.5	Low	33 Å²	33	67.4 Å²	67.4	17%	0.173	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	118.4	169.3	176.5	76.7	0	0	0	108.8	F17 L21 L24 R51 V58	F17-L56 HydrophobicContact CE1-CD2 4.44Å; F17-L56 HydrophobicContact CZ-CD2 4.12Å; L21-L56 HydrophobicContact CD1-CD2 3.55Å; L21-L56 HydrophobicContact CD2-CD1 3.57Å; L21-L56 HydrophobicContact CD2-CD2 3.19Å; L21-L56 HydrophobicContact CD2-CG 3.97Å; L21-L56 HydrophobicContact CG-CD2 3.97Å; L24-L56 HydrophobicContact CD1-CD1 4.45Å; R51-L56 HydrophobicContact CB-CD1 4.3Å; L56-V58 HydrophobicContact CD1-CG2 4.47Å; L56-V58 HydrophobicContact CD2-CG2 3.82Å; L56-V58 HydrophobicContact CG-CG2 3.91Å
57	V	66.9	Low	61.5	Low	48 Å²	48	68.6 Å²	68.6	29%	0.291	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	125.9	167.9	-176	0	0	0	0	107.7	L49 C50 P71	L49-V57 CarbonylContact C-O 3.56Å; L49-V57 WeakPolarHBondContact CA-O 3.43Å; C50-V57 HydrophobicContact CB-CB 4.28Å; C50-V57 PolarHBondContact N-O 3.08Å; C50-V57 PolarHBondContact O-N 3.14Å; V57-P71 HydrophobicContact CG2-CB 4.17Å
58	V	64.6	Low	60	Low	17 Å²	17	74.6 Å²	74.6	10%	0.103	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	142.4	169.6	-179	0	0	0	0	107.2	F17 V47 Y48 L49 L56 F69	F17-V58 HydrophobicContact CE2-CG1 4.19Å; F17-V58 HydrophobicContact CE2-CG2 3.87Å; F17-V58 HydrophobicContact CZ-CG2 3.63Å; V47-V58 HydrophobicContact CG1-CG1 3.86Å; Y48-V58 CarbonylContact O-C 3.5Å; Y48-V58 WeakPolarHBondContact O-CA 3.42Å; L49-V58 HydrophobicContact CD2-CB 4Å; L49-V58 HydrophobicContact CD2-CG1 3.74Å; L49-V58 HydrophobicContact CD2-CG2 3.37Å; L56-V58 HydrophobicContact CD1-CG2 4.47Å; L56-V58 HydrophobicContact CD2-CG2 3.82Å; L56-V58 HydrophobicContact CG-CG2 3.91Å; V58-F69 HydrophobicContact CB-CD1 4.38Å; V58-F69 VanDerWaalsContact O-CB 3.32Å; V58-F69 WeakPolarHBondContact O-CB 3.47Å
59	S	63.4	Low	58.9	Low	17 Å²	17	74.3 Å²	74.3	12%	0.119	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.4	130.9	175.4	-67.5	0	0	0	0	109.2	V47 Y48	V47-S59 CarbonylContact C-O 3.57Å; V47-S59 WeakPolarHBondContact CA-O 3.47Å; Y48-S59 PolarHBondContact N-O 3.1Å; Y48-S59 PolarHBondContact O-N 3.47Å
60	Y	61.6	Low	57.2	Low	34 Å²	34	82.7 Å²	82.7	13%	0.133	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112	115.7	-174.5	178.3	-91.6	0	0	0	110.1	A45 V47 R62 C67	A45-Y60 HydrophobicContact CB-CD2 4.12Å; A45-Y60 HydrophobicContact CB-CE1 4.42Å; A45-Y60 HydrophobicContact CB-CE2 3.25Å; A45-Y60 VanDerWaalsContact CB-CZ 3.43Å; A45-Y60 WeakPolarHBondContact CB-OH 3.36Å; V47-Y60 HydrophobicContact CG2-CD2 4Å; Y60-R62 HydrophobicContact CD1-CB 4.4Å; Y60-R62 HydrophobicContact CE1-CB 3.64Å; Y60-R62 HydrophobicContact CE1-CG 4.46Å; Y60-C67 HydrophobicContact CD1-CB 3.88Å; Y60-C67 PolarHBondContact N-O 3.25Å; Y60-C67 VanDerWaalsContact N-O 3.16Å; Y60-C67 CarbonylContact O-C 3.44Å; Y60-C67 PolarHBondContact O-N 2.87Å
61	F	60.7	Low	55.6	Low	91 Å²	91	83.7 Å²	83.7	40%	0.399	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.4	109.3	176.7	-58.3	-90.1	0	0	0	108.9	A45 S46	A45-F61 WeakPolarHBondContact CA-O 3.21Å; S46-F61 PolarHBondContact N-O 3.22Å; S46-F61 PolarHBondContact O-N 3.13Å
62	R	59.1	Low	54.3	Low	90 Å²	90	87 Å²	87	34%	0.34	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.6	140.5	164.9	-168.9	175.7	178.2	-159.1	1.3	108	Q43 Y60 S64 S65	Q43-R62 VanDerWaalsContact OE1-CZ 3.22Å; Y60-R62 HydrophobicContact CD1-CB 4.4Å; Y60-R62 HydrophobicContact CE1-CB 3.64Å; Y60-R62 HydrophobicContact CE1-CG 4.46Å; R62-S64 PolarHBondContact O-N 3.45Å; R62-S65 WeakPolarHBondContact CB-O 3.43Å; R62-S65 PolarHBondContact N-O 2.93Å; R62-S65 CarbonylContact O-C 3.55Å; R62-S65 PolarHBondContact O-N 2.96Å
63	K	56.4	Low	52.4	Low	218 Å²	218	89.8 Å²	89.8	95%	0.948	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.8	-19.3	177.6	-163.8	175.8	-179.9	178.8	0	113.5
64	S	52.5	Low	50.7	Low	90 Å²	90	90.3 Å²	90.3	63%	0.629	46%	0.464	S	S	*	.	T	Hydrogen-bonded Turn	trans	-114.2	2.8	178.9	64.7	0	0	0	0	115.7	R62	R62-S64 PolarHBondContact O-N 3.45Å
65	S	45.5	Very low	49.7	Very low	48 Å²	48	90.5 Å²	90.5	34%	0.336	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-171.7	119.8	178.4	54.6	0	0	0	0	110.8	R62 C67	R62-S65 WeakPolarHBondContact CB-O 3.43Å; R62-S65 PolarHBondContact N-O 2.93Å; R62-S65 CarbonylContact O-C 3.55Å; R62-S65 PolarHBondContact O-N 2.96Å; S65-C67 PolarHBondContact O-N 3.02Å
66	S	40	Very low	48.9	Very low	81 Å²	81	93.5 Å²	93.5	57%	0.566	47%	0.469	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.6	113	168	49.3	0	0	0	0	109.5
67	C	41.8	Very low	48	Very low	54 Å²	54	96.8 Å²	96.8	37%	0.365	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.6	106.3	170.1	-61.3	0	0	0	0	108.2	Y60 S65	Y60-C67 HydrophobicContact CD1-CB 3.88Å; Y60-C67 PolarHBondContact N-O 3.25Å; Y60-C67 VanDerWaalsContact N-O 3.16Å; Y60-C67 CarbonylContact O-C 3.44Å; Y60-C67 PolarHBondContact O-N 2.87Å; S65-C67 PolarHBondContact O-N 3.02Å
68	H	36.9	Very low	46.9	Very low	137 Å²	137	99.7 Å²	99.7	63%	0.634	50%	0.497	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81	127.2	172.2	-64.8	-97	0	0	0	108.6
69	F	42.3	Very low	45.8	Very low	75 Å²	75	104.9 Å²	104.9	33%	0.329	52%	0.522	S	S	.	.			trans	-105.8	138	172.3	-171.8	-90.7	0	0	0	108.7	V58 Y72	V58-F69 HydrophobicContact CB-CD1 4.38Å; V58-F69 VanDerWaalsContact O-CB 3.32Å; V58-F69 WeakPolarHBondContact O-CB 3.47Å; F69-Y72 HydrophobicContact CZ-CD2 4.21Å
70	F	36.2	Very low	44.6	Very low	176 Å²	176	110.7 Å²	110.7	77%	0.772	55%	0.549	S	S	*	.			trans	-89.2	139.8	175.9	-70.3	-85.2	0	0	0	109.3	Y72	F70-Y72 PolarHBondContact O-N 3.49Å
71	P	34.5	Very low	43.4	Very low	59 Å²	59	116.2 Å²	116.2	38%	0.383	58%	0.578	S	S	.	*			trans	-53.5	130.6	-173.7	19	-30.3	0	0	0	111.7	V57 I73	V57-P71 HydrophobicContact CG2-CB 4.17Å; P71-I73 PolarHBondContact O-N 2.96Å
72	Y	38.1	Very low	42.1	Very low	174 Å²	174	118.2 Å²	118.2	68%	0.682	59%	0.592	S	S	*	*	B	Isolated β-bridge	trans	-76.7	111.8	159.5	-129.7	-90.6	0	0	0	106	F69 F70	F69-Y72 HydrophobicContact CZ-CD2 4.21Å; F70-Y72 PolarHBondContact O-N 3.49Å
73	I	29.8	Very low	40.7	Very low	128 Å²	128	120.5 Å²	120.5	66%	0.656	61%	0.613	S	S	*	*			trans	-82.3	116	169.9	-55.2	173.6	0	0	0	105.7	P71	P71-I73 PolarHBondContact O-N 2.96Å
74	I	33.9	Very low	39.2	Very low	206 Å²	206	111.6 Å²	111.6	100%	1.056	58%	0.583	S	S	*	*			trans	-94.4	0	161.4	-58.9	176.7	0	0	0	106.7

Retrieved 74 of 74 residues in 74.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).