G4VPE9_SCHMA Loading...

Guanine nucleotide-binding protein subunit gamma

AlphaFold DB , UniProt , Accession G4VPE9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 79 aa.

						>G4VPE9_SCHMA|G4VPE9
MNSLDNPGEGDQNNPRQAEIEQKKLDIACYKHSLELNRIALSKTIWDIRNYCFTNAQNDPLLCPPRDNPYKSQRSCTVI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.7	Very low	48.6	Very low	236 Å²	236	142.5 Å²	142.5	100%	1.163	84%	0.837	S	S	*	*				0	106.2	0	-97.6	91.9	170	0	0	107.8
2	N	43.9	Very low	49.3	Very low	162 Å²	162	145.3 Å²	145.3	87%	0.866	84%	0.836	S	S	*	*	P	Polyproline II helix	trans	-81	116.6	170.9	-71.7	-9.2	0	0	0	107.6
3	S	49.4	Very low	50.4	Low	124 Å²	124	146.5 Å²	146.5	87%	0.867	84%	0.837	S	S	*	*	P	Polyproline II helix	trans	-85	120.9	168.8	-68.6	0	0	0	0	108.4
4	L	55.8	Low	52.2	Low	166 Å²	166	140.1 Å²	140.1	87%	0.869	80%	0.8	S	S	*	*	P	Polyproline II helix	trans	-67.5	145.3	-175.5	-71.9	139.8	0	0	0	112.3
5	D	49.1	Very low	54.6	Low	159 Å²	159	137.1 Å²	137.1	85%	0.85	79%	0.787	S	S	*	*			trans	-41.3	138.1	159.9	-69.7	-62	0	0	0	113.1
6	N	58.8	Low	57	Low	156 Å²	156	138.7 Å²	138.7	83%	0.834	78%	0.776	S	S	*	*			trans	-160.4	155.8	145.3	-135.2	5.2	0	0	0	110
7	P	47.1	Very low	59.1	Low	98 Å²	98	134.9 Å²	134.9	64%	0.636	75%	0.751	S	S	*	*				-116.3	141	-95.3	33.6	-18.6	0	0	0	110.1	E9	P7-E9 PolarHBondContact O-N 3.01Å
8	G	43.1	Very low	60.9	Low	87 Å²	87	130.4 Å²	130.4	90%	0.897	73%	0.734	S	S	*	*			trans	-59.8	111.1	173	0	0	0	0	0	110.6
9	E	46.5	Very low	62.8	Low	193 Å²	193	129.4 Å²	129.4	90%	0.902	72%	0.722	S	S	*	*			trans	-52.3	152.2	172	-65.3	168.8	125.3	0	0	111.6	P7	P7-E9 PolarHBondContact O-N 3.01Å
10	G	40.7	Very low	64.4	Low	65 Å²	65	125.4 Å²	125.4	67%	0.67	70%	0.699	S	S	*	*			trans	-58	131.3	-159.8	0	0	0	0	0	116	Q12	G10-Q12 VanDerWaalsContact C-N 3.27Å; G10-Q12 PolarHBondContact O-N 3.21Å
11	D	51.4	Low	65.9	Low	121 Å²	121	124.1 Å²	124.1	65%	0.647	69%	0.688	S	S	*	*			trans	-75.4	86.9	162.4	-163	12.5	0	0	0	108.5	N13 N14	D11-N13 PolarHBondContact O-N 3.06Å; D11-N13 VanDerWaalsContact O-N 3.16Å; D11-N14 WeakPolarHBondContact OD2-CB 3.42Å
12	Q	57.1	Low	68.2	Low	177 Å²	177	117.7 Å²	117.7	83%	0.827	66%	0.655	S	S	*	*			trans	-57.9	108.4	168.7	-63.6	174.4	-6.1	0	0	108.8	G10 N14	G10-Q12 VanDerWaalsContact C-N 3.27Å; G10-Q12 PolarHBondContact O-N 3.21Å; Q12-N14 PolarHBondContact O-N 2.98Å; Q12-N14 VanDerWaalsContact O-N 3.11Å
13	N	63.2	Low	70.8	Confident	160 Å²	160	115.9 Å²	115.9	86%	0.856	64%	0.639	S	S	*	*			trans	40.7	57.5	162	-95.1	-29.3	0	0	0	115.1	D11 P15	D11-N13 PolarHBondContact O-N 3.06Å; D11-N13 VanDerWaalsContact O-N 3.16Å; N13-P15 WeakPolarHBondContact O-CD 3.32Å; N13-P15 VanDerWaalsContact O-N 3.13Å
14	N	76.1	Confident	73.1	Confident	58 Å²	58	116.1 Å²	116.1	31%	0.31	63%	0.625	S	S	.	*			trans	-65.8	112.9	170.8	-173.2	-11.9	0	0	0	108.8	D11 Q12 R16 Q17 A18	D11-N14 WeakPolarHBondContact OD2-CB 3.42Å; Q12-N14 PolarHBondContact O-N 2.98Å; Q12-N14 VanDerWaalsContact O-N 3.11Å; N14-R16 PolarHBondContact O-N 3.16Å; N14-R16 VanDerWaalsContact OD1-CB 3.32Å; N14-R16 WeakPolarHBondContact OD1-CB 3.48Å; N14-R16 PolarHBondContact OD1-N 3.42Å; N14-Q17 HydrophobicContact CB-CB 3.98Å; N14-Q17 WeakPolarHBondContact O-CA 3.38Å; N14-Q17 WeakPolarHBondContact O-CB 3.17Å; N14-Q17 PolarHBondContact O-N 3.19Å; N14-A18 PolarHBondContact O-N 2.97Å
15	P	88.7	Confident	75.1	Confident	94 Å²	94	113.6 Å²	113.6	61%	0.61	61%	0.611	S	S	*	*	H	α-helix	trans	-56.5	-30.5	-177.9	22.4	-33.5	0	0	0	111.7	N13 A18 E19	N13-P15 WeakPolarHBondContact O-CD 3.32Å; N13-P15 VanDerWaalsContact O-N 3.13Å; P15-A18 PolarHBondContact O-N 3Å; P15-E19 WeakPolarHBondContact O-CG 3.37Å; P15-E19 PolarHBondContact O-N 3.11Å
16	R	92.1	Very high	77.5	Confident	163 Å²	163	108.9 Å²	108.9	62%	0.615	59%	0.586	S	S	*	*	H	α-helix	trans	-65.6	-37	174.6	-172.4	175.8	-179.6	-88.6	0.3	112.8	N14 E19 I20	N14-R16 PolarHBondContact O-N 3.16Å; N14-R16 VanDerWaalsContact OD1-CB 3.32Å; N14-R16 WeakPolarHBondContact OD1-CB 3.48Å; N14-R16 PolarHBondContact OD1-N 3.42Å; R16-E19 PolarHBondContact O-N 3.16Å; R16-I20 HydrophobicContact CG-CD1 4.2Å; R16-I20 WeakPolarHBondContact O-CD1 3.42Å; R16-I20 VanDerWaalsContact O-CG1 3.24Å; R16-I20 WeakPolarHBondContact O-CG1 3.24Å; R16-I20 PolarHBondContact O-N 3.44Å
17	Q	92.7	Very high	79.4	Confident	75 Å²	75	105.7 Å²	105.7	35%	0.35	57%	0.568	S	S	.	*	H	α-helix	trans	-68.8	-43.2	177.8	-178.4	59.9	26.9	0	0	110.5	N14 E19 I20 E21	N14-Q17 HydrophobicContact CB-CB 3.98Å; N14-Q17 WeakPolarHBondContact O-CA 3.38Å; N14-Q17 WeakPolarHBondContact O-CB 3.17Å; N14-Q17 PolarHBondContact O-N 3.19Å; Q17-E19 VanDerWaalsContact C-N 3.34Å; Q17-E19 PolarHBondContact O-N 3Å; Q17-I20 PolarHBondContact O-N 3.47Å; Q17-I20 VanDerWaalsContact O-N 3.16Å; Q17-E21 PolarHBondContact NE2-OE1 3.45Å; Q17-E21 WeakPolarHBondContact O-CG 3.32Å; Q17-E21 PolarHBondContact O-N 2.84Å
18	A	92.3	Very high	81.8	Confident	53 Å²	53	103.5 Å²	103.5	44%	0.438	56%	0.559	S	S	.	*	H	α-helix	trans	-59.3	-43.1	173.1	0	0	0	0	0	112	N14 P15 I20 E21 Q22	N14-A18 PolarHBondContact O-N 2.97Å; P15-A18 PolarHBondContact O-N 3Å; A18-I20 PolarHBondContact O-N 2.92Å; A18-E21 PolarHBondContact O-N 2.85Å; A18-Q22 PolarHBondContact O-N 3.33Å
19	E	95.9	Very high	84.4	Confident	111 Å²	111	102.9 Å²	102.9	52%	0.519	54%	0.54	S	S	.	.	H	α-helix	trans	-61.6	-40.2	173.8	-75.7	177.6	-166	0	0	113.2	P15 R16 Q17 K23	P15-E19 WeakPolarHBondContact O-CG 3.37Å; P15-E19 PolarHBondContact O-N 3.11Å; R16-E19 PolarHBondContact O-N 3.16Å; Q17-E19 VanDerWaalsContact C-N 3.34Å; Q17-E19 PolarHBondContact O-N 3Å; E19-K23 VanDerWaalsContact O-CG 3.32Å; E19-K23 WeakPolarHBondContact O-CG 3.49Å; E19-K23 PolarHBondContact O-N 3.47Å
20	I	96.2	Very high	86.9	Confident	49 Å²	49	101.3 Å²	101.3	25%	0.251	53%	0.527	S	S	.	.	H	α-helix	trans	-65.4	-42.4	177.3	-72.6	165.4	0	0	0	110.3	R16 Q17 A18 K23 K24	R16-I20 HydrophobicContact CG-CD1 4.2Å; R16-I20 WeakPolarHBondContact O-CD1 3.42Å; R16-I20 VanDerWaalsContact O-CG1 3.24Å; R16-I20 WeakPolarHBondContact O-CG1 3.24Å; R16-I20 PolarHBondContact O-N 3.44Å; Q17-I20 PolarHBondContact O-N 3.47Å; Q17-I20 VanDerWaalsContact O-N 3.16Å; A18-I20 PolarHBondContact O-N 2.92Å; I20-K23 PolarHBondContact O-N 3.01Å; I20-K24 HydrophobicContact CG2-CD 4.37Å; I20-K24 WeakPolarHBondContact O-CG 3.5Å; I20-K24 PolarHBondContact O-N 2.88Å
21	E	96.1	Very high	89.6	Confident	99 Å²	99	104.7 Å²	104.7	46%	0.463	52%	0.523	S	S	.	.	H	α-helix	trans	-63.8	-44.2	177.1	-74.1	170.7	-168.6	0	0	111.5	Q17 A18 K23 K24 L25	Q17-E21 PolarHBondContact NE2-OE1 3.45Å; Q17-E21 WeakPolarHBondContact O-CG 3.32Å; Q17-E21 PolarHBondContact O-N 2.84Å; A18-E21 PolarHBondContact O-N 2.85Å; E21-K23 PolarHBondContact O-N 2.92Å; E21-K24 WeakPolarHBondContact O-CB 3.46Å; E21-K24 PolarHBondContact O-N 3.04Å; E21-L25 WeakPolarHBondContact O-CG 3.44Å; E21-L25 PolarHBondContact O-N 3.17Å
22	Q	96.6	Very high	91.8	Very high	102 Å²	102	104.4 Å²	104.4	48%	0.477	52%	0.517	S	S	.	.	H	α-helix	trans	-58.8	-47.3	174	-174.2	58.7	52.2	0	0	111.6	A18 K24 L25 D26	A18-Q22 PolarHBondContact O-N 3.33Å; Q22-K24 VanDerWaalsContact C-N 3.27Å; Q22-K24 PolarHBondContact O-N 3.39Å; Q22-L25 WeakPolarHBondContact O-CB 3.4Å; Q22-L25 PolarHBondContact O-N 2.89Å; Q22-D26 PolarHBondContact NE2-OD1 3.29Å; Q22-D26 VanDerWaalsContact O-CG 3.28Å; Q22-D26 PolarHBondContact O-N 3.06Å
23	K	97.8	Very high	93.7	Very high	123 Å²	123	98 Å²	98	54%	0.535	49%	0.492	S	S	.	.	H	α-helix	trans	-60.9	-35.1	177.5	-74.5	170.5	-178.4	166.7	0	112.6	E19 I20 E21 D26 I27	E19-K23 VanDerWaalsContact O-CG 3.32Å; E19-K23 WeakPolarHBondContact O-CG 3.49Å; E19-K23 PolarHBondContact O-N 3.47Å; I20-K23 PolarHBondContact O-N 3.01Å; E21-K23 PolarHBondContact O-N 2.92Å; K23-D26 PolarHBondContact O-N 3.48Å; K23-I27 WeakPolarHBondContact O-CB 3.36Å; K23-I27 VanDerWaalsContact O-CG1 3.25Å; K23-I27 WeakPolarHBondContact O-CG1 3.25Å; K23-I27 PolarHBondContact O-N 2.99Å
24	K	98.2	Very high	95.4	Very high	130 Å²	130	97 Å²	97	57%	0.565	49%	0.486	S	S	*	.	H	α-helix	trans	-65.6	-41.1	174.3	-74	172.6	179.5	176.8	0	111.5	I20 E21 Q22 I27 A28	I20-K24 HydrophobicContact CG2-CD 4.37Å; I20-K24 WeakPolarHBondContact O-CG 3.5Å; I20-K24 PolarHBondContact O-N 2.88Å; E21-K24 WeakPolarHBondContact O-CB 3.46Å; E21-K24 PolarHBondContact O-N 3.04Å; Q22-K24 VanDerWaalsContact C-N 3.27Å; Q22-K24 PolarHBondContact O-N 3.39Å; K24-I27 PolarHBondContact O-N 2.89Å; K24-A28 WeakPolarHBondContact O-CB 3.37Å; K24-A28 PolarHBondContact O-N 3.47Å
25	L	98.1	Very high	96.4	Very high	112 Å²	112	100.6 Å²	100.6	59%	0.586	50%	0.501	S	S	*	.	H	α-helix	trans	-63.7	-44.1	174.7	-66.8	173.2	0	0	0	111.5	E21 Q22 I27 A28 C29	E21-L25 WeakPolarHBondContact O-CG 3.44Å; E21-L25 PolarHBondContact O-N 3.17Å; Q22-L25 WeakPolarHBondContact O-CB 3.4Å; Q22-L25 PolarHBondContact O-N 2.89Å; L25-I27 PolarHBondContact O-N 3.19Å; L25-A28 WeakPolarHBondContact O-CB 3.48Å; L25-A28 PolarHBondContact O-N 2.98Å; L25-C29 PolarHBondContact O-N 3.48Å
26	D	98.3	Very high	96.7	Very high	60 Å²	60	100.5 Å²	100.5	32%	0.321	50%	0.495	S	S	.	.	H	α-helix	trans	-60.8	-45.3	177.1	-61.9	-17.6	0	0	0	111.1	Q22 K23 A28 C29 Y30	Q22-D26 PolarHBondContact NE2-OD1 3.29Å; Q22-D26 VanDerWaalsContact O-CG 3.28Å; Q22-D26 PolarHBondContact O-N 3.06Å; K23-D26 PolarHBondContact O-N 3.48Å; D26-A28 VanDerWaalsContact C-N 3.33Å; D26-A28 PolarHBondContact O-N 2.9Å; D26-C29 WeakPolarHBondContact O-CB 3.48Å; D26-C29 PolarHBondContact O-N 3.43Å; D26-Y30 HydrophobicContact CB-CE2 4.21Å; D26-Y30 WeakPolarHBondContact O-CD2 3.49Å; D26-Y30 VanDerWaalsContact O-CG 3.31Å; D26-Y30 PolarHBondContact O-N 2.91Å
27	I	98.4	Very high	97	Very high	90 Å²	90	100.6 Å²	100.6	46%	0.462	51%	0.507	S	S	.	.	H	α-helix	trans	-61	-42.4	175.5	-70.9	166.5	0	0	0	111.2	K23 K24 L25 C29 Y30 K31	K23-I27 WeakPolarHBondContact O-CB 3.36Å; K23-I27 VanDerWaalsContact O-CG1 3.25Å; K23-I27 WeakPolarHBondContact O-CG1 3.25Å; K23-I27 PolarHBondContact O-N 2.99Å; K24-I27 PolarHBondContact O-N 2.89Å; L25-I27 PolarHBondContact O-N 3.19Å; I27-C29 VanDerWaalsContact C-N 3.32Å; I27-Y30 PolarHBondContact O-N 3.4Å; I27-K31 HydrophobicContact CG2-CD 4.18Å; I27-K31 HydrophobicContact CG2-CG 4.45Å; I27-K31 WeakPolarHBondContact O-CG 3.21Å; I27-K31 PolarHBondContact O-N 3.34Å
28	A	98.1	Very high	97.2	Very high	52 Å²	52	105.4 Å²	105.4	43%	0.43	52%	0.523	S	S	.	.	H	α-helix	trans	-62.1	-41.8	176.2	0	0	0	0	0	111.3	K24 L25 D26 K31 H32	K24-A28 WeakPolarHBondContact O-CB 3.37Å; K24-A28 PolarHBondContact O-N 3.47Å; L25-A28 WeakPolarHBondContact O-CB 3.48Å; L25-A28 PolarHBondContact O-N 2.98Å; D26-A28 VanDerWaalsContact C-N 3.33Å; D26-A28 PolarHBondContact O-N 2.9Å; A28-K31 PolarHBondContact O-N 3.19Å; A28-H32 WeakPolarHBondContact O-CB 3.43Å; A28-H32 PolarHBondContact O-N 2.99Å
29	C	98	Very high	97.4	Very high	74 Å²	74	108.2 Å²	108.2	50%	0.5	53%	0.529	S	S	.	.	H	α-helix	trans	-61.4	-44	174.8	-175.4	0	0	0	0	112.2	L25 D26 I27 H32 S33	L25-C29 PolarHBondContact O-N 3.48Å; D26-C29 WeakPolarHBondContact O-CB 3.48Å; D26-C29 PolarHBondContact O-N 3.43Å; I27-C29 VanDerWaalsContact C-N 3.32Å; C29-H32 PolarHBondContact O-N 2.93Å; C29-S33 WeakPolarHBondContact O-CB 3.35Å; C29-S33 PolarHBondContact O-N 2.84Å; C29-S33 PolarHBondContact O-OG 3.13Å
30	Y	98.2	Very high	97.5	Very high	160 Å²	160	105.8 Å²	105.8	63%	0.627	53%	0.528	S	S	*	.	H	α-helix	trans	-65.4	-42.8	176.9	-63.3	-38.2	0	0	0	112.4	D26 I27 H32 S33 L34	D26-Y30 HydrophobicContact CB-CE2 4.21Å; D26-Y30 WeakPolarHBondContact O-CD2 3.49Å; D26-Y30 VanDerWaalsContact O-CG 3.31Å; D26-Y30 PolarHBondContact O-N 2.91Å; I27-Y30 PolarHBondContact O-N 3.4Å; Y30-H32 VanDerWaalsContact C-N 3.33Å; Y30-H32 PolarHBondContact O-N 3.45Å; Y30-S33 WeakPolarHBondContact O-CB 3.45Å; Y30-S33 PolarHBondContact O-N 3.01Å; Y30-L34 WeakPolarHBondContact O-CG 3.43Å; Y30-L34 PolarHBondContact O-N 3.23Å; Y30-L34 VanDerWaalsContact O-N 3.13Å
31	K	98.3	Very high	97.6	Very high	135 Å²	135	109.4 Å²	109.4	59%	0.587	55%	0.547	S	S	*	.	H	α-helix	trans	-58.8	-46	175.2	-75.4	178.1	177.1	-176	0	111.2	I27 A28 S33 L34	I27-K31 HydrophobicContact CG2-CD 4.18Å; I27-K31 HydrophobicContact CG2-CG 4.45Å; I27-K31 WeakPolarHBondContact O-CG 3.21Å; I27-K31 PolarHBondContact O-N 3.34Å; A28-K31 PolarHBondContact O-N 3.19Å; K31-S33 VanDerWaalsContact C-N 3.33Å; K31-S33 PolarHBondContact O-N 3.08Å; K31-L34 WeakPolarHBondContact O-CB 3.49Å; K31-L34 PolarHBondContact O-N 3.21Å
32	H	97.7	Very high	97.7	Very high	115 Å²	115	109.1 Å²	109.1	53%	0.532	56%	0.556	S	S	.	*	H	α-helix	trans	-62.5	-39.9	175.8	-175.7	53.8	0	0	0	112.5	A28 C29 Y30 L34 E35	A28-H32 WeakPolarHBondContact O-CB 3.43Å; A28-H32 PolarHBondContact O-N 2.99Å; C29-H32 PolarHBondContact O-N 2.93Å; Y30-H32 VanDerWaalsContact C-N 3.33Å; Y30-H32 PolarHBondContact O-N 3.45Å; H32-L34 PolarHBondContact O-N 3.18Å; H32-E35 IonicContact ND1-OE2 3.34Å; H32-E35 PolarHBondContact ND1-OE2 3.39Å; H32-E35 WeakPolarHBondContact O-CB 3.42Å; H32-E35 PolarHBondContact O-N 3.44Å; H32-E35 VanDerWaalsContact O-N 3.08Å
33	S	97.5	Very high	97.8	Very high	43 Å²	43	108.9 Å²	108.9	30%	0.301	55%	0.553	S	S	.	*	H	α-helix	trans	-64.9	-23.3	178.2	-60.9	0	0	0	0	113.9	C29 Y30 K31 R38	C29-S33 WeakPolarHBondContact O-CB 3.35Å; C29-S33 PolarHBondContact O-N 2.84Å; C29-S33 PolarHBondContact O-OG 3.13Å; Y30-S33 WeakPolarHBondContact O-CB 3.45Å; Y30-S33 PolarHBondContact O-N 3.01Å; K31-S33 VanDerWaalsContact C-N 3.33Å; K31-S33 PolarHBondContact O-N 3.08Å; S33-R38 PolarHBondContact O-NH2 3.26Å
34	L	97.5	Very high	97.8	Very high	139 Å²	139	104.9 Å²	104.9	73%	0.728	54%	0.539	S	S	*	.	H	α-helix	trans	-75.8	-26.9	174.6	-69.1	171.7	0	0	0	112.4	Y30 K31 H32 L36	Y30-L34 WeakPolarHBondContact O-CG 3.43Å; Y30-L34 PolarHBondContact O-N 3.23Å; Y30-L34 VanDerWaalsContact O-N 3.13Å; K31-L34 WeakPolarHBondContact O-CB 3.49Å; K31-L34 PolarHBondContact O-N 3.21Å; H32-L34 PolarHBondContact O-N 3.18Å; L34-L36 PolarHBondContact O-N 3.03Å
35	E	97.4	Very high	97.9	Very high	133 Å²	133	103.3 Å²	103.3	62%	0.621	54%	0.536	S	S	*	.	S	Bend	trans	-76	-9.4	178.7	-61.8	167.4	170.6	0	0	112.8	H32 N37	H32-E35 IonicContact ND1-OE2 3.34Å; H32-E35 PolarHBondContact ND1-OE2 3.39Å; H32-E35 WeakPolarHBondContact O-CB 3.42Å; H32-E35 PolarHBondContact O-N 3.44Å; H32-E35 VanDerWaalsContact O-N 3.08Å; E35-N37 PolarHBondContact O-N 3.34Å
36	L	96.4	Very high	97.9	Very high	92 Å²	92	104.7 Å²	104.7	48%	0.482	53%	0.534	S	S	.	.			trans	-66.7	118.9	180	-63.4	177.6	0	0	0	111.9	L34 R38	L34-L36 PolarHBondContact O-N 3.03Å; L36-R38 PolarHBondContact O-N 3.37Å; L36-R38 PolarHBondContact O-NH1 3.17Å
37	N	97	Very high	97.9	Very high	165 Å²	165	104.7 Å²	104.7	88%	0.882	53%	0.534	S	S	*	.			trans	-73.5	102	169.5	-68.5	-49.8	0	0	0	110.2	E35	E35-N37 PolarHBondContact O-N 3.34Å
38	R	96.8	Very high	97.9	Very high	177 Å²	177	105.3 Å²	105.3	67%	0.668	54%	0.536	S	S	*	.	P	Polyproline II helix	trans	-81.6	137.3	179.5	-66.8	169.4	-176.8	71.8	0.9	110.4	S33 L36	S33-R38 PolarHBondContact O-NH2 3.26Å; L36-R38 PolarHBondContact O-N 3.37Å; L36-R38 PolarHBondContact O-NH1 3.17Å
39	I	96.9	Very high	97.9	Very high	111 Å²	111	109.4 Å²	109.4	57%	0.569	54%	0.541	S	S	*	.	P	Polyproline II helix	trans	-84.8	151.5	170.2	56.8	169	0	0	0	110.4	L41 T44	I39-L41 PolarHBondContact O-N 3.44Å; I39-T44 HydrophobicContact CD1-CG2 4.27Å; I39-T44 WeakPolarHBondContact CD1-OG1 3.29Å; I39-T44 VanDerWaalsContact CG1-OG1 3.29Å; I39-T44 WeakPolarHBondContact CG1-OG1 3.1Å
40	A	98.3	Very high	97.9	Very high	60 Å²	60	107.9 Å²	107.9	50%	0.496	53%	0.528	S	S	.	.	P	Polyproline II helix	trans	-62.6	134.4	176.4	0	0	0	0	0	110.7	S42 K43 T44	A40-S42 PolarHBondContact O-N 2.87Å; A40-K43 HydrophobicContact CB-CB 4.46Å; A40-K43 WeakPolarHBondContact O-CA 3.28Å; A40-K43 WeakPolarHBondContact O-CB 3.47Å; A40-K43 PolarHBondContact O-N 3.25Å; A40-T44 PolarHBondContact O-N 3.25Å; A40-T44 PolarHBondContact O-OG1 2.91Å
41	L	98.4	Very high	97.9	Very high	126 Å²	126	108 Å²	108	66%	0.66	53%	0.528	S	S	*	.	H	α-helix	trans	-55.8	-37.6	-178.5	179.6	61.3	0	0	0	112.4	I39 K43 T44 I45	I39-L41 PolarHBondContact O-N 3.44Å; L41-K43 VanDerWaalsContact C-N 3.3Å; L41-K43 PolarHBondContact O-N 3.04Å; L41-T44 WeakPolarHBondContact O-CB 3.46Å; L41-T44 PolarHBondContact O-N 3.46Å; L41-I45 HydrophobicContact CD1-CD1 4.08Å; L41-I45 HydrophobicContact CD1-CG1 4.16Å; L41-I45 HydrophobicContact CD2-CD1 4.43Å; L41-I45 HydrophobicContact CG-CD1 3.81Å; L41-I45 HydrophobicContact CG-CG1 4.34Å; L41-I45 WeakPolarHBondContact O-CB 3.35Å; L41-I45 VanDerWaalsContact O-CG1 3.28Å; L41-I45 WeakPolarHBondContact O-CG1 3.45Å; L41-I45 PolarHBondContact O-N 3.17Å
42	S	98.5	Very high	97.9	Very high	92 Å²	92	104.9 Å²	104.9	64%	0.643	52%	0.523	S	S	*	.	H	α-helix	trans	-59.1	-40.1	175	53.6	0	0	0	0	112.6	A40 W46	A40-S42 PolarHBondContact O-N 2.87Å; S42-W46 WeakPolarHBondContact O-CB 3.32Å; S42-W46 PolarHBondContact O-N 3.4Å
43	K	98.4	Very high	97.9	Very high	98 Å²	98	106 Å²	106	43%	0.426	53%	0.527	S	S	.	.	H	α-helix	trans	-68.6	-44.7	175.5	-177	59.9	167.7	77.3	0	111	A40 L41 I45 W46 D47	A40-K43 HydrophobicContact CB-CB 4.46Å; A40-K43 WeakPolarHBondContact O-CA 3.28Å; A40-K43 WeakPolarHBondContact O-CB 3.47Å; A40-K43 PolarHBondContact O-N 3.25Å; L41-K43 VanDerWaalsContact C-N 3.3Å; L41-K43 PolarHBondContact O-N 3.04Å; K43-I45 VanDerWaalsContact C-N 3.34Å; K43-I45 PolarHBondContact O-N 3.35Å; K43-W46 PolarHBondContact O-N 2.85Å; K43-D47 IonicContact NZ-OD1 2.6Å; K43-D47 PolarHBondContact NZ-OD1 3.47Å; K43-D47 IonicContact NZ-OD2 2.7Å; K43-D47 PolarHBondContact NZ-OD2 3.48Å; K43-D47 PolarHBondContact O-N 3.48Å
44	T	98.5	Very high	97.9	Very high	39 Å²	39	109 Å²	109	24%	0.239	54%	0.543	C	S	.	.	H	α-helix	trans	-56.6	-48.5	175.7	-48.3	0	0	0	0	111.6	I39 A40 L41 W46 D47 I48	I39-T44 HydrophobicContact CD1-CG2 4.27Å; I39-T44 WeakPolarHBondContact CD1-OG1 3.29Å; I39-T44 VanDerWaalsContact CG1-OG1 3.29Å; I39-T44 WeakPolarHBondContact CG1-OG1 3.1Å; A40-T44 PolarHBondContact O-N 3.25Å; A40-T44 PolarHBondContact O-OG1 2.91Å; L41-T44 WeakPolarHBondContact O-CB 3.46Å; L41-T44 PolarHBondContact O-N 3.46Å; T44-W46 VanDerWaalsContact C-N 3.34Å; T44-W46 PolarHBondContact O-N 3.4Å; T44-D47 PolarHBondContact O-N 3.49Å; T44-I48 HydrophobicContact CG2-CD1 3.95Å; T44-I48 WeakPolarHBondContact O-CG1 3.11Å; T44-I48 PolarHBondContact O-N 2.98Å
45	I	98.6	Very high	97.9	Very high	96 Å²	96	105.3 Å²	105.3	49%	0.492	52%	0.524	S	S	.	.	H	α-helix	trans	-61.3	-44.7	178.1	-70.3	167.9	0	0	0	110.4	L41 K43 D47 I48 R49	L41-I45 HydrophobicContact CD1-CD1 4.08Å; L41-I45 HydrophobicContact CD1-CG1 4.16Å; L41-I45 HydrophobicContact CD2-CD1 4.43Å; L41-I45 HydrophobicContact CG-CD1 3.81Å; L41-I45 HydrophobicContact CG-CG1 4.34Å; L41-I45 WeakPolarHBondContact O-CB 3.35Å; L41-I45 VanDerWaalsContact O-CG1 3.28Å; L41-I45 WeakPolarHBondContact O-CG1 3.45Å; L41-I45 PolarHBondContact O-N 3.17Å; K43-I45 VanDerWaalsContact C-N 3.34Å; K43-I45 PolarHBondContact O-N 3.35Å; I45-D47 VanDerWaalsContact C-N 3.35Å; I45-D47 PolarHBondContact O-N 2.97Å; I45-I48 PolarHBondContact O-N 3.26Å; I45-R49 WeakPolarHBondContact O-CB 3.36Å; I45-R49 PolarHBondContact O-N 2.7Å
46	W	98.5	Very high	97.9	Very high	142 Å²	142	100.3 Å²	100.3	54%	0.538	51%	0.505	S	S	.	.	H	α-helix	trans	-62	-42	178.7	-174.2	94.7	0	0	0	112	S42 K43 T44 R49 N50	S42-W46 WeakPolarHBondContact O-CB 3.32Å; S42-W46 PolarHBondContact O-N 3.4Å; K43-W46 PolarHBondContact O-N 2.85Å; T44-W46 VanDerWaalsContact C-N 3.34Å; T44-W46 PolarHBondContact O-N 3.4Å; W46-R49 PolarHBondContact O-N 3.21Å; W46-N50 WeakPolarHBondContact CH2-ND2 3.37Å; W46-N50 WeakPolarHBondContact CZ2-ND2 3.39Å; W46-N50 WeakPolarHBondContact CZ3-ND2 3.19Å; W46-N50 WeakPolarHBondContact O-CB 3.3Å; W46-N50 VanDerWaalsContact O-CG 3.24Å; W46-N50 PolarHBondContact O-N 3.13Å
47	D	98.4	Very high	97.9	Very high	60 Å²	60	103.6 Å²	103.6	32%	0.321	52%	0.518	S	S	.	.	H	α-helix	trans	-64.5	-48.8	177.8	-72.5	-27.4	0	0	0	111.8	K43 T44 I45 R49 N50 Y51	K43-D47 IonicContact NZ-OD1 2.6Å; K43-D47 PolarHBondContact NZ-OD1 3.47Å; K43-D47 IonicContact NZ-OD2 2.7Å; K43-D47 PolarHBondContact NZ-OD2 3.48Å; K43-D47 PolarHBondContact O-N 3.48Å; T44-D47 PolarHBondContact O-N 3.49Å; I45-D47 VanDerWaalsContact C-N 3.35Å; I45-D47 PolarHBondContact O-N 2.97Å; D47-R49 PolarHBondContact O-N 3.02Å; D47-N50 PolarHBondContact O-N 3.37Å; D47-Y51 WeakPolarHBondContact O-CB 3.26Å; D47-Y51 PolarHBondContact O-N 3.42Å
48	I	98.5	Very high	97.8	Very high	102 Å²	102	101.7 Å²	101.7	52%	0.523	51%	0.508	S	S	.	.	H	α-helix	trans	-59.2	-49.7	176.4	-68.2	168.6	0	0	0	110.1	T44 I45 N50 Y51 C52	T44-I48 HydrophobicContact CG2-CD1 3.95Å; T44-I48 WeakPolarHBondContact O-CG1 3.11Å; T44-I48 PolarHBondContact O-N 2.98Å; I45-I48 PolarHBondContact O-N 3.26Å; I48-N50 PolarHBondContact O-N 3.32Å; I48-Y51 PolarHBondContact O-N 2.89Å; I48-C52 PolarHBondContact O-N 3.47Å; I48-C52 PolarHBondContact O-SG 2.7Å; I48-C52 VanDerWaalsContact O-SG 3.35Å
49	R	98.2	Very high	97.7	Very high	138 Å²	138	96.1 Å²	96.1	52%	0.521	49%	0.492	S	S	.	.	H	α-helix	trans	-53.5	-53.8	178.7	177.4	176.4	179.4	-99.3	2.3	110.6	I45 W46 D47 Y51 C52 F53	I45-R49 WeakPolarHBondContact O-CB 3.36Å; I45-R49 PolarHBondContact O-N 2.7Å; W46-R49 PolarHBondContact O-N 3.21Å; D47-R49 PolarHBondContact O-N 3.02Å; R49-Y51 VanDerWaalsContact C-N 3.33Å; R49-Y51 PolarHBondContact O-N 3.25Å; R49-C52 PolarHBondContact O-N 3.44Å; R49-F53 HydrophobicContact CG-CD2 3.56Å; R49-F53 HydrophobicContact CG-CE2 3.58Å; R49-F53 WeakPolarHBondContact O-CD2 3.15Å; R49-F53 PolarHBondContact O-N 2.91Å
50	N	98.3	Very high	97.6	Very high	42 Å²	42	94.6 Å²	94.6	23%	0.225	49%	0.489	C	S	.	.	H	α-helix	trans	-64.7	-38.7	-177.1	-74.7	-6.8	0	0	0	112.4	W46 D47 I48 C52 F53 T54	W46-N50 WeakPolarHBondContact CH2-ND2 3.37Å; W46-N50 WeakPolarHBondContact CZ2-ND2 3.39Å; W46-N50 WeakPolarHBondContact CZ3-ND2 3.19Å; W46-N50 WeakPolarHBondContact O-CB 3.3Å; W46-N50 VanDerWaalsContact O-CG 3.24Å; W46-N50 PolarHBondContact O-N 3.13Å; D47-N50 PolarHBondContact O-N 3.37Å; I48-N50 PolarHBondContact O-N 3.32Å; N50-C52 VanDerWaalsContact C-N 3.35Å; N50-F53 PolarHBondContact O-N 2.91Å; N50-T54 VanDerWaalsContact O-CB 3.26Å; N50-T54 WeakPolarHBondContact O-CB 3.45Å; N50-T54 PolarHBondContact O-N 2.87Å; N50-T54 PolarHBondContact O-OG1 3.23Å
51	Y	98.6	Very high	97.5	Very high	162 Å²	162	99.3 Å²	99.3	64%	0.635	51%	0.505	S	S	*	.	H	α-helix	trans	-58.9	-48.3	174.5	-179	-94.3	0	0	0	110.9	D47 I48 R49 N55	D47-Y51 WeakPolarHBondContact O-CB 3.26Å; D47-Y51 PolarHBondContact O-N 3.42Å; I48-Y51 PolarHBondContact O-N 2.89Å; R49-Y51 VanDerWaalsContact C-N 3.33Å; R49-Y51 PolarHBondContact O-N 3.25Å; Y51-N55 PolarHBondContact O-N 2.79Å; Y51-N55 PolarHBondContact O-ND2 3.19Å
52	C	98.2	Very high	97.3	Very high	70 Å²	70	98.9 Å²	98.9	47%	0.473	50%	0.502	S	S	.	.	H	α-helix	trans	-60.9	-50.3	177.4	-67.2	0	0	0	0	112	I48 R49 N50 T54 N55 A56	I48-C52 PolarHBondContact O-N 3.47Å; I48-C52 PolarHBondContact O-SG 2.7Å; I48-C52 VanDerWaalsContact O-SG 3.35Å; R49-C52 PolarHBondContact O-N 3.44Å; N50-C52 VanDerWaalsContact C-N 3.35Å; C52-T54 PolarHBondContact O-N 2.96Å; C52-N55 PolarHBondContact O-N 3.44Å; C52-A56 WeakPolarHBondContact O-CB 3.35Å; C52-A56 PolarHBondContact O-N 2.93Å
53	F	97.1	Very high	97.1	Very high	140 Å²	140	97.4 Å²	97.4	61%	0.614	49%	0.492	S	S	*	.	H	α-helix	trans	-65.8	-35.8	-177.9	-80.3	-71.8	0	0	0	113.3	R49 N50 N55	R49-F53 HydrophobicContact CG-CD2 3.56Å; R49-F53 HydrophobicContact CG-CE2 3.58Å; R49-F53 WeakPolarHBondContact O-CD2 3.15Å; R49-F53 PolarHBondContact O-N 2.91Å; N50-F53 PolarHBondContact O-N 2.91Å; F53-N55 VanDerWaalsContact C-N 3.3Å; F53-N55 PolarHBondContact O-N 3.38Å
54	T	98	Very high	96.7	Very high	106 Å²	106	97.4 Å²	97.4	65%	0.65	50%	0.502	S	S	*	.	H	α-helix	trans	-65.1	-36	176.5	-56.5	0	0	0	0	111.5	N50 C52	N50-T54 VanDerWaalsContact O-CB 3.26Å; N50-T54 WeakPolarHBondContact O-CB 3.45Å; N50-T54 PolarHBondContact O-N 2.87Å; N50-T54 PolarHBondContact O-OG1 3.23Å; C52-T54 PolarHBondContact O-N 2.96Å
55	N	97.9	Very high	96.4	Very high	60 Å²	60	98.6 Å²	98.6	32%	0.321	51%	0.51	S	S	.	.	H	α-helix	trans	-99.5	-9.1	-174.2	-66.7	-76.5	0	0	0	114.2	Y51 C52 F53 Q57 N58 D59	Y51-N55 PolarHBondContact O-N 2.79Å; Y51-N55 PolarHBondContact O-ND2 3.19Å; C52-N55 PolarHBondContact O-N 3.44Å; F53-N55 VanDerWaalsContact C-N 3.3Å; F53-N55 PolarHBondContact O-N 3.38Å; N55-Q57 PolarHBondContact O-N 2.6Å; N55-Q57 VanDerWaalsContact O-N 3.1Å; N55-N58 PolarHBondContact O-N 3.47Å; N55-D59 PolarHBondContact O-N 2.82Å
56	A	96.9	Very high	95.8	Very high	28 Å²	28	104.6 Å²	104.6	23%	0.231	53%	0.526	C	S	.	.	G	3₁₀ helix	trans	-55.1	-33.9	-174.2	0	0	0	0	0	114	C52 N58 D59 L62 C63	C52-A56 WeakPolarHBondContact O-CB 3.35Å; C52-A56 PolarHBondContact O-N 2.93Å; A56-N58 VanDerWaalsContact C-N 3.26Å; A56-N58 PolarHBondContact O-N 3.15Å; A56-D59 PolarHBondContact O-N 2.75Å; A56-L62 HydrophobicContact CB-CD1 4.23Å; A56-C63 PolarHBondContact O-SG 3.1Å
57	Q	95	Very high	95.2	Very high	161 Å²	161	105 Å²	105	75%	0.752	54%	0.539	S	S	*	.	G	3₁₀ helix	trans	-70.6	-22.8	178.6	-65.9	-174.8	-3	0	0	113.5	N55 C63	N55-Q57 PolarHBondContact O-N 2.6Å; N55-Q57 VanDerWaalsContact O-N 3.1Å; Q57-C63 WeakPolarHBondContact O-CB 3.22Å
58	N	94.8	Very high	94.7	Very high	126 Å²	126	105.1 Å²	105.1	67%	0.674	54%	0.54	S	S	*	.	G	3₁₀ helix	trans	-95	-7.6	-179.1	-62.6	-36.1	0	0	0	112.6	N55 A56 P60	N55-N58 PolarHBondContact O-N 3.47Å; A56-N58 VanDerWaalsContact C-N 3.26Å; A56-N58 PolarHBondContact O-N 3.15Å; N58-P60 WeakPolarHBondContact O-CD 2.92Å
59	D	96.4	Very high	94.3	Very high	60 Å²	60	105.5 Å²	105.5	32%	0.321	55%	0.549	S	S	.	.			trans	-77.8	111.8	176.9	-176.6	-25.7	0	0	0	109.2	N55 A56 L61 L62 C63	N55-D59 PolarHBondContact O-N 2.82Å; A56-D59 PolarHBondContact O-N 2.75Å; D59-L61 PolarHBondContact O-N 3.36Å; D59-L61 VanDerWaalsContact O-N 3.15Å; D59-L61 WeakPolarHBondContact OD1-CA 3Å; D59-L61 VanDerWaalsContact OD1-CB 3.3Å; D59-L61 WeakPolarHBondContact OD1-CB 3.41Å; D59-L61 PolarHBondContact OD1-N 3.44Å; D59-L62 HydrophobicContact CB-CB 4.03Å; D59-L62 HydrophobicContact CB-CD1 3.98Å; D59-L62 HydrophobicContact CB-CG 4.04Å; D59-L62 PolarHBondContact O-N 2.91Å; D59-L62 VanDerWaalsContact O-N 3.13Å; D59-L62 PolarHBondContact OD1-N 3.42Å; D59-C63 WeakPolarHBondContact O-CA 3.36Å; D59-C63 PolarHBondContact O-N 3.46Å
60	P	94.7	Very high	93.8	Very high	78 Å²	78	108.8 Å²	108.8	51%	0.506	56%	0.563	S	S	.	*	T	Hydrogen-bonded Turn	trans	-65.8	-16.1	-178.4	-21.4	36	0	0	0	113.9	N58 P64 P65	N58-P60 WeakPolarHBondContact O-CD 2.92Å; P60-P64 VanDerWaalsContact O-CA 3.22Å; P60-P64 WeakPolarHBondContact O-CA 3.2Å; P60-P65 HydrophobicContact CB-CG 4.41Å
61	L	94.5	Very high	93.1	Very high	160 Å²	160	112.5 Å²	112.5	84%	0.838	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.9	-30.2	176.2	-57.8	179.1	0	0	0	111.5	D59	D59-L61 PolarHBondContact O-N 3.36Å; D59-L61 VanDerWaalsContact O-N 3.15Å; D59-L61 WeakPolarHBondContact OD1-CA 3Å; D59-L61 VanDerWaalsContact OD1-CB 3.3Å; D59-L61 WeakPolarHBondContact OD1-CB 3.41Å; D59-L61 PolarHBondContact OD1-N 3.44Å
62	L	95.5	Very high	92.3	Very high	116 Å²	116	110 Å²	110	61%	0.607	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.6	-39	173	-61.5	177.8	0	0	0	112.3	A56 D59	A56-L62 HydrophobicContact CB-CD1 4.23Å; D59-L62 HydrophobicContact CB-CB 4.03Å; D59-L62 HydrophobicContact CB-CD1 3.98Å; D59-L62 HydrophobicContact CB-CG 4.04Å; D59-L62 PolarHBondContact O-N 2.91Å; D59-L62 VanDerWaalsContact O-N 3.13Å; D59-L62 PolarHBondContact OD1-N 3.42Å
63	C	93.7	Very high	91.3	Very high	62 Å²	62	116 Å²	116	42%	0.419	60%	0.604	S	S	.	*	S	Bend	trans	-124.3	79.3	-179.2	-67.9	0	0	0	0	110.6	A56 Q57 D59	A56-C63 PolarHBondContact O-SG 3.1Å; Q57-C63 WeakPolarHBondContact O-CB 3.22Å; D59-C63 WeakPolarHBondContact O-CA 3.36Å; D59-C63 PolarHBondContact O-N 3.46Å
64	P	91	Very high	90.2	Very high	98 Å²	98	120.7 Å²	120.7	64%	0.636	62%	0.618	S	S	*	*			trans	-59.6	126.1	-174.6	-26.4	35.8	0	0	0	113.7	P60	P60-P64 VanDerWaalsContact O-CA 3.22Å; P60-P64 WeakPolarHBondContact O-CA 3.2Å
65	P	90.6	Very high	89.3	Confident	63 Å²	63	121 Å²	121	41%	0.409	62%	0.624	S	S	.	*			trans	-69.8	151.5	178.5	28.2	-34.4	0	0	0	111.2	P60 D67	P60-P65 HydrophobicContact CB-CG 4.41Å; P65-D67 VanDerWaalsContact C-N 3.26Å; P65-D67 PolarHBondContact O-N 3.47Å
66	R	86.1	Confident	88.3	Confident	223 Å²	223	123.7 Å²	123.7	84%	0.842	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.2	-34.8	172	-71.6	-172.5	177.4	-170.4	0.5	111.5	N68 K71	R66-N68 VanDerWaalsContact C-N 3.3Å; R66-N68 PolarHBondContact O-N 3.36Å; R66-K71 WeakPolarHBondContact O-CE 3.3Å; R66-K71 PolarHBondContact O-NZ 2.91Å
67	D	86.9	Confident	87.5	Confident	151 Å²	151	127.9 Å²	127.9	81%	0.807	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.8	50	-177	-55.2	-39	0	0	0	111.4	P65 P69	P65-D67 VanDerWaalsContact C-N 3.26Å; P65-D67 PolarHBondContact O-N 3.47Å; D67-P69 VanDerWaalsContact O-CD 3.3Å; D67-P69 WeakPolarHBondContact O-CD 3.48Å
68	N	87.8	Confident	86.5	Confident	61 Å²	61	126.6 Å²	126.6	33%	0.326	67%	0.672	S	S	.	*			trans	-66	117	174.3	176.2	-8.2	0	0	0	109.3	R66 Y70 K71	R66-N68 VanDerWaalsContact C-N 3.3Å; R66-N68 PolarHBondContact O-N 3.36Å; N68-Y70 PolarHBondContact O-N 3.24Å; N68-Y70 WeakPolarHBondContact OD1-CB 3.5Å; N68-Y70 WeakPolarHBondContact OD1-CD2 3.33Å; N68-Y70 PolarHBondContact OD1-N 3.26Å; N68-K71 HydrophobicContact CB-CD 4.23Å; N68-K71 HydrophobicContact CB-CG 3.99Å; N68-K71 WeakPolarHBondContact O-CB 3.39Å; N68-K71 WeakPolarHBondContact O-CG 3.4Å; N68-K71 PolarHBondContact O-N 3.18Å; N68-K71 VanDerWaalsContact O-N 3.11Å
69	P	89.1	Confident	85.3	Confident	111 Å²	111	131.3 Å²	131.3	72%	0.721	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.6	-16.7	-175.6	28.9	-36.2	0	0	0	113.2	D67 K71	D67-P69 VanDerWaalsContact O-CD 3.3Å; D67-P69 WeakPolarHBondContact O-CD 3.48Å; P69-K71 VanDerWaalsContact C-N 3.33Å
70	Y	89.1	Confident	84.8	Confident	207 Å²	207	134.9 Å²	134.9	81%	0.812	71%	0.714	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.4	5.1	177.4	-53.7	-73	0	0	0	113.3	N68 S72	N68-Y70 PolarHBondContact O-N 3.24Å; N68-Y70 WeakPolarHBondContact OD1-CB 3.5Å; N68-Y70 WeakPolarHBondContact OD1-CD2 3.33Å; N68-Y70 PolarHBondContact OD1-N 3.26Å; Y70-S72 PolarHBondContact O-N 3.11Å
71	K	82.6	Confident	84.3	Confident	119 Å²	119	137.9 Å²	137.9	52%	0.517	73%	0.725	S	S	.	*	S	Bend	trans	-62.8	135.6	173.8	-78.8	177.1	175.4	-170.2	0	110.3	R66 N68 P69 Q73	R66-K71 WeakPolarHBondContact O-CE 3.3Å; R66-K71 PolarHBondContact O-NZ 2.91Å; N68-K71 HydrophobicContact CB-CD 4.23Å; N68-K71 HydrophobicContact CB-CG 3.99Å; N68-K71 WeakPolarHBondContact O-CB 3.39Å; N68-K71 WeakPolarHBondContact O-CG 3.4Å; N68-K71 PolarHBondContact O-N 3.18Å; N68-K71 VanDerWaalsContact O-N 3.11Å; P69-K71 VanDerWaalsContact C-N 3.33Å; K71-Q73 PolarHBondContact O-N 3.25Å
72	S	82.2	Confident	83.7	Confident	109 Å²	109	136.7 Å²	136.7	76%	0.762	72%	0.718	S	S	*	*	P	Polyproline II helix	trans	-56	124.7	170	56.4	0	0	0	0	109.8	Y70 R74	Y70-S72 PolarHBondContact O-N 3.11Å; S72-R74 PolarHBondContact O-N 2.65Å
73	Q	78	Confident	83	Confident	196 Å²	196	137.9 Å²	137.9	92%	0.916	73%	0.725	S	S	*	*	P	Polyproline II helix	trans	-61.7	124.1	174.1	-64.7	-172.2	1.7	0	0	108.9	K71 S75	K71-Q73 PolarHBondContact O-N 3.25Å; Q73-S75 PolarHBondContact O-N 3.45Å
74	R	74.5	Confident	82.3	Confident	240 Å²	240	142.6 Å²	142.6	91%	0.906	74%	0.744	S	S	*	*	P	Polyproline II helix	trans	-73.2	119.6	173	-68.3	-173.1	178.7	-169.2	-0.8	108	S72 C76	S72-R74 PolarHBondContact O-N 2.65Å; R74-C76 PolarHBondContact O-N 3.34Å
75	S	78.7	Confident	81.7	Confident	112 Å²	112	145.6 Å²	145.6	78%	0.783	75%	0.751	S	S	*	*	P	Polyproline II helix	trans	-66.3	121.4	165.3	55.9	0	0	0	0	108.6	Q73	Q73-S75 PolarHBondContact O-N 3.45Å
76	C	76.8	Confident	81.1	Confident	116 Å²	116	151.5 Å²	151.5	78%	0.784	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-100.8	121.3	166.8	-173.8	0	0	0	0	107.6	R74	R74-C76 PolarHBondContact O-N 3.34Å
77	T	78.9	Confident	80.7	Confident	116 Å²	116	146 Å²	146	71%	0.712	77%	0.771	S	S	*	*			trans	-107.9	118.9	168.7	-53.5	0	0	0	0	107.1
78	V	75	Confident	80.2	Confident	134 Å²	134	145.6 Å²	145.6	81%	0.812	77%	0.767	S	S	*	*			trans	-81.4	116.4	169.1	-176.1	0	0	0	0	106.3
79	I	70.1	Confident	79.5	Confident	226 Å²	226	153.3 Å²	153.3	100%	1.159	81%	0.808	S	S	*	*			trans	-86.8	0	170	-58.4	175.8	0	0	0	108.2

Retrieved 79 of 79 residues in 16 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).