G4VPM7_SCHMA Loading...

40S ribosomal protein S26

AlphaFold DB , UniProt , Accession G4VPM7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 114 aa.

						>G4VPM7_SCHMA|G4VPM7
MTRKRRNHGRSKKGRGHVGFIRCTNCGRACPKDKSVWKLVTRSMVEAAAVKDLEDASVYGKNYAVPKLYVKLQYCISCAIHSKVLRNRSRESRRLRRIIVKPRVKFSRPVAPRA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	69.6	Low	86.8	Confident	247 Å²	247	121.9 Å²	121.9	100%	1.217	58%	0.584	S	S	*	*				0	121.2	0	-156.7	-179	-123	0	0	109.9
2	T	87.3	Confident	86.8	Confident	150 Å²	150	118.3 Å²	118.3	92%	0.92	56%	0.564	S	S	*	*			trans	-82.1	137.5	-174.5	54.4	0	0	0	0	111.7
3	R	88.5	Confident	86.9	Confident	123 Å²	123	119.2 Å²	119.2	46%	0.464	56%	0.564	S	S	.	*			trans	-121.2	107.3	-175	-166.8	-178.9	-172.7	-174.8	8	111.7	R5 R6 H8	R3-R5 VanDerWaalsContact C-N 3.28Å; R3-R5 WeakPolarHBondContact CD-O 3.41Å; R3-R5 VanDerWaalsContact CG-O 3.26Å; R3-R5 WeakPolarHBondContact CG-O 3.22Å; R3-R5 PolarHBondContact NE-O 3.27Å; R3-R5 PolarHBondContact O-N 3.03Å; R3-R6 PolarHBondContact NH1-O 3.4Å; R3-R6 VanDerWaalsContact NH2-C 3.3Å; R3-R6 PolarHBondContact NH2-O 3.47Å; R3-H8 PolarHBondContact NE-CE1 3.04Å; R3-H8 PolarHBondContact NE-ND1 3.21Å; R3-H8 PolarHBondContact NE-NE2 3.15Å; R3-H8 PolarHBondContact NH2-CD2 3.18Å; R3-H8 PolarHBondContact NH2-NE2 3.06Å
4	K	89.4	Confident	87	Confident	141 Å²	141	117.3 Å²	117.3	61%	0.613	59%	0.592	S	S	*	*	S	Bend	trans	-58.9	-34.6	177.5	-174	175.8	-178.8	171.6	0	113.8	R93	K4-R93 VanDerWaalsContact CE-NH1 3.28Å
5	R	89.2	Confident	86.9	Confident	104 Å²	104	121.6 Å²	121.6	39%	0.392	60%	0.598	S	S	.	*	S	Bend	trans	-139.3	128.1	-179	-69.3	-179	163.7	118.7	-3.3	110.3	R3 N7 H8	R3-R5 VanDerWaalsContact C-N 3.28Å; R3-R5 WeakPolarHBondContact CD-O 3.41Å; R3-R5 VanDerWaalsContact CG-O 3.26Å; R3-R5 WeakPolarHBondContact CG-O 3.22Å; R3-R5 PolarHBondContact NE-O 3.27Å; R3-R5 PolarHBondContact O-N 3.03Å; R5-N7 PolarHBondContact O-N 3.49Å; R5-H8 PolarHBondContact O-N 3.1Å
6	R	87.9	Confident	87	Confident	218 Å²	218	117.9 Å²	117.9	82%	0.823	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.8	-10.8	175.6	-173.2	178.4	176.2	-156	0	114.7	R3	R3-R6 PolarHBondContact NH1-O 3.4Å; R3-R6 VanDerWaalsContact NH2-C 3.3Å; R3-R6 PolarHBondContact NH2-O 3.47Å
7	N	84.9	Confident	87.2	Confident	31 Å²	31	118.5 Å²	118.5	17%	0.166	60%	0.601	C	S	.	*	T	Hydrogen-bonded Turn	trans	-114.3	10.3	175	-77.5	4.5	0	0	0	113.4	R5 G9 R10 K13 R96	R5-N7 PolarHBondContact O-N 3.49Å; N7-G9 PolarHBondContact O-N 3.22Å; N7-R10 PolarHBondContact O-N 3.01Å; N7-K13 WeakPolarHBondContact OD1-CE 3.32Å; N7-K13 PolarHBondContact OD1-NZ 3.16Å; N7-R96 PolarHBondContact ND2-NH2 3.36Å; N7-R96 VanDerWaalsContact ND2-NH2 3.11Å
8	H	89.2	Confident	87.4	Confident	136 Å²	136	113.2 Å²	113.2	63%	0.63	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	51.5	16.1	-169.2	-56.1	-71	0	0	0	115	R3 R5	R3-H8 PolarHBondContact NE-CE1 3.04Å; R3-H8 PolarHBondContact NE-ND1 3.21Å; R3-H8 PolarHBondContact NE-NE2 3.15Å; R3-H8 PolarHBondContact NH2-CD2 3.18Å; R3-H8 PolarHBondContact NH2-NE2 3.06Å; R5-H8 PolarHBondContact O-N 3.1Å
9	G	88.7	Confident	87.7	Confident	32 Å²	32	109.7 Å²	109.7	33%	0.33	57%	0.571	S	S	.	*	T	Hydrogen-bonded Turn	trans	76.1	22.3	-174.5	0	0	0	0	0	114.6	N7	N7-G9 PolarHBondContact O-N 3.22Å
10	R	91.2	Very high	87.9	Confident	74 Å²	74	110.3 Å²	110.3	28%	0.279	57%	0.569	S	S	.	*	S	Bend	trans	-126.7	148.8	176.6	-88.2	175.8	179.9	-122.4	24.7	111.8	N7 K12 D33 K34	N7-R10 PolarHBondContact O-N 3.01Å; R10-K12 VanDerWaalsContact C-N 3.27Å; R10-K12 HydrophobicContact CB-CB 4.34Å; R10-K12 PolarHBondContact O-N 3.03Å; R10-D33 VanDerWaalsContact CB-OD2 3.32Å; R10-D33 WeakPolarHBondContact CB-OD2 3.31Å; R10-D33 WeakPolarHBondContact CD-OD2 3.21Å; R10-D33 WeakPolarHBondContact CG-OD2 3.36Å; R10-D33 IonicContact CZ-OD2 3.85Å; R10-D33 IonicContact NE-OD2 3.82Å; R10-D33 IonicContact NH1-OD1 3.02Å; R10-D33 PolarHBondContact NH1-OD1 2.8Å; R10-D33 IonicContact NH1-OD2 3.05Å; R10-D33 PolarHBondContact NH1-OD2 3.39Å; R10-K34 HydrophobicContact CG-CB 3.71Å; R10-K34 HydrophobicContact CG-CD 4.15Å; R10-K34 HydrophobicContact CG-CG 4Å
11	S	89.2	Confident	88.2	Confident	85 Å²	85	107.3 Å²	107.3	59%	0.594	55%	0.553	S	S	*	*			trans	-92.6	50.8	170.8	-157.3	0	0	0	0	112.1	D33	S11-D33 PolarHBondContact N-O 3.01Å
12	K	87	Confident	89.4	Confident	79 Å²	79	104.6 Å²	104.6	34%	0.343	53%	0.529	S	S	.	.			trans	-106.8	102.9	-178.9	-163.1	177.6	177.7	-171.6	0	109.3	R10 R15 G16 V18 D33	R10-K12 VanDerWaalsContact C-N 3.27Å; R10-K12 HydrophobicContact CB-CB 4.34Å; R10-K12 PolarHBondContact O-N 3.03Å; K12-R15 HydrophobicContact CG-CB 4.33Å; K12-G16 WeakPolarHBondContact CE-O 3.22Å; K12-G16 PolarHBondContact NZ-O 3.02Å; K12-V18 HydrophobicContact CD-CG2 4.47Å; K12-V18 HydrophobicContact CG-CG2 4.28Å; K12-D33 WeakPolarHBondContact CB-OD2 3.45Å
13	K	87.7	Confident	89.8	Confident	130 Å²	130	97.7 Å²	97.7	57%	0.565	49%	0.487	S	S	*	.	S	Bend	trans	-121.9	113.4	175	-61.3	-65.1	179.1	179.7	0	107.3	N7 R15	N7-K13 WeakPolarHBondContact OD1-CE 3.32Å; N7-K13 PolarHBondContact OD1-NZ 3.16Å; K13-R15 WeakPolarHBondContact O-CG 3.13Å; K13-R15 PolarHBondContact O-N 3.33Å; K13-R15 VanDerWaalsContact O-N 3.08Å
14	G	88.5	Confident	90.1	Very high	92 Å²	92	95.2 Å²	95.2	95%	0.948	49%	0.486	S	S	*	.	S	Bend	trans	67.8	-0.2	179.2	0	0	0	0	0	117.4
15	R	85.5	Confident	90.3	Very high	182 Å²	182	93.4 Å²	93.4	69%	0.687	48%	0.483	S	S	*	.			trans	-85.8	-10.9	-169.4	-57.2	-163.1	-159.4	-112.8	1.1	116.8	K12 K13 H17 V18	K12-R15 HydrophobicContact CG-CB 4.33Å; K13-R15 WeakPolarHBondContact O-CG 3.13Å; K13-R15 PolarHBondContact O-N 3.33Å; K13-R15 VanDerWaalsContact O-N 3.08Å; R15-H17 PolarHBondContact O-N 3.25Å; R15-H17 VanDerWaalsContact O-O 3.07Å; R15-V18 HydrophobicContact CB-CG2 4.22Å
16	G	88.8	Confident	90.6	Very high	63 Å²	63	91.8 Å²	91.8	65%	0.649	49%	0.487	S	S	*	.	S	Bend	trans	67.3	-64.4	178.4	0	0	0	0	0	115.6	K12	K12-G16 WeakPolarHBondContact CE-O 3.22Å; K12-G16 PolarHBondContact NZ-O 3.02Å
17	H	89.2	Confident	90.8	Very high	127 Å²	127	83.2 Å²	83.2	59%	0.588	47%	0.467	S	S	*	.			trans	-134.9	154.1	173.2	-179.5	-100.1	0	0	0	109.9	R15 F20	R15-H17 PolarHBondContact O-N 3.25Å; R15-H17 VanDerWaalsContact O-O 3.07Å; H17-F20 AromaticContact CE1-CE2 3.83Å; H17-F20 AromaticContact NE2-CD2 3.93Å; H17-F20 AromaticContact NE2-CE2 3.15Å; H17-F20 WeakPolarHBondContact NE2-CE2 3.38Å; H17-F20 AromaticContact NE2-CZ 3.75Å
18	V	91.5	Very high	91.2	Very high	23 Å²	23	89.4 Å²	89.4	14%	0.139	49%	0.488	C	S	.	.			trans	-136.3	134.4	177.9	-178.1	0	0	0	0	107.5	K12 R15 K32 D33	K12-V18 HydrophobicContact CD-CG2 4.47Å; K12-V18 HydrophobicContact CG-CG2 4.28Å; R15-V18 HydrophobicContact CB-CG2 4.22Å; V18-K32 HydrophobicContact CG1-CB 3.87Å; V18-D33 HydrophobicContact CG1-CB 4.43Å; V18-D33 HydrophobicContact CG2-CB 4.35Å
19	G	92.1	Very high	91.5	Very high	48 Å²	48	85.4 Å²	85.4	50%	0.495	48%	0.478	S	S	.	.			trans	-50.7	140.4	178.1	0	0	0	0	0	113.2	K32	G19-K32 PolarHBondContact O-N 2.74Å; G19-K32 VanDerWaalsContact O-N 3.13Å
20	F	93.5	Very high	91.6	Very high	120 Å²	120	84.5 Å²	84.5	53%	0.526	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.6	145.1	178.1	-64.2	-83.1	0	0	0	111.3	H17 P31	H17-F20 AromaticContact CE1-CE2 3.83Å; H17-F20 AromaticContact NE2-CD2 3.93Å; H17-F20 AromaticContact NE2-CE2 3.15Å; H17-F20 WeakPolarHBondContact NE2-CE2 3.38Å; H17-F20 AromaticContact NE2-CZ 3.75Å; F20-P31 HydrophobicContact CD1-CB 3.74Å; F20-P31 HydrophobicContact CD1-CG 4.18Å; F20-P31 HydrophobicContact CE1-CB 3.74Å; F20-P31 HydrophobicContact CE1-CG 3.94Å
21	I	93.5	Very high	91.8	Very high	49 Å²	49	81.4 Å²	81.4	25%	0.251	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	144.4	173.6	-61.2	177.9	0	0	0	107.1	C30 K32 Q73	I21-C30 PolarHBondContact N-O 3.13Å; I21-C30 PolarHBondContact O-N 3.09Å; I21-K32 HydrophobicContact CD1-CB 3.62Å; I21-K32 HydrophobicContact CD1-CD 3.95Å; I21-K32 HydrophobicContact CD1-CG 3.54Å; I21-K32 HydrophobicContact CG1-CB 4.12Å; I21-Q73 HydrophobicContact CG2-CB 3.88Å; I21-Q73 HydrophobicContact CG2-CG 3.97Å
22	R	95.4	Very high	92	Very high	189 Å²	189	83.6 Å²	83.6	71%	0.713	46%	0.455	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.1	134.6	174.7	-64.1	-77.8	173.7	99.4	-4.2	109.7	G27	R22-G27 WeakPolarHBondContact CD-O 2.93Å
23	C	95.3	Very high	92.2	Very high	5 Å²	5	81 Å²	81	3%	0.034	45%	0.445	C	S	.	.			trans	-62.5	135.6	172.2	-178.1	0	0	0	0	110	N25 G27 R28 Q73 C75	C23-N25 VanDerWaalsContact C-N 3.25Å; C23-N25 PolarHBondContact O-N 3.36Å; C23-G27 VanDerWaalsContact O-CA 3.31Å; C23-G27 WeakPolarHBondContact O-CA 3.39Å; C23-G27 PolarHBondContact O-N 2.66Å; C23-R28 PolarHBondContact N-O 3.3Å; C23-Q73 WeakPolarHBondContact CA-O 3.34Å; C23-C75 HydrophobicContact CB-CB 4.1Å; C23-C75 PolarHBondContact SG-N 3.4Å
24	T	94	Very high	92.5	Very high	72 Å²	72	79 Å²	79	44%	0.442	44%	0.436	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.7	-28.2	-179.8	53.1	0	0	0	0	113.8	L72 Q73	T24-L72 HydrophobicContact CG2-CD2 4.07Å; T24-Q73 PolarHBondContact N-O 2.96Å; T24-Q73 PolarHBondContact OG1-O 2.95Å
25	N	93.7	Very high	92.7	Very high	103 Å²	103	75.3 Å²	75.3	55%	0.551	40%	0.396	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.2	-43.4	-174.6	-69.2	23.5	0	0	0	113	C23 Y74	C23-N25 VanDerWaalsContact C-N 3.25Å; C23-N25 PolarHBondContact O-N 3.36Å; N25-Y74 WeakPolarHBondContact OD1-CE1 3.35Å
26	C	94.8	Very high	93.1	Very high	69 Å²	69	68 Å²	68	47%	0.466	37%	0.371	S	S	.	.	T	Hydrogen-bonded Turn	trans	-115.3	1.1	-172	63.1	0	0	0	0	113.9	R28 C78	C26-R28 PolarHBondContact O-N 3.29Å; C26-C78 PolarHBondContact SG-SG 3.48Å
27	G	93	Very high	93.2	Very high	39 Å²	39	72.4 Å²	72.4	40%	0.402	37%	0.368	S	S	.	.			trans	65.8	-1.6	-178.1	0	0	0	0	0	115.2	R22 C23 A29	R22-G27 WeakPolarHBondContact CD-O 2.93Å; C23-G27 VanDerWaalsContact O-CA 3.31Å; C23-G27 WeakPolarHBondContact O-CA 3.39Å; C23-G27 PolarHBondContact O-N 2.66Å; G27-A29 PolarHBondContact O-N 3.4Å
28	R	94	Very high	93.3	Very high	160 Å²	160	71.1 Å²	71.1	60%	0.604	36%	0.361	S	S	*	.			trans	-59.4	130.6	-178.3	-174.6	174.9	-176.7	152.7	5.5	111.5	C23 C26 C30	C23-R28 PolarHBondContact N-O 3.3Å; C26-R28 PolarHBondContact O-N 3.29Å; R28-C30 PolarHBondContact O-N 3.48Å
29	A	94.4	Very high	93.3	Very high	52 Å²	52	74.3 Å²	74.3	43%	0.43	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.3	117.1	171.5	0	0	0	0	0	110.3	G27	G27-A29 PolarHBondContact O-N 3.4Å
30	C	92.1	Very high	93.3	Very high	13 Å²	13	73 Å²	73	9%	0.088	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.2	131.4	178.6	-68.7	0	0	0	0	109.1	I21 R28 C75	I21-C30 PolarHBondContact N-O 3.13Å; I21-C30 PolarHBondContact O-N 3.09Å; R28-C30 PolarHBondContact O-N 3.48Å; C30-C75 WeakPolarHBondContact SG-CB 3.37Å
31	P	94.1	Very high	93.3	Very high	9 Å²	9	70.7 Å²	70.7	6%	0.058	36%	0.355	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.2	141.4	-179.9	25.3	-23.5	0	0	0	109.9	F20 D33 K34 S35	F20-P31 HydrophobicContact CD1-CB 3.74Å; F20-P31 HydrophobicContact CD1-CG 4.18Å; F20-P31 HydrophobicContact CE1-CB 3.74Å; F20-P31 HydrophobicContact CE1-CG 3.94Å; P31-D33 VanDerWaalsContact CB-OD1 3.31Å; P31-D33 WeakPolarHBondContact CB-OD1 3.34Å; P31-D33 PolarHBondContact O-N 2.77Å; P31-D33 VanDerWaalsContact O-N 3.07Å; P31-K34 HydrophobicContact CG-CB 3.96Å; P31-K34 WeakPolarHBondContact O-CA 3.29Å; P31-K34 PolarHBondContact O-N 3.1Å; P31-S35 PolarHBondContact O-N 3.13Å
32	K	92.8	Very high	93.2	Very high	131 Å²	131	76.6 Å²	76.6	57%	0.57	37%	0.374	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.8	-28.8	-170.2	-179.1	176.3	-178	-179.7	0	114.2	V18 G19 I21 K34 S35	V18-K32 HydrophobicContact CG1-CB 3.87Å; G19-K32 PolarHBondContact O-N 2.74Å; G19-K32 VanDerWaalsContact O-N 3.13Å; I21-K32 HydrophobicContact CD1-CB 3.62Å; I21-K32 HydrophobicContact CD1-CD 3.95Å; I21-K32 HydrophobicContact CD1-CG 3.54Å; I21-K32 HydrophobicContact CG1-CB 4.12Å; K32-K34 VanDerWaalsContact C-N 3.34Å; K32-S35 PolarHBondContact O-OG 2.9Å
33	D	93	Very high	93	Very high	24 Å²	24	70.4 Å²	70.4	13%	0.128	36%	0.36	C	S	.	.	T	Hydrogen-bonded Turn	trans	-80	-13.4	178.4	63	-49.4	0	0	0	114.1	R10 S11 K12 V18 P31	R10-D33 VanDerWaalsContact CB-OD2 3.32Å; R10-D33 WeakPolarHBondContact CB-OD2 3.31Å; R10-D33 WeakPolarHBondContact CD-OD2 3.21Å; R10-D33 WeakPolarHBondContact CG-OD2 3.36Å; R10-D33 IonicContact CZ-OD2 3.85Å; R10-D33 IonicContact NE-OD2 3.82Å; R10-D33 IonicContact NH1-OD1 3.02Å; R10-D33 PolarHBondContact NH1-OD1 2.8Å; R10-D33 IonicContact NH1-OD2 3.05Å; R10-D33 PolarHBondContact NH1-OD2 3.39Å; S11-D33 PolarHBondContact N-O 3.01Å; K12-D33 WeakPolarHBondContact CB-OD2 3.45Å; V18-D33 HydrophobicContact CG1-CB 4.43Å; V18-D33 HydrophobicContact CG2-CB 4.35Å; P31-D33 VanDerWaalsContact CB-OD1 3.31Å; P31-D33 WeakPolarHBondContact CB-OD1 3.34Å; P31-D33 PolarHBondContact O-N 2.77Å; P31-D33 VanDerWaalsContact O-N 3.07Å
34	K	93	Very high	92.7	Very high	89 Å²	89	74.9 Å²	74.9	39%	0.387	38%	0.382	S	S	.	.	T	Hydrogen-bonded Turn	trans	-107.5	-23.4	176.5	-164.6	169.6	177	-179.6	0	112.3	R10 P31 K32 I76	R10-K34 HydrophobicContact CG-CB 3.71Å; R10-K34 HydrophobicContact CG-CD 4.15Å; R10-K34 HydrophobicContact CG-CG 4Å; P31-K34 HydrophobicContact CG-CB 3.96Å; P31-K34 WeakPolarHBondContact O-CA 3.29Å; P31-K34 PolarHBondContact O-N 3.1Å; K32-K34 VanDerWaalsContact C-N 3.34Å; K34-I76 HydrophobicContact CD-CD1 4.18Å; K34-I76 HydrophobicContact CG-CD1 3.84Å; K34-I76 HydrophobicContact CG-CG1 4.4Å
35	S	93.3	Very high	92.6	Very high	14 Å²	14	73 Å²	73	10%	0.098	37%	0.37	C	S	.	.	S	Bend	trans	-65.7	145.7	-179.6	67.1	0	0	0	0	110.9	P31 K32 Q73 Y74	P31-S35 PolarHBondContact O-N 3.13Å; K32-S35 PolarHBondContact O-OG 2.9Å; S35-Q73 PolarHBondContact OG-OE1 2.84Å; S35-Y74 WeakPolarHBondContact CA-O 3.4Å
36	V	93.4	Very high	92.4	Very high	30 Å²	30	74.8 Å²	74.8	18%	0.182	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.4	108.3	175.9	-177.9	0	0	0	0	106.1	Y74 A79 V84 L85	V36-Y74 PolarHBondContact N-O 3Å; V36-Y74 PolarHBondContact O-N 3.24Å; V36-A79 HydrophobicContact CB-CB 4.16Å; V36-A79 HydrophobicContact CG1-CB 4.44Å; V36-A79 HydrophobicContact CG2-CB 4.01Å; V36-V84 HydrophobicContact CG1-CG1 4.27Å; V36-L85 HydrophobicContact CB-CD1 3.94Å; V36-L85 HydrophobicContact CG1-CD1 3.5Å; V36-L85 VanDerWaalsContact CG1-CD1 3.5Å; V36-L85 HydrophobicContact CG2-CD1 3.23Å
37	W	91.5	Very high	92.1	Very high	154 Å²	154	75.7 Å²	75.7	58%	0.583	39%	0.388	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.1	141.2	175.8	72.2	-84.6	0	0	0	110.2	L39 K71 L72	W37-L39 HydrophobicContact CE3-CB 4.43Å; W37-L39 HydrophobicContact CZ3-CB 3.95Å; W37-K71 HydrophobicContact CB-CG 4.49Å; W37-K71 HydrophobicContact CE3-CG 4.36Å; W37-L72 CarbonylContact C-O 3.51Å; W37-L72 VanDerWaalsContact CA-O 3.22Å; W37-L72 WeakPolarHBondContact CA-O 3.46Å
38	K	91.6	Very high	92	Very high	100 Å²	100	77 Å²	77	44%	0.435	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	119.1	171.1	-176.6	176.5	-178	-177.6	0	107.6	V40 L72 Y74	K38-V40 HydrophobicContact CD-CG2 4.28Å; K38-V40 HydrophobicContact CG-CG2 4.12Å; K38-V40 PolarHBondContact O-N 3Å; K38-L72 PolarHBondContact N-O 3.42Å; K38-L72 PolarHBondContact O-N 3.29Å; K38-Y74 HydrophobicContact CB-CE2 4.33Å
39	L	91.5	Very high	91.8	Very high	91 Å²	91	71.2 Å²	71.2	48%	0.476	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.4	121.7	167.6	-175.3	67.7	0	0	0	107.9	W37	W37-L39 HydrophobicContact CE3-CB 4.43Å; W37-L39 HydrophobicContact CZ3-CB 3.95Å
40	V	92.2	Very high	91.5	Very high	21 Å²	21	70.9 Å²	70.9	13%	0.127	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	107.5	173.5	177.1	0	0	0	0	106.6	K38 R42 V70 L72	K38-V40 HydrophobicContact CD-CG2 4.28Å; K38-V40 HydrophobicContact CG-CG2 4.12Å; K38-V40 PolarHBondContact O-N 3Å; V40-R42 HydrophobicContact CG1-CG 3.64Å; V40-R42 VanDerWaalsContact CG1-NE 3.34Å; V40-V70 PolarHBondContact N-O 3.07Å; V40-V70 PolarHBondContact O-N 3.02Å; V40-L72 HydrophobicContact CB-CD1 4.33Å; V40-L72 HydrophobicContact CG2-CD1 3.51Å; V40-L72 HydrophobicContact CG2-CG 4.15Å
41	T	92.5	Very high	91.2	Very high	71 Å²	71	76.1 Å²	76.1	44%	0.436	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.9	115.4	167.5	-54	0	0	0	0	107.3	K67 L68 Y69	T41-K67 HydrophobicContact CG2-CB 4.26Å; T41-K67 HydrophobicContact CG2-CD 4.17Å; T41-L68 WeakPolarHBondContact CA-O 3.32Å; T41-Y69 HydrophobicContact CG2-CD1 3.96Å; T41-Y69 HydrophobicContact CG2-CE1 3.56Å
42	R	91.4	Very high	91.1	Very high	172 Å²	172	80.8 Å²	80.8	65%	0.649	42%	0.42	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-128.7	144.3	176.5	-72.8	177	-179.1	-168.1	-0.8	108.4	V40 K67 L68	V40-R42 HydrophobicContact CG1-CG 3.64Å; V40-R42 VanDerWaalsContact CG1-NE 3.34Å; R42-K67 CarbonylContact O-C 3.53Å; R42-K67 WeakPolarHBondContact O-CA 3.16Å; R42-L68 PolarHBondContact N-O 3.05Å; R42-L68 VanDerWaalsContact N-O 3.09Å; R42-L68 PolarHBondContact O-N 2.58Å
43	S	91.1	Very high	90.8	Very high	60 Å²	60	77.7 Å²	77.7	42%	0.42	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-59.9	149.8	162	43.5	0	0	0	0	108.8	V45	S43-V45 WeakPolarHBondContact CB-O 3.48Å; S43-V45 PolarHBondContact O-N 3.09Å; S43-V45 PolarHBondContact OG-O 3.33Å
44	M	90.1	Very high	90.6	Very high	99 Å²	99	79.6 Å²	79.6	49%	0.488	42%	0.417	S	S	.	.	S	Bend	trans	-62.5	-28.7	172.1	-74.4	-170.1	-52.5	0	0	112	P66 L68	M44-P66 HydrophobicContact CE-CB 3.38Å; M44-P66 HydrophobicContact CE-CG 3.26Å; M44-P66 PolarHBondContact N-O 2.7Å; M44-P66 VanDerWaalsContact N-O 3.13Å; M44-P66 HydrophobicContact SD-CB 4.31Å; M44-L68 HydrophobicContact CG-CD1 4.12Å; M44-L68 HydrophobicContact CG-CD2 3.88Å; M44-L68 HydrophobicContact CG-CG 3.63Å; M44-L68 HydrophobicContact SD-CD2 4.19Å
45	V	90.6	Very high	90.3	Very high	32 Å²	32	80.9 Å²	80.9	19%	0.194	43%	0.428	C	S	.	.	S	Bend	trans	-105.7	143.4	-178	-173.8	0	0	0	0	110.4	S43 A49 L53 V65	S43-V45 WeakPolarHBondContact CB-O 3.48Å; S43-V45 PolarHBondContact O-N 3.09Å; S43-V45 PolarHBondContact OG-O 3.33Å; V45-A49 HydrophobicContact CG1-CB 3.6Å; V45-L53 HydrophobicContact CG2-CD2 4Å; V45-V65 HydrophobicContact CB-CG1 4.22Å; V45-V65 HydrophobicContact CG2-CG1 3.84Å
46	E	90.2	Very high	90.1	Very high	140 Å²	140	84.4 Å²	84.4	65%	0.654	46%	0.458	S	S	*	.			trans	-66	148.5	172	178.3	-173.2	143	0	0	111	A48 A49 V50	E46-A48 PolarHBondContact O-N 3.2Å; E46-A48 VanDerWaalsContact O-N 3.13Å; E46-A48 WeakPolarHBondContact OE1-CB 3.15Å; E46-A49 PolarHBondContact O-N 2.99Å; E46-A49 VanDerWaalsContact O-N 3.1Å; E46-V50 WeakPolarHBondContact O-CG2 3.22Å; E46-V50 PolarHBondContact O-N 3.47Å
47	A	88.3	Confident	89.8	Confident	89 Å²	89	84.6 Å²	84.6	74%	0.736	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.2	-32.9	179.9	0	0	0	0	0	115.1
48	A	90.3	Very high	89.6	Confident	67 Å²	67	84.1 Å²	84.1	55%	0.554	47%	0.474	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.7	-42.5	178	0	0	0	0	0	112.2	E46 V50	E46-A48 PolarHBondContact O-N 3.2Å; E46-A48 VanDerWaalsContact O-N 3.13Å; E46-A48 WeakPolarHBondContact OE1-CB 3.15Å; A48-V50 PolarHBondContact O-N 2.97Å
49	A	90	Very high	89.3	Confident	38 Å²	38	87.7 Å²	87.7	31%	0.314	49%	0.486	S	S	.	.	H	α-helix	trans	-76.7	-5.3	-177.7	0	0	0	0	0	113.7	V45 E46 K51 D52 L53	V45-A49 HydrophobicContact CG1-CB 3.6Å; E46-A49 PolarHBondContact O-N 2.99Å; E46-A49 VanDerWaalsContact O-N 3.1Å; A49-K51 VanDerWaalsContact C-N 3.27Å; A49-K51 PolarHBondContact O-N 2.98Å; A49-D52 PolarHBondContact O-N 3.29Å; A49-L53 VanDerWaalsContact O-CB 3.32Å; A49-L53 WeakPolarHBondContact O-CB 3.19Å; A49-L53 PolarHBondContact O-N 3.42Å
50	V	88.5	Confident	88.6	Confident	45 Å²	45	84.6 Å²	84.6	27%	0.273	48%	0.476	S	S	.	.	H	α-helix	trans	-58.9	-42.5	177	176.4	0	0	0	0	110.6	E46 A48 L53 E54	E46-V50 WeakPolarHBondContact O-CG2 3.22Å; E46-V50 PolarHBondContact O-N 3.47Å; A48-V50 PolarHBondContact O-N 2.97Å; V50-L53 PolarHBondContact O-N 2.91Å; V50-E54 WeakPolarHBondContact CG1-OE1 3.49Å; V50-E54 WeakPolarHBondContact O-CG 3.34Å; V50-E54 PolarHBondContact O-N 2.99Å
51	K	86.7	Confident	87.9	Confident	122 Å²	122	91.5 Å²	91.5	53%	0.53	51%	0.505	S	S	.	.	H	α-helix	trans	-67.8	-47.1	-178.4	-178.4	170.5	176.1	171.4	0	112	A49 L53 E54 D55	A49-K51 VanDerWaalsContact C-N 3.27Å; A49-K51 PolarHBondContact O-N 2.98Å; K51-L53 PolarHBondContact O-N 3.13Å; K51-E54 PolarHBondContact O-N 2.87Å; K51-E54 VanDerWaalsContact O-N 3.16Å; K51-D55 PolarHBondContact O-N 3.18Å
52	D	90.6	Very high	87.4	Confident	108 Å²	108	95.4 Å²	95.4	58%	0.578	52%	0.523	S	S	*	.	H	α-helix	trans	-63.4	-35	-179.9	-53.3	-43.8	0	0	0	111.3	A49 A56	A49-D52 PolarHBondContact O-N 3.29Å; D52-A56 WeakPolarHBondContact O-CB 3.4Å; D52-A56 PolarHBondContact O-N 2.72Å
53	L	87.5	Confident	87	Confident	66 Å²	66	92.8 Å²	92.8	35%	0.346	51%	0.513	S	S	.	.	H	α-helix	trans	-67.9	-41.7	174.9	-165.6	87.1	0	0	0	112.1	V45 A49 V50 K51 S57 V65	V45-L53 HydrophobicContact CG2-CD2 4Å; A49-L53 VanDerWaalsContact O-CB 3.32Å; A49-L53 WeakPolarHBondContact O-CB 3.19Å; A49-L53 PolarHBondContact O-N 3.42Å; V50-L53 PolarHBondContact O-N 2.91Å; K51-L53 PolarHBondContact O-N 3.13Å; L53-S57 WeakPolarHBondContact O-CB 3.42Å; L53-S57 PolarHBondContact O-N 2.89Å; L53-S57 PolarHBondContact O-OG 3.25Å; L53-V65 HydrophobicContact CD2-CG2 3.75Å
54	E	87.4	Confident	86.7	Confident	64 Å²	64	93.9 Å²	93.9	30%	0.299	53%	0.527	S	S	.	.	H	α-helix	trans	-61.6	-46.4	176.8	-76.3	173.3	-167.2	0	0	110.9	V50 K51 S57	V50-E54 WeakPolarHBondContact CG1-OE1 3.49Å; V50-E54 WeakPolarHBondContact O-CG 3.34Å; V50-E54 PolarHBondContact O-N 2.99Å; K51-E54 PolarHBondContact O-N 2.87Å; K51-E54 VanDerWaalsContact O-N 3.16Å; E54-S57 PolarHBondContact O-N 3.46Å; E54-S57 PolarHBondContact O-OG 2.99Å; E54-S57 VanDerWaalsContact O-OG 3.06Å
55	D	87.7	Confident	86.5	Confident	116 Å²	116	91.1 Å²	91.1	62%	0.62	52%	0.515	S	S	*	.	H	α-helix	trans	-68.8	-34.5	-178.6	-67.9	-21.3	0	0	0	112.4	K51	K51-D55 PolarHBondContact O-N 3.18Å
56	A	89.5	Confident	86.5	Confident	88 Å²	88	92.1 Å²	92.1	73%	0.727	52%	0.522	S	S	*	.	H	α-helix	trans	-88	-9.2	179.7	0	0	0	0	0	114.6	D52	D52-A56 WeakPolarHBondContact O-CB 3.4Å; D52-A56 PolarHBondContact O-N 2.72Å
57	S	86.2	Confident	86.7	Confident	34 Å²	34	91.4 Å²	91.4	24%	0.238	52%	0.517	C	S	.	.			trans	-86.6	140.5	-176.3	69.2	0	0	0	0	112.8	L53 E54 Y59 G60	L53-S57 WeakPolarHBondContact O-CB 3.42Å; L53-S57 PolarHBondContact O-N 2.89Å; L53-S57 PolarHBondContact O-OG 3.25Å; E54-S57 PolarHBondContact O-N 3.46Å; E54-S57 PolarHBondContact O-OG 2.99Å; E54-S57 VanDerWaalsContact O-OG 3.06Å; S57-Y59 PolarHBondContact O-N 2.9Å; S57-G60 PolarHBondContact O-N 3.3Å; S57-G60 WeakPolarHBondContact OG-CA 2.86Å; S57-G60 PolarHBondContact OG-N 3.37Å; S57-G60 PolarHBondContact OG-O 2.94Å
58	V	88.5	Confident	86.9	Confident	143 Å²	143	91.4 Å²	91.4	87%	0.867	50%	0.504	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.1	-32.7	177.1	-178.7	0	0	0	0	112	G60	V58-G60 VanDerWaalsContact C-N 3.32Å
59	Y	83.9	Confident	87.2	Confident	176 Å²	176	95.5 Å²	95.5	69%	0.69	51%	0.506	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.8	1.4	179.2	-58.4	-65.8	0	0	0	113.4	S57 N62 Y63	S57-Y59 PolarHBondContact O-N 2.9Å; Y59-N62 PolarHBondContact O-N 3.37Å; Y59-N62 VanDerWaalsContact O-N 3.15Å; Y59-Y63 HydrophobicContact CD2-CD2 4.35Å
60	G	77.7	Confident	87.4	Confident	25 Å²	25	97 Å²	97	26%	0.258	51%	0.511	S	S	.	.	G	3₁₀ helix	trans	49.6	-138.3	-177.5	0	0	0	0	0	113.2	S57 V58 N62 Y63	S57-G60 PolarHBondContact O-N 3.3Å; S57-G60 WeakPolarHBondContact OG-CA 2.86Å; S57-G60 PolarHBondContact OG-N 3.37Å; S57-G60 PolarHBondContact OG-O 2.94Å; V58-G60 VanDerWaalsContact C-N 3.32Å; G60-N62 PolarHBondContact O-N 3.38Å; G60-N62 VanDerWaalsContact O-N 3.1Å; G60-Y63 PolarHBondContact O-N 2.86Å
61	K	76.4	Confident	87.7	Confident	167 Å²	167	100.4 Å²	100.4	73%	0.726	52%	0.523	S	S	*	.	G	3₁₀ helix	trans	-63.8	-12	178.8	-71.5	-178	179.1	173.5	0	115.2	Y63	K61-Y63 VanDerWaalsContact C-N 3.3Å; K61-Y63 PolarHBondContact O-N 3.31Å
62	N	81.8	Confident	88	Confident	153 Å²	153	96.5 Å²	96.5	82%	0.818	51%	0.507	S	S	*	.	G	3₁₀ helix	trans	-82.3	-8	-177.6	-79.9	24.1	0	0	0	113.2	Y59 G60 A64	Y59-N62 PolarHBondContact O-N 3.37Å; Y59-N62 VanDerWaalsContact O-N 3.15Å; G60-N62 PolarHBondContact O-N 3.38Å; G60-N62 VanDerWaalsContact O-N 3.1Å; N62-A64 PolarHBondContact O-N 3.23Å
63	Y	83.4	Confident	88.2	Confident	116 Å²	116	92.2 Å²	92.2	46%	0.455	48%	0.484	S	S	.	.			trans	-78.9	108.1	177.3	-170.6	-110.4	0	0	0	111.9	Y59 G60 K61 V65	Y59-Y63 HydrophobicContact CD2-CD2 4.35Å; G60-Y63 PolarHBondContact O-N 2.86Å; K61-Y63 VanDerWaalsContact C-N 3.3Å; K61-Y63 PolarHBondContact O-N 3.31Å; Y63-V65 HydrophobicContact CD1-CG2 4.45Å; Y63-V65 PolarHBondContact O-N 3.34Å; Y63-V65 VanDerWaalsContact O-N 3.09Å
64	A	84.8	Confident	88.6	Confident	84 Å²	84	90.3 Å²	90.3	69%	0.694	47%	0.472	S	S	*	.			trans	-72.7	102.6	174.7	0	0	0	0	0	110.8	N62 P66	N62-A64 PolarHBondContact O-N 3.23Å; A64-P66 WeakPolarHBondContact O-CD 3.44Å
65	V	86.3	Confident	89	Confident	40 Å²	40	87.5 Å²	87.5	24%	0.242	46%	0.46	C	S	.	.			trans	-58.7	119.5	178.3	-177.9	0	0	0	0	110.7	V45 L53 Y63	V45-V65 HydrophobicContact CB-CG1 4.22Å; V45-V65 HydrophobicContact CG2-CG1 3.84Å; L53-V65 HydrophobicContact CD2-CG2 3.75Å; Y63-V65 HydrophobicContact CD1-CG2 4.45Å; Y63-V65 PolarHBondContact O-N 3.34Å; Y63-V65 VanDerWaalsContact O-N 3.09Å
66	P	90.9	Very high	89.3	Confident	54 Å²	54	85.2 Å²	85.2	35%	0.351	45%	0.447	S	S	.	.			trans	-66.3	158.5	-178.6	-15.6	24.8	0	0	0	113.1	M44 A64	M44-P66 HydrophobicContact CE-CB 3.38Å; M44-P66 HydrophobicContact CE-CG 3.26Å; M44-P66 PolarHBondContact N-O 2.7Å; M44-P66 VanDerWaalsContact N-O 3.13Å; M44-P66 HydrophobicContact SD-CB 4.31Å; A64-P66 WeakPolarHBondContact O-CD 3.44Å
67	K	93.4	Very high	89.5	Confident	124 Å²	124	84.7 Å²	84.7	54%	0.539	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.1	136.7	-179.3	-66.7	173.2	-175.8	167.5	0	110.7	T41 R42 Y69	T41-K67 HydrophobicContact CG2-CB 4.26Å; T41-K67 HydrophobicContact CG2-CD 4.17Å; R42-K67 CarbonylContact O-C 3.53Å; R42-K67 WeakPolarHBondContact O-CA 3.16Å; K67-Y69 HydrophobicContact CB-CD2 4.48Å; K67-Y69 HydrophobicContact CB-CE2 3.74Å; K67-Y69 VanDerWaalsContact O-CD2 3.29Å; K67-Y69 WeakPolarHBondContact O-CD2 3.12Å; K67-Y69 WeakPolarHBondContact O-CE2 3.31Å
68	L	93.9	Very high	90	Very high	89 Å²	89	84 Å²	84	47%	0.466	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.5	129.2	168.9	-63.3	173.3	0	0	0	109.8	T41 R42 M44	T41-L68 WeakPolarHBondContact CA-O 3.32Å; R42-L68 PolarHBondContact N-O 3.05Å; R42-L68 VanDerWaalsContact N-O 3.09Å; R42-L68 PolarHBondContact O-N 2.58Å; M44-L68 HydrophobicContact CG-CD1 4.12Å; M44-L68 HydrophobicContact CG-CD2 3.88Å; M44-L68 HydrophobicContact CG-CG 3.63Å; M44-L68 HydrophobicContact SD-CD2 4.19Å
69	Y	95.8	Very high	90.3	Very high	153 Å²	153	77.2 Å²	77.2	60%	0.6	39%	0.392	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.5	105.1	175.2	-63.7	-89.7	0	0	0	109.1	T41 K67	T41-Y69 HydrophobicContact CG2-CD1 3.96Å; T41-Y69 HydrophobicContact CG2-CE1 3.56Å; K67-Y69 HydrophobicContact CB-CD2 4.48Å; K67-Y69 HydrophobicContact CB-CE2 3.74Å; K67-Y69 VanDerWaalsContact O-CD2 3.29Å; K67-Y69 WeakPolarHBondContact O-CD2 3.12Å; K67-Y69 WeakPolarHBondContact O-CE2 3.31Å
70	V	94.5	Very high	90.8	Very high	70 Å²	70	72.9 Å²	72.9	42%	0.424	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.2	123.4	179.9	-174.6	0	0	0	0	109.8	V40 L72	V40-V70 PolarHBondContact N-O 3.07Å; V40-V70 PolarHBondContact O-N 3.02Å; V70-L72 HydrophobicContact CG1-CD2 3.61Å; V70-L72 HydrophobicContact CG1-CG 4.1Å; V70-L72 PolarHBondContact O-N 3.11Å
71	K	94.2	Very high	91.7	Very high	116 Å²	116	79.7 Å²	79.7	50%	0.504	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.2	91.1	172.3	-171	176.1	-172.5	169.9	0	109.8	W37	W37-K71 HydrophobicContact CB-CG 4.49Å; W37-K71 HydrophobicContact CE3-CG 4.36Å
72	L	94.1	Very high	92.4	Very high	40 Å²	40	74 Å²	74	21%	0.209	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72	139	176.9	-60.4	176.2	0	0	0	110.3	T24 W37 K38 V40 V70 Y74	T24-L72 HydrophobicContact CG2-CD2 4.07Å; W37-L72 CarbonylContact C-O 3.51Å; W37-L72 VanDerWaalsContact CA-O 3.22Å; W37-L72 WeakPolarHBondContact CA-O 3.46Å; K38-L72 PolarHBondContact N-O 3.42Å; K38-L72 PolarHBondContact O-N 3.29Å; V40-L72 HydrophobicContact CB-CD1 4.33Å; V40-L72 HydrophobicContact CG2-CD1 3.51Å; V40-L72 HydrophobicContact CG2-CG 4.15Å; V70-L72 HydrophobicContact CG1-CD2 3.61Å; V70-L72 HydrophobicContact CG1-CG 4.1Å; V70-L72 PolarHBondContact O-N 3.11Å; L72-Y74 HydrophobicContact CB-CE2 3.77Å; L72-Y74 HydrophobicContact CD1-CE2 4.44Å; L72-Y74 WeakPolarHBondContact CD1-OH 3.32Å
73	Q	95.1	Very high	92.9	Very high	19 Å²	19	74 Å²	74	9%	0.089	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	116	-178.9	-68.8	-76.1	-0.7	0	0	109.1	I21 C23 T24 S35	I21-Q73 HydrophobicContact CG2-CB 3.88Å; I21-Q73 HydrophobicContact CG2-CG 3.97Å; C23-Q73 WeakPolarHBondContact CA-O 3.34Å; T24-Q73 PolarHBondContact N-O 2.96Å; T24-Q73 PolarHBondContact OG1-O 2.95Å; S35-Q73 PolarHBondContact OG-OE1 2.84Å
74	Y	95.9	Very high	93.2	Very high	26 Å²	26	71.1 Å²	71.1	10%	0.102	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110	147.2	-177.3	-60.4	-75.4	0	0	0	112.2	N25 S35 V36 K38 L72 C78	N25-Y74 WeakPolarHBondContact OD1-CE1 3.35Å; S35-Y74 WeakPolarHBondContact CA-O 3.4Å; V36-Y74 PolarHBondContact N-O 3Å; V36-Y74 PolarHBondContact O-N 3.24Å; K38-Y74 HydrophobicContact CB-CE2 4.33Å; L72-Y74 HydrophobicContact CB-CE2 3.77Å; L72-Y74 HydrophobicContact CD1-CE2 4.44Å; L72-Y74 WeakPolarHBondContact CD1-OH 3.32Å; Y74-C78 HydrophobicContact CD1-CB 4.33Å
75	C	95.2	Very high	93.5	Very high	5 Å²	5	70 Å²	70	3%	0.034	36%	0.355	C	S	.	.			trans	-72.1	160.2	158.6	75.8	0	0	0	0	110.2	C23 C30 S77 C78 A79	C23-C75 HydrophobicContact CB-CB 4.1Å; C23-C75 PolarHBondContact SG-N 3.4Å; C30-C75 WeakPolarHBondContact SG-CB 3.37Å; C75-S77 VanDerWaalsContact C-N 3.26Å; C75-S77 PolarHBondContact O-N 3.15Å; C75-C78 PolarHBondContact O-N 2.99Å; C75-C78 VanDerWaalsContact SG-CB 3.59Å; C75-C78 PolarHBondContact SG-N 3.32Å; C75-C78 PolarHBondContact SG-SG 2.94Å; C75-A79 WeakPolarHBondContact O-CB 3.37Å; C75-A79 PolarHBondContact O-N 3.08Å
76	I	93.7	Very high	93.7	Very high	68 Å²	68	75.7 Å²	75.7	35%	0.349	37%	0.372	S	S	.	.	H	α-helix	trans	-60.6	-37.9	-177.9	-61.1	-177.7	0	0	0	111.3	K34 A79 I80	K34-I76 HydrophobicContact CD-CD1 4.18Å; K34-I76 HydrophobicContact CG-CD1 3.84Å; K34-I76 HydrophobicContact CG-CG1 4.4Å; I76-A79 PolarHBondContact O-N 2.99Å; I76-I80 HydrophobicContact CG2-CD1 3.87Å; I76-I80 WeakPolarHBondContact O-CG1 3.44Å; I76-I80 PolarHBondContact O-N 3.48Å; I76-I80 VanDerWaalsContact O-N 3.11Å
77	S	94.7	Very high	93.7	Very high	76 Å²	76	79.6 Å²	79.6	53%	0.531	39%	0.39	S	S	.	.	H	α-helix	trans	-64.1	-50.8	179.6	-48.9	0	0	0	0	111.7	C75 A79 I80 H81	C75-S77 VanDerWaalsContact C-N 3.26Å; C75-S77 PolarHBondContact O-N 3.15Å; S77-A79 VanDerWaalsContact C-N 3.31Å; S77-A79 PolarHBondContact O-N 3.4Å; S77-I80 PolarHBondContact O-N 2.99Å; S77-H81 PolarHBondContact O-N 3.06Å
78	C	95.9	Very high	93.6	Very high	21 Å²	21	77.1 Å²	77.1	14%	0.142	38%	0.377	C	S	.	.	H	α-helix	trans	-62.8	-38.3	177	-68.5	0	0	0	0	111.8	C26 Y74 C75 I80 H81 S82	C26-C78 PolarHBondContact SG-SG 3.48Å; Y74-C78 HydrophobicContact CD1-CB 4.33Å; C75-C78 PolarHBondContact O-N 2.99Å; C75-C78 VanDerWaalsContact SG-CB 3.59Å; C75-C78 PolarHBondContact SG-N 3.32Å; C75-C78 PolarHBondContact SG-SG 2.94Å; C78-I80 VanDerWaalsContact C-N 3.28Å; C78-I80 PolarHBondContact O-N 3.08Å; C78-H81 PolarHBondContact O-N 3.32Å; C78-S82 WeakPolarHBondContact O-CB 3.46Å; C78-S82 PolarHBondContact O-N 3.05Å; C78-S82 PolarHBondContact O-OG 2.89Å
79	A	94.9	Very high	93.4	Very high	0 Å²	0	76.3 Å²	76.3	0%	0	38%	0.379	C	S	.	.	H	α-helix	trans	-66.1	-30	179.5	0	0	0	0	0	113.2	V36 C75 I76 S77 V84 L85	V36-A79 HydrophobicContact CB-CB 4.16Å; V36-A79 HydrophobicContact CG1-CB 4.44Å; V36-A79 HydrophobicContact CG2-CB 4.01Å; C75-A79 WeakPolarHBondContact O-CB 3.37Å; C75-A79 PolarHBondContact O-N 3.08Å; I76-A79 PolarHBondContact O-N 2.99Å; S77-A79 VanDerWaalsContact C-N 3.31Å; S77-A79 PolarHBondContact O-N 3.4Å; A79-V84 PolarHBondContact O-N 3.06Å; A79-L85 HydrophobicContact CB-CD1 3.94Å; A79-L85 PolarHBondContact O-N 3.11Å
80	I	95.4	Very high	93.1	Very high	85 Å²	85	78.6 Å²	78.6	44%	0.436	39%	0.386	S	S	.	.	H	α-helix	trans	-77.1	-44.6	173.8	-66.7	167.6	0	0	0	110.1	I76 S77 C78 S82 K83	I76-I80 HydrophobicContact CG2-CD1 3.87Å; I76-I80 WeakPolarHBondContact O-CG1 3.44Å; I76-I80 PolarHBondContact O-N 3.48Å; I76-I80 VanDerWaalsContact O-N 3.11Å; S77-I80 PolarHBondContact O-N 2.99Å; C78-I80 VanDerWaalsContact C-N 3.28Å; C78-I80 PolarHBondContact O-N 3.08Å; I80-S82 PolarHBondContact O-N 2.91Å; I80-K83 PolarHBondContact O-N 2.98Å
81	H	95.2	Very high	92.9	Very high	167 Å²	167	82.9 Å²	82.9	77%	0.773	40%	0.401	S	S	*	.	H	α-helix	trans	-61.3	-44.5	179.1	-176	76.8	0	0	0	112.2	S77 C78 K83	S77-H81 PolarHBondContact O-N 3.06Å; C78-H81 PolarHBondContact O-N 3.32Å; H81-K83 PolarHBondContact O-N 2.89Å; H81-K83 VanDerWaalsContact O-N 3.15Å
82	S	91.9	Very high	92.7	Very high	49 Å²	49	78.7 Å²	78.7	34%	0.343	39%	0.387	S	S	.	.	T	Hydrogen-bonded Turn	trans	-76.5	6.3	176.3	67.9	0	0	0	0	114	C78 I80 V84	C78-S82 WeakPolarHBondContact O-CB 3.46Å; C78-S82 PolarHBondContact O-N 3.05Å; C78-S82 PolarHBondContact O-OG 2.89Å; I80-S82 PolarHBondContact O-N 2.91Å; S82-V84 PolarHBondContact O-N 2.83Å; S82-V84 VanDerWaalsContact O-N 3.08Å; S82-V84 WeakPolarHBondContact OG-CG2 3.26Å
83	K	91.4	Very high	92.4	Very high	153 Å²	153	80.1 Å²	80.1	67%	0.665	39%	0.39	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.4	19.7	179.2	-56.1	170.1	-176.6	174.3	0	113.8	I80 H81	I80-K83 PolarHBondContact O-N 2.98Å; H81-K83 PolarHBondContact O-N 2.89Å; H81-K83 VanDerWaalsContact O-N 3.15Å
84	V	90.2	Very high	92	Very high	54 Å²	54	88.9 Å²	88.9	33%	0.327	42%	0.422	S	S	.	.	S	Bend	trans	-68.3	-41.4	172.7	173.2	0	0	0	0	110.2	V36 A79 S82	V36-V84 HydrophobicContact CG1-CG1 4.27Å; A79-V84 PolarHBondContact O-N 3.06Å; S82-V84 PolarHBondContact O-N 2.83Å; S82-V84 VanDerWaalsContact O-N 3.08Å; S82-V84 WeakPolarHBondContact OG-CG2 3.26Å
85	L	90.4	Very high	91.7	Very high	61 Å²	61	92.8 Å²	92.8	32%	0.319	44%	0.444	S	S	.	.	S	Bend	trans	-113.6	148.5	169.7	-86.5	141	0	0	0	110.1	V36 A79	V36-L85 HydrophobicContact CB-CD1 3.94Å; V36-L85 HydrophobicContact CG1-CD1 3.5Å; V36-L85 VanDerWaalsContact CG1-CD1 3.5Å; V36-L85 HydrophobicContact CG2-CD1 3.23Å; A79-L85 HydrophobicContact CB-CD1 3.94Å; A79-L85 PolarHBondContact O-N 3.11Å
86	R	91.2	Very high	91.1	Very high	159 Å²	159	102.1 Å²	102.1	60%	0.6	48%	0.478	S	S	*	.			trans	-127.9	155.8	176.2	-67.1	176.4	177.9	160.1	-3.1	110.2	R88	R86-R88 PolarHBondContact O-N 2.86Å
87	N	91	Very high	90.7	Very high	137 Å²	137	109.4 Å²	109.4	73%	0.733	50%	0.501	S	S	*	.			trans	-63.4	136.4	171	-96.5	-6.5	0	0	0	109.8
88	R	90.4	Very high	89.9	Confident	72 Å²	72	113.1 Å²	113.1	27%	0.272	51%	0.514	S	S	.	.			trans	-122.8	152.3	-177.1	-81.1	-168.1	-74.4	164.9	-9.5	110	R86 S92 R93 L95	R86-R88 PolarHBondContact O-N 2.86Å; R88-S92 WeakPolarHBondContact CB-OG 3.44Å; R88-S92 PolarHBondContact NH1-O 3.22Å; R88-R93 HydrophobicContact CB-CG 4Å; R88-R93 PolarHBondContact O-NE 2.96Å; R88-R93 PolarHBondContact O-NH2 3.24Å; R88-R93 VanDerWaalsContact O-NH2 3.16Å; R88-L95 PolarHBondContact NH1-O 2.76Å
89	S	91.3	Very high	88.7	Confident	71 Å²	71	118.3 Å²	118.3	50%	0.497	54%	0.539	S	S	.	.			trans	-58.5	162	172.7	70.4	0	0	0	0	111.8	E91 S92 R93	S89-E91 VanDerWaalsContact C-N 3.25Å; S89-E91 PolarHBondContact O-N 3.09Å; S89-S92 PolarHBondContact N-OG 2.73Å; S89-S92 PolarHBondContact O-N 3.37Å; S89-S92 PolarHBondContact O-OG 2.99Å; S89-S92 WeakPolarHBondContact OG-CB 3.41Å; S89-S92 PolarHBondContact OG-N 2.91Å; S89-S92 PolarHBondContact OG-OG 2.91Å; S89-R93 VanDerWaalsContact O-CG 3.23Å; S89-R93 WeakPolarHBondContact O-CG 3.4Å; S89-R93 PolarHBondContact O-N 2.84Å; S89-R93 VanDerWaalsContact O-N 3.08Å
90	R	89.5	Confident	87.5	Confident	202 Å²	202	123.7 Å²	123.7	76%	0.762	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.1	-41.9	-175.8	-175.5	178.5	178.9	-178.9	-2	112
91	E	89.4	Confident	85.9	Confident	159 Å²	159	127.1 Å²	127.1	74%	0.743	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74	-49.7	-179.2	-62.8	175.9	162.4	0	0	111.5	S89 R93 R94	S89-E91 VanDerWaalsContact C-N 3.25Å; S89-E91 PolarHBondContact O-N 3.09Å; E91-R93 PolarHBondContact O-N 2.89Å; E91-R93 VanDerWaalsContact O-N 3.08Å; E91-R94 WeakPolarHBondContact O-CB 3.48Å; E91-R94 PolarHBondContact O-N 2.82Å
92	S	89.5	Confident	84.3	Confident	28 Å²	28	124.5 Å²	124.5	20%	0.196	58%	0.581	C	S	.	*	T	Hydrogen-bonded Turn	trans	-64.6	-17.2	-179.2	62.6	0	0	0	0	113.7	R88 S89 R94 L95	R88-S92 WeakPolarHBondContact CB-OG 3.44Å; R88-S92 PolarHBondContact NH1-O 3.22Å; S89-S92 PolarHBondContact N-OG 2.73Å; S89-S92 PolarHBondContact O-N 3.37Å; S89-S92 PolarHBondContact O-OG 2.99Å; S89-S92 WeakPolarHBondContact OG-CB 3.41Å; S89-S92 PolarHBondContact OG-N 2.91Å; S89-S92 PolarHBondContact OG-OG 2.91Å; S92-R94 PolarHBondContact O-N 3.34Å; S92-L95 WeakPolarHBondContact O-CB 3.23Å; S92-L95 PolarHBondContact O-N 3.07Å
93	R	88.6	Confident	83	Confident	71 Å²	71	133.8 Å²	133.8	27%	0.268	61%	0.608	S	S	.	*	T	Hydrogen-bonded Turn	trans	-64.8	-25	169.9	-74.6	166.5	-163.1	170.2	6.6	113.4	K4 R88 S89 E91	K4-R93 VanDerWaalsContact CE-NH1 3.28Å; R88-R93 HydrophobicContact CB-CG 4Å; R88-R93 PolarHBondContact O-NE 2.96Å; R88-R93 PolarHBondContact O-NH2 3.24Å; R88-R93 VanDerWaalsContact O-NH2 3.16Å; S89-R93 VanDerWaalsContact O-CG 3.23Å; S89-R93 WeakPolarHBondContact O-CG 3.4Å; S89-R93 PolarHBondContact O-N 2.84Å; S89-R93 VanDerWaalsContact O-N 3.08Å; E91-R93 PolarHBondContact O-N 2.89Å; E91-R93 VanDerWaalsContact O-N 3.08Å
94	R	87.2	Confident	81.8	Confident	202 Å²	202	132.8 Å²	132.8	76%	0.762	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.5	-26.5	178.7	-65.9	-178.9	178	176	-0.9	111.6	E91 S92 R96	E91-R94 WeakPolarHBondContact O-CB 3.48Å; E91-R94 PolarHBondContact O-N 2.82Å; S92-R94 PolarHBondContact O-N 3.34Å; R94-R96 PolarHBondContact O-N 3.49Å
95	L	88.2	Confident	80.4	Confident	108 Å²	108	139.7 Å²	139.7	57%	0.565	64%	0.641	S	S	*	*			trans	-63.5	117	174.5	-63.4	170.4	0	0	0	110.4	R88 S92	R88-L95 PolarHBondContact NH1-O 2.76Å; S92-L95 WeakPolarHBondContact O-CB 3.23Å; S92-L95 PolarHBondContact O-N 3.07Å
96	R	83.9	Confident	79	Confident	201 Å²	201	145.1 Å²	145.1	76%	0.758	66%	0.662	S	S	*	*			trans	-102.9	-3.4	178.5	-62.6	-171.5	-171.3	171	10.2	114	N7 R94	N7-R96 PolarHBondContact ND2-NH2 3.36Å; N7-R96 VanDerWaalsContact ND2-NH2 3.11Å; R94-R96 PolarHBondContact O-N 3.49Å
97	R	85.2	Confident	77.7	Confident	222 Å²	222	142.6 Å²	142.6	84%	0.838	67%	0.669	S	S	*	*	S	Bend	trans	-66.4	146.6	175.1	-62.4	-176.4	-176.6	-176.4	1	109.7	I99	R97-I99 PolarHBondContact O-N 3.26Å
98	I	78	Confident	76.3	Confident	153 Å²	153	145.4 Å²	145.4	79%	0.785	67%	0.669	S	S	*	*			trans	-67.7	123.3	173.6	-62.6	170.1	0	0	0	107.2	V100	I98-V100 VanDerWaalsContact C-N 3.35Å; I98-V100 HydrophobicContact CG2-CG2 4.04Å; I98-V100 PolarHBondContact O-N 3.4Å
99	I	70.8	Confident	75	Confident	130 Å²	130	148 Å²	148	67%	0.667	70%	0.695	S	S	*	*			trans	-79.9	92	173.6	-55.9	169.4	0	0	0	106.2	R97 K101	R97-I99 PolarHBondContact O-N 3.26Å; I99-K101 PolarHBondContact O-N 2.93Å
100	V	69.1	Low	73.8	Confident	114 Å²	114	151 Å²	151	69%	0.691	71%	0.71	S	S	*	*			trans	-75.3	115.7	171.6	-172.7	0	0	0	0	106.3	I98 P102	I98-V100 VanDerWaalsContact C-N 3.35Å; I98-V100 HydrophobicContact CG2-CG2 4.04Å; I98-V100 PolarHBondContact O-N 3.4Å; V100-P102 WeakPolarHBondContact O-CD 3.36Å
101	K	62.4	Low	72.6	Confident	156 Å²	156	145 Å²	145	68%	0.678	70%	0.704	S	S	*	*			trans	-66.7	125	164.5	-81.4	-168.8	169.6	-161.5	0	106.9	I99 R103	I99-K101 PolarHBondContact O-N 2.93Å; K101-R103 PolarHBondContact O-N 3.08Å
102	P	61.1	Low	71.4	Confident	113 Å²	113	143.4 Å²	143.4	73%	0.734	71%	0.707	S	S	*	*			trans	-57.8	119.2	170.8	20.9	-27.4	0	0	0	107.4	V100 V104	V100-P102 WeakPolarHBondContact O-CD 3.36Å; P102-V104 PolarHBondContact O-N 3.38Å
103	R	64.3	Low	70.1	Confident	243 Å²	243	152.7 Å²	152.7	92%	0.917	74%	0.738	S	S	*	*			trans	-72.1	93.2	165.7	-75	-166.5	-164.9	-158.5	6.8	105.4	K101 K105	K101-R103 PolarHBondContact O-N 3.08Å; R103-K105 PolarHBondContact O-N 3.08Å
104	V	65.2	Low	68.6	Low	132 Å²	132	157.6 Å²	157.6	80%	0.8	79%	0.794	S	S	*	*			trans	-60.1	107.9	163.7	-133.2	0	0	0	0	105	P102 F106	P102-V104 PolarHBondContact O-N 3.38Å; V104-F106 PolarHBondContact O-N 3.16Å
105	K	61.2	Low	67.7	Low	200 Å²	200	155.4 Å²	155.4	87%	0.87	80%	0.795	S	S	*	*			trans	-68.2	92.7	171.6	-77.9	-175.3	178.8	-179.4	0	105.5	R103 S107	R103-K105 PolarHBondContact O-N 3.08Å; K105-S107 PolarHBondContact O-N 3.39Å
106	F	61.2	Low	66.6	Low	174 Å²	174	157.8 Å²	157.8	76%	0.763	81%	0.807	S	S	*	*			trans	-69.8	92.4	169.3	-159.3	-85.5	0	0	0	106	V104 R108	V104-F106 PolarHBondContact O-N 3.16Å; F106-R108 HydrophobicContact CD1-CG 3.61Å; F106-R108 HydrophobicContact CE1-CG 3.93Å; F106-R108 PolarHBondContact O-N 2.84Å
107	S	64.3	Low	65.6	Low	106 Å²	106	155.4 Å²	155.4	74%	0.741	81%	0.81	S	S	*	*			trans	-66	90.6	169.2	47.7	0	0	0	0	106.7	K105	K105-S107 PolarHBondContact O-N 3.39Å
108	R	62.1	Low	64.5	Low	196 Å²	196	151.5 Å²	151.5	74%	0.74	81%	0.808	S	S	*	*			trans	-63.9	126.2	163.8	-68.9	-171.1	165.7	-179.7	-7.3	106.1	F106 V110	F106-R108 HydrophobicContact CD1-CG 3.61Å; F106-R108 HydrophobicContact CE1-CG 3.93Å; F106-R108 PolarHBondContact O-N 2.84Å; R108-V110 PolarHBondContact O-N 2.69Å
109	P	63.2	Low	63.6	Low	127 Å²	127	151.4 Å²	151.4	83%	0.825	81%	0.81	S	S	*	*			trans	-60.4	112.4	169.6	24.6	-29.7	0	0	0	106.7	A111	P109-A111 PolarHBondContact O-N 3.19Å
110	V	65.1	Low	63.1	Low	133 Å²	133	152.9 Å²	152.9	81%	0.806	82%	0.82	S	S	*	*			trans	-75.7	112.4	170.4	-177.2	0	0	0	0	104.5	R108	R108-V110 PolarHBondContact O-N 2.69Å
111	A	63.8	Low	62.7	Low	76 Å²	76	155.6 Å²	155.6	63%	0.628	83%	0.829	S	S	*	*	P	Polyproline II helix	trans	-54.4	138.5	174.1	0	0	0	0	0	108.9	P109 R113	P109-A111 PolarHBondContact O-N 3.19Å; A111-R113 PolarHBondContact O-N 3.27Å
112	P	64.8	Low	62.8	Low	127 Å²	127	155.6 Å²	155.6	83%	0.825	84%	0.84	S	S	*	*	P	Polyproline II helix	trans	-56.6	129.3	173.8	24.8	-31.8	0	0	0	107.9	A114	P112-A114 PolarHBondContact O-N 2.99Å
113	R	63.5	Low	62.9	Low	222 Å²	222	159.2 Å²	159.2	84%	0.838	85%	0.849	S	S	*	*	P	Polyproline II helix	trans	-68.1	124.1	169.6	-68.1	-177	177.8	-160.4	-3.1	106.2	A111	A111-R113 PolarHBondContact O-N 3.27Å
114	A	56	Low	62.8	Low	174 Å²	174	151.5 Å²	151.5	100%	1.438	84%	0.843	S	S	*	*			trans	-57	0	173.1	0	0	0	0	0	111.2	P112	P112-A114 PolarHBondContact O-N 2.99Å

Retrieved 114 of 114 residues in 19.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).