G4VPS8_SCHMA Loading...

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4

AlphaFold DB , UniProt , Accession G4VPS8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 125 aa.

						>G4VPS8_SCHMA|G4VPS8
MAKSSNSVFNPWNTFYETPEEQAAIKERAKIRDAMKAEYRKRYTNPFNPPIGHLHDPALQHQFSAQVSYAEYLRPSPKLGLIALGVLGTAGLAMVIRGRLKKRRLQEYGGGELTYRERWGGNTWL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.9	Very low	54.4	Low	242 Å²	242	123.5 Å²	123.5	100%	1.192	70%	0.7	S	S	*	*				0	96	0	-80.3	172.9	164.6	0	0	108.3	K3	M1-K3 PolarHBondContact O-N 3.03Å; M1-K3 VanDerWaalsContact O-N 3.13Å
2	A	38.3	Very low	55.6	Low	97 Å²	97	130.6 Å²	130.6	80%	0.802	71%	0.707	S	S	*	*			trans	-68	110.2	168.5	0	0	0	0	0	107.1	S4	A2-S4 PolarHBondContact O-N 3.39Å
3	K	44.9	Very low	56.5	Low	214 Å²	214	129.6 Å²	129.6	93%	0.93	70%	0.702	S	S	*	*			trans	-65.4	85	155.1	-104.4	-176.8	173	-176.2	0	105.5	M1 S5	M1-K3 PolarHBondContact O-N 3.03Å; M1-K3 VanDerWaalsContact O-N 3.13Å; K3-S5 PolarHBondContact O-N 2.94Å
4	S	46.3	Very low	57.2	Low	104 Å²	104	125.3 Å²	125.3	73%	0.727	68%	0.682	S	S	*	*			trans	-74.7	118.8	176.9	177.9	0	0	0	0	108	A2	A2-S4 PolarHBondContact O-N 3.39Å
5	S	46.9	Very low	57.8	Low	83 Å²	83	126.5 Å²	126.5	58%	0.58	68%	0.678	S	S	*	*			trans	74.8	105.6	-179.6	81.6	0	0	0	0	116.2	K3 S7	K3-S5 PolarHBondContact O-N 2.94Å; S5-S7 PolarHBondContact O-N 3.26Å
6	N	52.8	Low	58.3	Low	176 Å²	176	133 Å²	133	94%	0.941	69%	0.692	S	S	*	*			trans	-65.8	54.9	139	-90.7	-21.6	0	0	0	108.5	V8	N6-V8 PolarHBondContact O-N 2.9Å
7	S	58.3	Low	59.4	Low	56 Å²	56	129.5 Å²	129.5	39%	0.392	67%	0.672	S	S	.	*			trans	-74.2	115	167	-178.8	0	0	0	0	105.5	S5 F9	S5-S7 PolarHBondContact O-N 3.26Å; S7-F9 WeakPolarHBondContact CB-O 3.27Å; S7-F9 PolarHBondContact O-N 3.45Å; S7-F9 VanDerWaalsContact OG-C 3.24Å; S7-F9 PolarHBondContact OG-N 3.39Å; S7-F9 PolarHBondContact OG-O 3.01Å
8	V	65.8	Low	60.8	Low	158 Å²	158	125.9 Å²	125.9	96%	0.958	66%	0.657	S	S	*	*	S	Bend	trans	-47.5	-22.7	167.7	175	0	0	0	0	111	N6	N6-V8 PolarHBondContact O-N 2.9Å
9	F	64.8	Low	62.2	Low	114 Å²	114	125.2 Å²	125.2	50%	0.5	66%	0.66	S	S	.	*			trans	-122	98.7	174	-173.1	-101.7	0	0	0	111.5	S7 P11 T14 F15	S7-F9 WeakPolarHBondContact CB-O 3.27Å; S7-F9 PolarHBondContact O-N 3.45Å; S7-F9 VanDerWaalsContact OG-C 3.24Å; S7-F9 PolarHBondContact OG-N 3.39Å; S7-F9 PolarHBondContact OG-O 3.01Å; F9-P11 HydrophobicContact CD1-CG 4.19Å; F9-P11 HydrophobicContact CE1-CB 4.21Å; F9-P11 HydrophobicContact CE1-CG 3.85Å; F9-T14 HydrophobicContact CD2-CG2 3.77Å; F9-T14 HydrophobicContact CE2-CG2 3.8Å; F9-T14 WeakPolarHBondContact CE2-OG1 3.49Å; F9-F15 HydrophobicContact CZ-CE2 4.46Å; F9-F15 HydrophobicContact CZ-CZ 4.39Å
10	N	69.4	Low	63.5	Low	57 Å²	57	127.2 Å²	127.2	31%	0.305	67%	0.666	S	S	.	*			trans	-95.8	111.4	163.1	-179.1	5	0	0	0	107.7	W12 N13 T14	N10-W12 PolarHBondContact O-N 3.46Å; N10-W12 VanDerWaalsContact O-N 3.07Å; N10-W12 PolarHBondContact OD1-N 2.87Å; N10-N13 HydrophobicContact CB-CB 4.17Å; N10-N13 PolarHBondContact ND2-ND2 2.89Å; N10-N13 PolarHBondContact O-N 3.12Å; N10-T14 PolarHBondContact O-N 3.29Å; N10-T14 PolarHBondContact O-OG1 3.12Å
11	P	71.5	Confident	64.6	Low	57 Å²	57	125.5 Å²	125.5	37%	0.37	65%	0.654	S	S	.	*	H	α-helix	trans	-52	-37.9	-175.7	-23.5	30.5	0	0	0	112.4	F9 N13 T14 F15	F9-P11 HydrophobicContact CD1-CG 4.19Å; F9-P11 HydrophobicContact CE1-CB 4.21Å; F9-P11 HydrophobicContact CE1-CG 3.85Å; P11-N13 VanDerWaalsContact C-N 3.28Å; P11-N13 PolarHBondContact O-N 3.22Å; P11-T14 WeakPolarHBondContact CA-OG1 3.33Å; P11-T14 PolarHBondContact O-N 3.22Å; P11-T14 PolarHBondContact O-OG1 3.45Å; P11-F15 HydrophobicContact CB-CE2 4.31Å; P11-F15 WeakPolarHBondContact O-CD2 3.43Å
12	W	68.9	Low	66.9	Low	209 Å²	209	117.5 Å²	117.5	79%	0.792	61%	0.614	S	S	*	*	H	α-helix	trans	-73.5	-14.6	-178.2	-56.5	105.3	0	0	0	114.6	N10	N10-W12 PolarHBondContact O-N 3.46Å; N10-W12 VanDerWaalsContact O-N 3.07Å; N10-W12 PolarHBondContact OD1-N 2.87Å
13	N	67.9	Low	69.4	Low	118 Å²	118	115.1 Å²	115.1	63%	0.631	60%	0.595	S	S	*	*	H	α-helix	trans	-102.9	-13.5	175.9	-69.7	-8	0	0	0	112.7	N10 P11	N10-N13 HydrophobicContact CB-CB 4.17Å; N10-N13 PolarHBondContact ND2-ND2 2.89Å; N10-N13 PolarHBondContact O-N 3.12Å; P11-N13 VanDerWaalsContact C-N 3.28Å; P11-N13 PolarHBondContact O-N 3.22Å
14	T	66.3	Low	71.6	Confident	69 Å²	69	106.6 Å²	106.6	42%	0.423	56%	0.564	S	S	.	*	H	α-helix	trans	-95.2	-17	-174.8	43.5	0	0	0	0	114	F9 N10 P11	F9-T14 HydrophobicContact CD2-CG2 3.77Å; F9-T14 HydrophobicContact CE2-CG2 3.8Å; F9-T14 WeakPolarHBondContact CE2-OG1 3.49Å; N10-T14 PolarHBondContact O-N 3.29Å; N10-T14 PolarHBondContact O-OG1 3.12Å; P11-T14 WeakPolarHBondContact CA-OG1 3.33Å; P11-T14 PolarHBondContact O-N 3.22Å; P11-T14 PolarHBondContact O-OG1 3.45Å
15	F	65.6	Low	73.6	Confident	144 Å²	144	105 Å²	105	63%	0.632	55%	0.547	S	S	*	.	S	Bend	trans	-101.3	163.4	178.7	-62.3	-63.2	0	0	0	112	F9 P11 E17	F9-F15 HydrophobicContact CZ-CE2 4.46Å; F9-F15 HydrophobicContact CZ-CZ 4.39Å; P11-F15 HydrophobicContact CB-CE2 4.31Å; P11-F15 WeakPolarHBondContact O-CD2 3.43Å; F15-E17 PolarHBondContact O-N 2.96Å; F15-E17 VanDerWaalsContact O-N 3.1Å
16	Y	66.9	Low	75.9	Confident	230 Å²	230	108 Å²	108	90%	0.902	55%	0.549	S	S	*	.			trans	-55.8	113.3	176.3	-99.2	-91.7	0	0	0	110.4	T18	Y16-T18 PolarHBondContact O-N 3.3Å
17	E	76.4	Confident	77.9	Confident	73 Å²	73	105.9 Å²	105.9	34%	0.341	53%	0.534	S	S	.	.			trans	-62	132.5	169.3	-67.9	175.2	172.8	0	0	109.2	F15 E21 Q22 I25	F15-E17 PolarHBondContact O-N 2.96Å; F15-E17 VanDerWaalsContact O-N 3.1Å; E17-E21 HydrophobicContact CB-CB 4.44Å; E17-Q22 HydrophobicContact CB-CG 3.74Å; E17-Q22 WeakPolarHBondContact OE2-CG 3.33Å; E17-I25 VanDerWaalsContact CD-CD1 3.41Å; E17-I25 HydrophobicContact CG-CD1 4.46Å; E17-I25 VanDerWaalsContact OE1-CD1 3.28Å; E17-I25 WeakPolarHBondContact OE1-CD1 3.43Å; E17-I25 WeakPolarHBondContact OE2-CD1 3.44Å
18	T	84.1	Confident	79.6	Confident	66 Å²	66	111.4 Å²	111.4	41%	0.405	55%	0.546	S	S	.	.			trans	-62.9	153.8	174	58.1	0	0	0	0	110.4	Y16 E20 E21 Q22	Y16-T18 PolarHBondContact O-N 3.3Å; T18-E20 PolarHBondContact O-N 3.03Å; T18-E20 VanDerWaalsContact O-N 3.13Å; T18-E21 PolarHBondContact N-OE2 3.19Å; T18-E21 PolarHBondContact O-N 2.87Å; T18-E21 WeakPolarHBondContact OG1-CB 3.32Å; T18-E21 WeakPolarHBondContact OG1-CG 3.36Å; T18-E21 PolarHBondContact OG1-N 3.36Å; T18-E21 PolarHBondContact OG1-OE2 3.17Å; T18-Q22 PolarHBondContact O-N 3.46Å
19	P	88.2	Confident	81	Confident	111 Å²	111	105.4 Å²	105.4	72%	0.721	51%	0.513	S	S	*	.	H	α-helix	trans	-55.6	-32.3	177.7	-25.3	33.7	0	0	0	113.2	A23	P19-A23 PolarHBondContact O-N 3.4Å
20	E	87.6	Confident	82.5	Confident	165 Å²	165	107.7 Å²	107.7	77%	0.771	52%	0.523	S	S	*	.	H	α-helix	trans	-68.5	-44.2	176	-62.5	-173.2	173.8	0	0	112.1	T18 A23 A24	T18-E20 PolarHBondContact O-N 3.03Å; T18-E20 VanDerWaalsContact O-N 3.13Å; E20-A23 WeakPolarHBondContact O-CB 3.45Å; E20-A23 PolarHBondContact O-N 3.43Å; E20-A24 PolarHBondContact O-N 2.98Å
21	E	86.6	Confident	83.7	Confident	92 Å²	92	110.1 Å²	110.1	43%	0.43	53%	0.534	S	S	.	.	H	α-helix	trans	-64	-41.9	175.7	-74.1	166.7	149.8	0	0	111.6	E17 T18 A23 A24 I25	E17-E21 HydrophobicContact CB-CB 4.44Å; T18-E21 PolarHBondContact N-OE2 3.19Å; T18-E21 PolarHBondContact O-N 2.87Å; T18-E21 WeakPolarHBondContact OG1-CB 3.32Å; T18-E21 WeakPolarHBondContact OG1-CG 3.36Å; T18-E21 PolarHBondContact OG1-N 3.36Å; T18-E21 PolarHBondContact OG1-OE2 3.17Å; E21-A23 VanDerWaalsContact C-N 3.3Å; E21-A23 PolarHBondContact O-N 2.98Å; E21-A24 PolarHBondContact O-N 3.37Å; E21-I25 VanDerWaalsContact O-CG1 3.25Å; E21-I25 WeakPolarHBondContact O-CG1 3.43Å; E21-I25 PolarHBondContact O-N 3.4Å
22	Q	86.7	Confident	84.8	Confident	75 Å²	75	114 Å²	114	35%	0.35	54%	0.541	S	S	.	.	H	α-helix	trans	-60.9	-40	175	-71.9	-172.3	5.5	0	0	111.9	E17 T18 I25 K26	E17-Q22 HydrophobicContact CB-CG 3.74Å; E17-Q22 WeakPolarHBondContact OE2-CG 3.33Å; T18-Q22 PolarHBondContact O-N 3.46Å; Q22-I25 PolarHBondContact O-N 3.42Å; Q22-K26 WeakPolarHBondContact O-CB 3.45Å; Q22-K26 VanDerWaalsContact O-CG 3.28Å; Q22-K26 WeakPolarHBondContact O-CG 3.46Å; Q22-K26 PolarHBondContact O-N 2.97Å
23	A	91.1	Very high	86.2	Confident	47 Å²	47	108.1 Å²	108.1	39%	0.388	53%	0.526	S	S	.	.	H	α-helix	trans	-62.6	-47.8	175	0	0	0	0	0	110.7	P19 E20 E21 I25 K26 E27	P19-A23 PolarHBondContact O-N 3.4Å; E20-A23 WeakPolarHBondContact O-CB 3.45Å; E20-A23 PolarHBondContact O-N 3.43Å; E21-A23 VanDerWaalsContact C-N 3.3Å; E21-A23 PolarHBondContact O-N 2.98Å; A23-I25 VanDerWaalsContact C-N 3.32Å; A23-I25 PolarHBondContact O-N 3.07Å; A23-K26 PolarHBondContact O-N 3.34Å; A23-K26 VanDerWaalsContact O-N 3.17Å; A23-E27 WeakPolarHBondContact O-CG 3.28Å; A23-E27 PolarHBondContact O-N 3.17Å
24	A	91	Very high	87.5	Confident	34 Å²	34	105 Å²	105	28%	0.281	52%	0.516	S	S	.	.	H	α-helix	trans	-61.5	-37.3	177	0	0	0	0	0	112.9	E20 E21 E27 R28	E20-A24 PolarHBondContact O-N 2.98Å; E21-A24 PolarHBondContact O-N 3.37Å; A24-E27 PolarHBondContact O-N 2.99Å; A24-R28 WeakPolarHBondContact O-CB 3.49Å; A24-R28 VanDerWaalsContact O-CG 3.25Å; A24-R28 WeakPolarHBondContact O-CG 3.48Å; A24-R28 PolarHBondContact O-N 3.37Å
25	I	89.4	Confident	88.8	Confident	72 Å²	72	107.1 Å²	107.1	37%	0.369	52%	0.523	S	S	.	.	H	α-helix	trans	-65.5	-44	175.3	-69.9	164.5	0	0	0	110.5	E17 E21 Q22 A23 R28 A29	E17-I25 VanDerWaalsContact CD-CD1 3.41Å; E17-I25 HydrophobicContact CG-CD1 4.46Å; E17-I25 VanDerWaalsContact OE1-CD1 3.28Å; E17-I25 WeakPolarHBondContact OE1-CD1 3.43Å; E17-I25 WeakPolarHBondContact OE2-CD1 3.44Å; E21-I25 VanDerWaalsContact O-CG1 3.25Å; E21-I25 WeakPolarHBondContact O-CG1 3.43Å; E21-I25 PolarHBondContact O-N 3.4Å; Q22-I25 PolarHBondContact O-N 3.42Å; A23-I25 VanDerWaalsContact C-N 3.32Å; A23-I25 PolarHBondContact O-N 3.07Å; I25-R28 PolarHBondContact O-N 3Å; I25-A29 WeakPolarHBondContact O-CB 3.39Å; I25-A29 PolarHBondContact O-N 3.38Å
26	K	93.9	Very high	90.1	Very high	144 Å²	144	105.6 Å²	105.6	63%	0.626	52%	0.516	S	S	*	.	H	α-helix	trans	-63.1	-41.4	176.7	-73.2	170.8	-175.1	172.7	0	111.7	Q22 A23 A29 K30	Q22-K26 WeakPolarHBondContact O-CB 3.45Å; Q22-K26 VanDerWaalsContact O-CG 3.28Å; Q22-K26 WeakPolarHBondContact O-CG 3.46Å; Q22-K26 PolarHBondContact O-N 2.97Å; A23-K26 PolarHBondContact O-N 3.34Å; A23-K26 VanDerWaalsContact O-N 3.17Å; K26-A29 PolarHBondContact O-N 3.06Å; K26-K30 WeakPolarHBondContact O-CB 3.44Å; K26-K30 PolarHBondContact O-N 3.33Å
27	E	96	Very high	91.5	Very high	133 Å²	133	96.3 Å²	96.3	62%	0.621	49%	0.486	S	S	*	.	H	α-helix	trans	-63	-46.6	175.5	-72.8	-174.8	171.3	0	0	112	A23 A24 A29 K30 I31	A23-E27 WeakPolarHBondContact O-CG 3.28Å; A23-E27 PolarHBondContact O-N 3.17Å; A24-E27 PolarHBondContact O-N 2.99Å; E27-A29 VanDerWaalsContact C-N 3.31Å; E27-A29 PolarHBondContact O-N 3.2Å; E27-K30 WeakPolarHBondContact O-CB 3.45Å; E27-K30 PolarHBondContact O-N 2.99Å; E27-I31 WeakPolarHBondContact O-CG1 3.34Å; E27-I31 PolarHBondContact O-N 2.86Å
28	R	93	Very high	92.2	Very high	172 Å²	172	98.2 Å²	98.2	65%	0.649	50%	0.496	S	S	*	.	H	α-helix	trans	-61.9	-38.4	175.3	-71.3	170.8	-176.2	170.3	3.4	112.2	A24 I25 R32	A24-R28 WeakPolarHBondContact O-CB 3.49Å; A24-R28 VanDerWaalsContact O-CG 3.25Å; A24-R28 WeakPolarHBondContact O-CG 3.48Å; A24-R28 PolarHBondContact O-N 3.37Å; I25-R28 PolarHBondContact O-N 3Å; R28-R32 WeakPolarHBondContact O-CB 3.38Å; R28-R32 PolarHBondContact O-N 3.42Å
29	A	95.3	Very high	92.5	Very high	31 Å²	31	101 Å²	101	26%	0.256	50%	0.499	S	S	.	.	H	α-helix	trans	-64.2	-44	175	0	0	0	0	0	111.2	I25 K26 E27 I31 R32 D33	I25-A29 WeakPolarHBondContact O-CB 3.39Å; I25-A29 PolarHBondContact O-N 3.38Å; K26-A29 PolarHBondContact O-N 3.06Å; E27-A29 VanDerWaalsContact C-N 3.31Å; E27-A29 PolarHBondContact O-N 3.2Å; A29-I31 PolarHBondContact O-N 2.88Å; A29-R32 WeakPolarHBondContact O-CB 3.41Å; A29-R32 PolarHBondContact O-N 3.4Å; A29-R32 VanDerWaalsContact O-N 3.17Å; A29-D33 PolarHBondContact O-N 3.02Å
30	K	97.3	Very high	92.7	Very high	163 Å²	163	102.6 Å²	102.6	71%	0.709	49%	0.491	S	S	*	.	H	α-helix	trans	-58.6	-45.2	176.3	-170.6	-177.4	179.7	-177.9	0	112.1	K26 E27 D33 A34	K26-K30 WeakPolarHBondContact O-CB 3.44Å; K26-K30 PolarHBondContact O-N 3.33Å; E27-K30 WeakPolarHBondContact O-CB 3.45Å; E27-K30 PolarHBondContact O-N 2.99Å; K30-D33 PolarHBondContact O-N 2.91Å; K30-A34 WeakPolarHBondContact O-CB 3.28Å; K30-A34 PolarHBondContact O-N 3.21Å
31	I	94.8	Very high	92.9	Very high	107 Å²	107	102.2 Å²	102.2	55%	0.549	49%	0.487	S	S	.	.	H	α-helix	trans	-62.1	-44.5	176.6	-65	165.8	0	0	0	110.5	E27 A29 D33 A34 M35	E27-I31 WeakPolarHBondContact O-CG1 3.34Å; E27-I31 PolarHBondContact O-N 2.86Å; A29-I31 PolarHBondContact O-N 2.88Å; I31-D33 PolarHBondContact O-N 3.48Å; I31-A34 PolarHBondContact O-N 2.89Å; I31-M35 HydrophobicContact CG2-CE 4.08Å; I31-M35 WeakPolarHBondContact O-CG 3.34Å; I31-M35 PolarHBondContact O-N 3.17Å; I31-M35 VanDerWaalsContact O-N 3.07Å
32	R	94.8	Very high	93	Very high	138 Å²	138	103.8 Å²	103.8	52%	0.521	49%	0.489	S	S	.	.	H	α-helix	trans	-61.1	-43.7	177.4	-171.8	-171.8	-59.6	141.1	1.6	112.2	R28 A29 M35 K36	R28-R32 WeakPolarHBondContact O-CB 3.38Å; R28-R32 PolarHBondContact O-N 3.42Å; A29-R32 WeakPolarHBondContact O-CB 3.41Å; A29-R32 PolarHBondContact O-N 3.4Å; A29-R32 VanDerWaalsContact O-N 3.17Å; R32-M35 PolarHBondContact O-N 3.28Å; R32-K36 HydrophobicContact CG-CD 4.47Å; R32-K36 WeakPolarHBondContact O-CG 3.45Å; R32-K36 PolarHBondContact O-N 3.1Å
33	D	96.7	Very high	93.1	Very high	87 Å²	87	107 Å²	107	47%	0.465	50%	0.499	S	S	.	.	H	α-helix	trans	-69.9	-35.4	-178.7	-72.2	-18.9	0	0	0	111.8	A29 K30 I31 K36 A37	A29-D33 PolarHBondContact O-N 3.02Å; K30-D33 PolarHBondContact O-N 2.91Å; I31-D33 PolarHBondContact O-N 3.48Å; D33-K36 PolarHBondContact O-N 3.49Å; D33-A37 WeakPolarHBondContact O-CB 3.25Å; D33-A37 PolarHBondContact O-N 3.13Å
34	A	95.3	Very high	93	Very high	52 Å²	52	109.6 Å²	109.6	43%	0.43	51%	0.51	S	S	.	.	H	α-helix	trans	-59.8	-50.3	170.9	0	0	0	0	0	111.6	K30 I31 K36 A37 E38	K30-A34 WeakPolarHBondContact O-CB 3.28Å; K30-A34 PolarHBondContact O-N 3.21Å; I31-A34 PolarHBondContact O-N 2.89Å; A34-K36 PolarHBondContact O-N 2.92Å; A34-A37 WeakPolarHBondContact O-CB 3.48Å; A34-A37 PolarHBondContact O-N 2.98Å; A34-A37 VanDerWaalsContact O-N 3.12Å; A34-E38 PolarHBondContact O-N 2.7Å
35	M	93.4	Very high	92.9	Very high	114 Å²	114	110.8 Å²	110.8	56%	0.562	51%	0.512	S	S	*	.	H	α-helix	trans	-61	-41.7	177.5	-68.4	-174.9	-63	0	0	112.3	I31 R32 A37 E38 Y39	I31-M35 HydrophobicContact CG2-CE 4.08Å; I31-M35 WeakPolarHBondContact O-CG 3.34Å; I31-M35 PolarHBondContact O-N 3.17Å; I31-M35 VanDerWaalsContact O-N 3.07Å; R32-M35 PolarHBondContact O-N 3.28Å; M35-A37 VanDerWaalsContact C-N 3.33Å; M35-A37 PolarHBondContact O-N 3.06Å; M35-E38 PolarHBondContact O-N 3.36Å; M35-Y39 PolarHBondContact O-N 3.23Å
36	K	94.7	Very high	92.9	Very high	111 Å²	111	112.2 Å²	112.2	48%	0.483	53%	0.525	S	S	.	.	H	α-helix	trans	-65	-35.8	175.1	-75.5	178.9	177.9	-179.5	0	112.6	R32 D33 A34 R40	R32-K36 HydrophobicContact CG-CD 4.47Å; R32-K36 WeakPolarHBondContact O-CG 3.45Å; R32-K36 PolarHBondContact O-N 3.1Å; D33-K36 PolarHBondContact O-N 3.49Å; A34-K36 PolarHBondContact O-N 2.92Å; K36-R40 WeakPolarHBondContact O-CB 3.25Å; K36-R40 WeakPolarHBondContact O-CG 3.46Å; K36-R40 PolarHBondContact O-N 2.85Å; K36-R40 PolarHBondContact O-NE 3.4Å
37	A	95.1	Very high	92.6	Very high	35 Å²	35	114.4 Å²	114.4	29%	0.289	54%	0.535	S	S	.	.	H	α-helix	trans	-66.5	-43.4	176.8	0	0	0	0	0	110.8	D33 A34 M35 R40 K41	D33-A37 WeakPolarHBondContact O-CB 3.25Å; D33-A37 PolarHBondContact O-N 3.13Å; A34-A37 WeakPolarHBondContact O-CB 3.48Å; A34-A37 PolarHBondContact O-N 2.98Å; A34-A37 VanDerWaalsContact O-N 3.12Å; M35-A37 VanDerWaalsContact C-N 3.33Å; M35-A37 PolarHBondContact O-N 3.06Å; A37-R40 PolarHBondContact O-N 3.22Å; A37-K41 WeakPolarHBondContact O-CG 3.38Å; A37-K41 PolarHBondContact O-N 3.26Å
38	E	91.1	Very high	92	Very high	114 Å²	114	113.4 Å²	113.4	53%	0.533	53%	0.534	S	S	.	.	H	α-helix	trans	-61.7	-45.9	174.8	-70.4	-177.7	179	0	0	112.4	A34 M35 R40 K41 R42	A34-E38 PolarHBondContact O-N 2.7Å; M35-E38 PolarHBondContact O-N 3.36Å; E38-R40 PolarHBondContact O-N 2.97Å; E38-K41 PolarHBondContact O-N 3.07Å; E38-R42 PolarHBondContact O-N 3.09Å; E38-R42 VanDerWaalsContact O-N 3.12Å
39	Y	91.1	Very high	91.4	Very high	123 Å²	123	109 Å²	109	48%	0.482	53%	0.528	S	S	.	.	H	α-helix	trans	-57.1	-49.2	175.8	178.8	-91.5	0	0	0	111.4	M35 K41 R42 Y43 L54	M35-Y39 PolarHBondContact O-N 3.23Å; Y39-K41 PolarHBondContact O-N 3.36Å; Y39-R42 PolarHBondContact O-N 3.27Å; Y39-Y43 HydrophobicContact CE1-CG 4.34Å; Y39-Y43 WeakPolarHBondContact O-CB 3.44Å; Y39-Y43 PolarHBondContact O-N 3.41Å; Y39-L54 HydrophobicContact CD2-CD2 3.54Å; Y39-L54 HydrophobicContact CE2-CD2 3.61Å; Y39-L54 HydrophobicContact CG-CD2 4.41Å
40	R	91.9	Very high	90.6	Very high	146 Å²	146	109.5 Å²	109.5	55%	0.551	53%	0.529	S	S	*	.	H	α-helix	trans	-59.8	-45.9	178.5	-77.4	-178.2	-72.4	-164.8	1.7	111.8	K36 A37 E38 R42 Y43 T44	K36-R40 WeakPolarHBondContact O-CB 3.25Å; K36-R40 WeakPolarHBondContact O-CG 3.46Å; K36-R40 PolarHBondContact O-N 2.85Å; K36-R40 PolarHBondContact O-NE 3.4Å; A37-R40 PolarHBondContact O-N 3.22Å; E38-R40 PolarHBondContact O-N 2.97Å; R40-R42 VanDerWaalsContact C-N 3.27Å; R40-R42 PolarHBondContact O-N 3.17Å; R40-Y43 PolarHBondContact O-N 2.93Å; R40-T44 PolarHBondContact O-N 3.26Å; R40-T44 PolarHBondContact O-OG1 3.49Å
41	K	91	Very high	89.8	Confident	156 Å²	156	109.9 Å²	109.9	68%	0.678	54%	0.536	S	S	*	.	H	α-helix	trans	-55.1	-41.6	177.1	-76.3	176.6	-178.9	-177.1	0	112.4	A37 E38 Y39 N45	A37-K41 WeakPolarHBondContact O-CG 3.38Å; A37-K41 PolarHBondContact O-N 3.26Å; E38-K41 PolarHBondContact O-N 3.07Å; Y39-K41 PolarHBondContact O-N 3.36Å; K41-N45 WeakPolarHBondContact O-CB 3.01Å
42	R	89.1	Confident	89.2	Confident	126 Å²	126	107.9 Å²	107.9	48%	0.475	54%	0.542	S	S	.	.	H	α-helix	trans	-74.3	-42.1	178.6	-65.8	-176.8	-173.7	-163.9	1.4	112	E38 Y39 R40 L54	E38-R42 PolarHBondContact O-N 3.09Å; E38-R42 VanDerWaalsContact O-N 3.12Å; Y39-R42 PolarHBondContact O-N 3.27Å; R40-R42 VanDerWaalsContact C-N 3.27Å; R40-R42 PolarHBondContact O-N 3.17Å; R42-L54 HydrophobicContact CB-CD1 3.94Å; R42-L54 HydrophobicContact CB-CD2 3.89Å
43	Y	89.6	Confident	88.7	Confident	142 Å²	142	110.6 Å²	110.6	56%	0.557	56%	0.56	S	S	*	*	H	α-helix	trans	-69.9	-40.8	-175.9	-173.9	-99.3	0	0	0	113.1	Y39 R40 P50	Y39-Y43 HydrophobicContact CE1-CG 4.34Å; Y39-Y43 WeakPolarHBondContact O-CB 3.44Å; Y39-Y43 PolarHBondContact O-N 3.41Å; R40-Y43 PolarHBondContact O-N 2.93Å; Y43-P50 HydrophobicContact CD2-CG 4.22Å
44	T	89.5	Confident	88.2	Confident	101 Å²	101	108.9 Å²	108.9	62%	0.62	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.6	9.5	-176.5	66.8	0	0	0	0	113.6	R40 P46	R40-T44 PolarHBondContact O-N 3.26Å; R40-T44 PolarHBondContact O-OG1 3.49Å; T44-P46 VanDerWaalsContact O-CD 3.27Å; T44-P46 WeakPolarHBondContact O-CD 2.99Å
45	N	89.2	Confident	87.9	Confident	60 Å²	60	111.6 Å²	111.6	32%	0.321	56%	0.555	S	S	.	*			trans	-76.5	114.6	-179.3	-176.2	-1.7	0	0	0	110.7	K41 F47 N48	K41-N45 WeakPolarHBondContact O-CB 3.01Å; N45-F47 VanDerWaalsContact C-N 3.3Å; N45-F47 PolarHBondContact O-N 3.02Å; N45-F47 PolarHBondContact OD1-N 3.42Å; N45-N48 CarbonylContact O-C 3.58Å
46	P	87.5	Confident	87.8	Confident	101 Å²	101	109.7 Å²	109.7	66%	0.656	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.1	-21.3	-178.8	29.5	-34.7	0	0	0	113.7	T44	T44-P46 VanDerWaalsContact O-CD 3.27Å; T44-P46 WeakPolarHBondContact O-CD 2.99Å
47	F	87.7	Confident	87.6	Confident	191 Å²	191	107.3 Å²	107.3	84%	0.838	54%	0.542	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.9	-18	-177.5	-59.6	-71.1	0	0	0	113.5	N45	N45-F47 VanDerWaalsContact C-N 3.3Å; N45-F47 PolarHBondContact O-N 3.02Å; N45-F47 PolarHBondContact OD1-N 3.42Å
48	N	84.8	Confident	87.5	Confident	112 Å²	112	108.6 Å²	108.6	60%	0.599	55%	0.553	S	S	*	*	S	Bend	trans	-139.4	70	175.5	-171	19.4	0	0	0	108.9	N45	N45-N48 CarbonylContact O-C 3.58Å
49	P	80.2	Confident	87.5	Confident	78 Å²	78	107.2 Å²	107.2	51%	0.506	55%	0.549	S	S	.	.			trans	-61.8	132.1	177.6	25.9	-32.2	0	0	0	108.6	I51	P49-I51 PolarHBondContact O-N 3.27Å
50	P	78.9	Confident	87.7	Confident	43 Å²	43	106.6 Å²	106.6	28%	0.279	55%	0.551	S	S	.	*			trans	-61.5	115.3	179.1	23.4	-31.3	0	0	0	109.6	Y43 G52 L54	Y43-P50 HydrophobicContact CD2-CG 4.22Å; P50-G52 PolarHBondContact O-N 2.85Å; P50-L54 HydrophobicContact CB-CD1 4.4Å
51	I	78.7	Confident	87.7	Confident	170 Å²	170	105.7 Å²	105.7	87%	0.872	55%	0.552	S	S	*	*			trans	-79.9	100.4	173.8	-56.7	172.2	0	0	0	106.9	P49	P49-I51 PolarHBondContact O-N 3.27Å
52	G	83.6	Confident	87.8	Confident	65 Å²	65	103.5 Å²	103.5	67%	0.67	54%	0.544	S	S	*	.	S	Bend	trans	85	-137.2	-178.1	0	0	0	0	0	113.3	P50	P50-G52 PolarHBondContact O-N 2.85Å
53	H	84.2	Confident	88.1	Confident	195 Å²	195	103.3 Å²	103.3	90%	0.903	55%	0.547	S	S	*	.	S	Bend	trans	-82.3	130.1	-177.6	-61.4	-59.6	0	0	0	111.2	H55	H53-H55 PolarHBondContact O-N 3.29Å
54	L	86.8	Confident	88.3	Confident	52 Å²	52	99.2 Å²	99.2	27%	0.272	54%	0.54	S	S	.	.	P	Polyproline II helix	trans	-66.4	126.8	172.8	-173.9	67.1	0	0	0	109.3	Y39 R42 P50 D56	Y39-L54 HydrophobicContact CD2-CD2 3.54Å; Y39-L54 HydrophobicContact CE2-CD2 3.61Å; Y39-L54 HydrophobicContact CG-CD2 4.41Å; R42-L54 HydrophobicContact CB-CD1 3.94Å; R42-L54 HydrophobicContact CB-CD2 3.89Å; P50-L54 HydrophobicContact CB-CD1 4.4Å; L54-D56 PolarHBondContact O-N 2.97Å
55	H	88.6	Confident	88.5	Confident	108 Å²	108	97 Å²	97	50%	0.5	53%	0.532	S	S	.	.	P	Polyproline II helix	trans	-60	120.2	175.1	177.7	-88.6	0	0	0	110.5	H53 Q60	H53-H55 PolarHBondContact O-N 3.29Å; H55-Q60 PolarHBondContact CE1-OE1 3.25Å; H55-Q60 PolarHBondContact NE2-OE1 2.92Å
56	D	90	Very high	88.6	Confident	75 Å²	75	99.8 Å²	99.8	40%	0.401	54%	0.543	S	S	.	.			trans	-108.6	111.8	172.8	-177.1	-6.5	0	0	0	109.2	L54 A58 L59 Q60	L54-D56 PolarHBondContact O-N 2.97Å; D56-A58 PolarHBondContact O-N 3.18Å; D56-A58 WeakPolarHBondContact OD1-CB 3.37Å; D56-A58 PolarHBondContact OD1-N 2.6Å; D56-L59 HydrophobicContact CB-CB 4.17Å; D56-L59 HydrophobicContact CB-CD1 4.04Å; D56-L59 HydrophobicContact CB-CG 4.13Å; D56-L59 PolarHBondContact O-N 3.39Å; D56-Q60 PolarHBondContact O-N 2.84Å; D56-Q60 VanDerWaalsContact O-N 3.09Å
57	P	92.3	Very high	88.8	Confident	60 Å²	60	101 Å²	101	39%	0.39	55%	0.548	S	S	.	.	H	α-helix	trans	-56.5	-35.6	176.7	-24.3	33.4	0	0	0	113	L59 Q60 H61	P57-L59 PolarHBondContact O-N 2.9Å; P57-Q60 PolarHBondContact O-N 3.34Å; P57-H61 WeakPolarHBondContact O-CB 3.17Å; P57-H61 PolarHBondContact O-CD2 3.03Å; P57-H61 PolarHBondContact O-N 3.13Å
58	A	91.6	Very high	89.1	Confident	62 Å²	62	93.2 Å²	93.2	51%	0.512	52%	0.517	S	S	.	.	H	α-helix	trans	-66.5	-41.1	-177.9	0	0	0	0	0	111.4	D56 H61 Q62	D56-A58 PolarHBondContact O-N 3.18Å; D56-A58 WeakPolarHBondContact OD1-CB 3.37Å; D56-A58 PolarHBondContact OD1-N 2.6Å; A58-H61 PolarHBondContact O-N 3.42Å; A58-Q62 PolarHBondContact O-N 2.92Å
59	L	92.1	Very high	89.3	Confident	86 Å²	86	95 Å²	95	45%	0.45	52%	0.516	S	S	.	.	H	α-helix	trans	-64.5	-44.4	173.3	-72.8	178.5	0	0	0	111.1	D56 P57 H61 Q62 F63	D56-L59 HydrophobicContact CB-CB 4.17Å; D56-L59 HydrophobicContact CB-CD1 4.04Å; D56-L59 HydrophobicContact CB-CG 4.13Å; D56-L59 PolarHBondContact O-N 3.39Å; P57-L59 PolarHBondContact O-N 2.9Å; L59-H61 VanDerWaalsContact C-N 3.32Å; L59-H61 PolarHBondContact O-N 3.07Å; L59-Q62 PolarHBondContact O-N 3.34Å; L59-F63 HydrophobicContact CB-CD2 4.44Å; L59-F63 HydrophobicContact CB-CE2 4.18Å; L59-F63 WeakPolarHBondContact O-CD2 3.48Å; L59-F63 PolarHBondContact O-N 2.84Å
60	Q	94	Very high	89.6	Confident	110 Å²	110	94.7 Å²	94.7	51%	0.514	52%	0.521	S	S	.	.	H	α-helix	trans	-58	-46	176.2	-175.6	-177.1	1.2	0	0	111.4	H55 D56 P57 Q62 F63 S64	H55-Q60 PolarHBondContact CE1-OE1 3.25Å; H55-Q60 PolarHBondContact NE2-OE1 2.92Å; D56-Q60 PolarHBondContact O-N 2.84Å; D56-Q60 VanDerWaalsContact O-N 3.09Å; P57-Q60 PolarHBondContact O-N 3.34Å; Q60-Q62 VanDerWaalsContact C-N 3.3Å; Q60-Q62 PolarHBondContact O-N 3.41Å; Q60-F63 PolarHBondContact O-N 3.45Å; Q60-S64 WeakPolarHBondContact O-CB 3.29Å; Q60-S64 PolarHBondContact O-N 3.24Å; Q60-S64 PolarHBondContact O-OG 3.21Å
61	H	93.2	Very high	90.1	Very high	127 Å²	127	100.1 Å²	100.1	59%	0.588	54%	0.543	S	S	*	.	H	α-helix	trans	-60.5	-40.3	177.3	-78.2	-63	0	0	0	112.1	P57 A58 L59 S64 A65	P57-H61 WeakPolarHBondContact O-CB 3.17Å; P57-H61 PolarHBondContact O-CD2 3.03Å; P57-H61 PolarHBondContact O-N 3.13Å; A58-H61 PolarHBondContact O-N 3.42Å; L59-H61 VanDerWaalsContact C-N 3.32Å; L59-H61 PolarHBondContact O-N 3.07Å; H61-S64 VanDerWaalsContact CA-OG 3.29Å; H61-S64 WeakPolarHBondContact CA-OG 3.47Å; H61-S64 PolarHBondContact O-N 3.26Å; H61-S64 PolarHBondContact O-OG 3.37Å; H61-A65 VanDerWaalsContact O-CB 3.28Å; H61-A65 WeakPolarHBondContact O-CB 3.42Å; H61-A65 PolarHBondContact O-N 3.15Å
62	Q	93.3	Very high	90.5	Very high	109 Å²	109	100.1 Å²	100.1	51%	0.509	53%	0.533	S	S	.	.	H	α-helix	trans	-64.3	-45.3	176.1	-178.5	178.1	-16.8	0	0	111.8	A58 L59 Q60 A65 Q66	A58-Q62 PolarHBondContact O-N 2.92Å; L59-Q62 PolarHBondContact O-N 3.34Å; Q60-Q62 VanDerWaalsContact C-N 3.3Å; Q60-Q62 PolarHBondContact O-N 3.41Å; Q62-A65 PolarHBondContact O-N 2.89Å; Q62-Q66 WeakPolarHBondContact O-CG 3.28Å; Q62-Q66 PolarHBondContact O-N 2.83Å; Q62-Q66 VanDerWaalsContact O-N 3.15Å
63	F	94.6	Very high	90.8	Very high	122 Å²	122	100.6 Å²	100.6	54%	0.535	52%	0.52	S	S	.	.	H	α-helix	trans	-64.5	-43	176.3	-70.2	-59	0	0	0	111.6	L59 Q60 A65 Q66 V67	L59-F63 HydrophobicContact CB-CD2 4.44Å; L59-F63 HydrophobicContact CB-CE2 4.18Å; L59-F63 WeakPolarHBondContact O-CD2 3.48Å; L59-F63 PolarHBondContact O-N 2.84Å; Q60-F63 PolarHBondContact O-N 3.45Å; F63-A65 VanDerWaalsContact C-N 3.3Å; F63-A65 PolarHBondContact O-N 2.81Å; F63-Q66 PolarHBondContact O-N 3.33Å; F63-V67 WeakPolarHBondContact O-CG2 3.44Å; F63-V67 PolarHBondContact O-N 3.14Å; F63-V67 VanDerWaalsContact O-N 3.14Å
64	S	94.1	Very high	91	Very high	57 Å²	57	101.4 Å²	101.4	40%	0.399	52%	0.515	S	S	.	.	H	α-helix	trans	-61.5	-40.2	176.7	63.1	0	0	0	0	111.6	Q60 H61 Q66 V67 S68	Q60-S64 WeakPolarHBondContact O-CB 3.29Å; Q60-S64 PolarHBondContact O-N 3.24Å; Q60-S64 PolarHBondContact O-OG 3.21Å; H61-S64 VanDerWaalsContact CA-OG 3.29Å; H61-S64 WeakPolarHBondContact CA-OG 3.47Å; H61-S64 PolarHBondContact O-N 3.26Å; H61-S64 PolarHBondContact O-OG 3.37Å; S64-Q66 VanDerWaalsContact C-N 3.31Å; S64-Q66 PolarHBondContact O-N 2.88Å; S64-V67 PolarHBondContact O-N 3.25Å; S64-S68 WeakPolarHBondContact O-CB 3.47Å; S64-S68 PolarHBondContact O-N 2.96Å; S64-S68 PolarHBondContact O-OG 3.27Å
65	A	93.3	Very high	91	Very high	55 Å²	55	105.4 Å²	105.4	46%	0.455	54%	0.544	S	S	.	.	H	α-helix	trans	-66.3	-31.2	178.8	0	0	0	0	0	113	H61 Q62 F63 Y69	H61-A65 VanDerWaalsContact O-CB 3.28Å; H61-A65 WeakPolarHBondContact O-CB 3.42Å; H61-A65 PolarHBondContact O-N 3.15Å; Q62-A65 PolarHBondContact O-N 2.89Å; F63-A65 VanDerWaalsContact C-N 3.3Å; F63-A65 PolarHBondContact O-N 2.81Å; A65-Y69 PolarHBondContact O-N 3.41Å
66	Q	91.8	Very high	91.1	Very high	117 Å²	117	102.8 Å²	102.8	55%	0.547	54%	0.537	S	S	.	.	H	α-helix	trans	-70.9	-40.6	174.4	-70.6	174.1	15.9	0	0	111.5	Q62 F63 S64 Y69	Q62-Q66 WeakPolarHBondContact O-CG 3.28Å; Q62-Q66 PolarHBondContact O-N 2.83Å; Q62-Q66 VanDerWaalsContact O-N 3.15Å; F63-Q66 PolarHBondContact O-N 3.33Å; S64-Q66 VanDerWaalsContact C-N 3.31Å; S64-Q66 PolarHBondContact O-N 2.88Å; Q66-Y69 WeakPolarHBondContact O-CB 3.3Å
67	V	92.1	Very high	91.2	Very high	127 Å²	127	104.4 Å²	104.4	77%	0.77	55%	0.552	S	S	*	*	H	α-helix	trans	-72.5	-42.4	-179.4	176.7	0	0	0	0	111.3	F63 S64 Y69	F63-V67 WeakPolarHBondContact O-CG2 3.44Å; F63-V67 PolarHBondContact O-N 3.14Å; F63-V67 VanDerWaalsContact O-N 3.14Å; S64-V67 PolarHBondContact O-N 3.25Å; V67-Y69 PolarHBondContact O-N 3.39Å
68	S	92.9	Very high	91.1	Very high	27 Å²	27	109.7 Å²	109.7	19%	0.189	57%	0.569	C	S	.	*	G	3₁₀ helix	trans	-78.4	2.3	178.5	64.9	0	0	0	0	113.9	S64 A70 E71 Y72	S64-S68 WeakPolarHBondContact O-CB 3.47Å; S64-S68 PolarHBondContact O-N 2.96Å; S64-S68 PolarHBondContact O-OG 3.27Å; S68-A70 PolarHBondContact O-N 3Å; S68-A70 VanDerWaalsContact O-N 3.09Å; S68-E71 WeakPolarHBondContact O-CB 3.33Å; S68-E71 PolarHBondContact O-N 3.09Å; S68-Y72 VanDerWaalsContact O-CD2 3.3Å; S68-Y72 WeakPolarHBondContact O-CD2 3.44Å
69	Y	88.3	Confident	91.1	Very high	149 Å²	149	110.2 Å²	110.2	58%	0.584	56%	0.563	S	S	*	*	G	3₁₀ helix	trans	-55.9	-32.9	-178	-171.8	-107.8	0	0	0	112.9	A65 Q66 V67 E71 Y72 L73	A65-Y69 PolarHBondContact O-N 3.41Å; Q66-Y69 WeakPolarHBondContact O-CB 3.3Å; V67-Y69 PolarHBondContact O-N 3.39Å; Y69-E71 VanDerWaalsContact C-N 3.27Å; Y69-E71 PolarHBondContact O-N 3.15Å; Y69-Y72 PolarHBondContact O-N 3.49Å; Y69-Y72 VanDerWaalsContact O-N 3.15Å; Y69-L73 HydrophobicContact CD1-CD1 4.48Å; Y69-L73 HydrophobicContact CD1-CD2 4.2Å; Y69-L73 HydrophobicContact CD1-CG 4.22Å; Y69-L73 HydrophobicContact CE1-CD2 3.55Å; Y69-L73 HydrophobicContact CE1-CG 4.08Å; Y69-L73 PolarHBondContact O-N 3.36Å
70	A	86.5	Confident	91.1	Very high	73 Å²	73	108 Å²	108	60%	0.603	56%	0.561	S	S	*	*	G	3₁₀ helix	trans	-61.1	-32.8	178.2	0	0	0	0	0	113.5	S68 Y72 L73	S68-A70 PolarHBondContact O-N 3Å; S68-A70 VanDerWaalsContact O-N 3.09Å; A70-Y72 PolarHBondContact O-N 3.41Å; A70-L73 PolarHBondContact O-N 3.38Å
71	E	89.4	Confident	91.1	Very high	157 Å²	157	108.7 Å²	108.7	73%	0.734	57%	0.568	S	S	*	*	G	3₁₀ helix	trans	-69.1	-26.1	179.1	-62.1	175.9	-171.4	0	0	112	S68 Y69	S68-E71 WeakPolarHBondContact O-CB 3.33Å; S68-E71 PolarHBondContact O-N 3.09Å; Y69-E71 VanDerWaalsContact C-N 3.27Å; Y69-E71 PolarHBondContact O-N 3.15Å
72	Y	88.9	Confident	91.2	Very high	170 Å²	170	107.8 Å²	107.8	67%	0.667	57%	0.566	S	S	*	*	G	3₁₀ helix	trans	-95.2	-2.7	-179.4	-59.9	-74.8	0	0	0	113.4	S68 Y69 A70 R74	S68-Y72 VanDerWaalsContact O-CD2 3.3Å; S68-Y72 WeakPolarHBondContact O-CD2 3.44Å; Y69-Y72 PolarHBondContact O-N 3.49Å; Y69-Y72 VanDerWaalsContact O-N 3.15Å; A70-Y72 PolarHBondContact O-N 3.41Å; Y72-R74 PolarHBondContact O-N 3.35Å; Y72-R74 VanDerWaalsContact O-N 3.1Å
73	L	88	Confident	91.2	Very high	75 Å²	75	104.8 Å²	104.8	39%	0.393	56%	0.56	S	S	.	*			trans	-70.2	106.5	177	-77.3	176.1	0	0	0	110.4	Y69 A70 L79	Y69-L73 HydrophobicContact CD1-CD1 4.48Å; Y69-L73 HydrophobicContact CD1-CD2 4.2Å; Y69-L73 HydrophobicContact CD1-CG 4.22Å; Y69-L73 HydrophobicContact CE1-CD2 3.55Å; Y69-L73 HydrophobicContact CE1-CG 4.08Å; Y69-L73 PolarHBondContact O-N 3.36Å; A70-L73 PolarHBondContact O-N 3.38Å; L73-L79 HydrophobicContact CD2-CD2 4.04Å
74	R	88.4	Confident	91.3	Very high	212 Å²	212	104.9 Å²	104.9	80%	0.8	57%	0.565	S	S	*	*			trans	-82.7	139.8	169.2	-68.3	-175.4	176.6	142.9	0.4	110.3	Y72 S76	Y72-R74 PolarHBondContact O-N 3.35Å; Y72-R74 VanDerWaalsContact O-N 3.1Å; R74-S76 PolarHBondContact O-N 3.15Å
75	P	87.3	Confident	91.4	Very high	136 Å²	136	103.9 Å²	103.9	88%	0.883	56%	0.564	S	S	*	*			trans	-59.2	115.4	172.2	25	-32	0	0	0	108.4
76	S	91.1	Very high	91.5	Very high	52 Å²	52	105.7 Å²	105.7	36%	0.364	57%	0.569	S	S	.	*			trans	-129.5	142.9	177.3	82.2	0	0	0	0	110.3	R74 K78 L79 G80	R74-S76 PolarHBondContact O-N 3.15Å; S76-K78 PolarHBondContact O-N 3.1Å; S76-L79 PolarHBondContact O-N 2.72Å; S76-L79 VanDerWaalsContact O-N 3.15Å; S76-L79 WeakPolarHBondContact OG-CB 3.38Å; S76-L79 PolarHBondContact OG-N 3.08Å; S76-L79 VanDerWaalsContact OG-N 3.1Å; S76-G80 PolarHBondContact O-N 3.47Å; S76-G80 VanDerWaalsContact O-N 3.08Å
77	P	91.4	Very high	91.7	Very high	110 Å²	110	106.1 Å²	106.1	71%	0.714	58%	0.575	S	S	*	*	H	α-helix	trans	-57.3	-36.3	176.6	-23.4	31.5	0	0	0	112.3	G80 L81	P77-G80 PolarHBondContact O-N 3.33Å; P77-L81 WeakPolarHBondContact O-CG 3.38Å; P77-L81 PolarHBondContact O-N 3.32Å
78	K	91.5	Very high	91.9	Very high	170 Å²	170	102 Å²	102	74%	0.739	56%	0.557	S	S	*	*	H	α-helix	trans	-62.4	-44.8	177.9	-64.8	-175.7	-179.4	-179.5	0	111.8	S76 G80 L81 I82	S76-K78 PolarHBondContact O-N 3.1Å; K78-G80 VanDerWaalsContact C-N 3.33Å; K78-L81 PolarHBondContact O-N 3.33Å; K78-I82 WeakPolarHBondContact O-CG1 3.33Å; K78-I82 PolarHBondContact O-N 3.27Å
79	L	90.8	Very high	92.1	Very high	73 Å²	73	105.1 Å²	105.1	38%	0.382	58%	0.576	S	S	.	*	H	α-helix	trans	-64.8	-40.5	177.2	-170.1	72.5	0	0	0	111	L73 S76 L81 I82 A83	L73-L79 HydrophobicContact CD2-CD2 4.04Å; S76-L79 PolarHBondContact O-N 2.72Å; S76-L79 VanDerWaalsContact O-N 3.15Å; S76-L79 WeakPolarHBondContact OG-CB 3.38Å; S76-L79 PolarHBondContact OG-N 3.08Å; S76-L79 VanDerWaalsContact OG-N 3.1Å; L79-L81 PolarHBondContact O-N 3.23Å; L79-I82 PolarHBondContact O-N 3.32Å; L79-A83 WeakPolarHBondContact O-CB 3.43Å; L79-A83 PolarHBondContact O-N 3.02Å
80	G	91.7	Very high	92.5	Very high	41 Å²	41	100.5 Å²	100.5	42%	0.423	57%	0.568	S	S	.	*	H	α-helix	trans	-59.6	-42.7	174.4	0	0	0	0	0	113	S76 P77 K78 A83 L84	S76-G80 PolarHBondContact O-N 3.47Å; S76-G80 VanDerWaalsContact O-N 3.08Å; P77-G80 PolarHBondContact O-N 3.33Å; K78-G80 VanDerWaalsContact C-N 3.33Å; G80-A83 PolarHBondContact O-N 3.01Å; G80-L84 WeakPolarHBondContact O-CB 3.37Å; G80-L84 PolarHBondContact O-N 3.08Å
81	L	95	Very high	93	Very high	123 Å²	123	98.6 Å²	98.6	64%	0.644	56%	0.556	S	S	*	*	H	α-helix	trans	-64.4	-41.2	175.7	-72.7	173.7	0	0	0	112.5	P77 K78 L79 L84 G85	P77-L81 WeakPolarHBondContact O-CG 3.38Å; P77-L81 PolarHBondContact O-N 3.32Å; K78-L81 PolarHBondContact O-N 3.33Å; L79-L81 PolarHBondContact O-N 3.23Å; L81-L84 PolarHBondContact O-N 2.81Å; L81-G85 PolarHBondContact O-N 3.44Å
82	I	95	Very high	93.3	Very high	109 Å²	109	96.1 Å²	96.1	56%	0.559	55%	0.547	S	S	*	.	H	α-helix	trans	-63.1	-46.8	175.1	-66.4	166.9	0	0	0	110	K78 L79 L84 G85 V86	K78-I82 WeakPolarHBondContact O-CG1 3.33Å; K78-I82 PolarHBondContact O-N 3.27Å; L79-I82 PolarHBondContact O-N 3.32Å; I82-L84 VanDerWaalsContact C-N 3.33Å; I82-L84 PolarHBondContact O-N 3.28Å; I82-G85 PolarHBondContact O-N 3.35Å; I82-V86 WeakPolarHBondContact O-CG2 3.15Å; I82-V86 PolarHBondContact O-N 3.41Å
83	A	93.5	Very high	93.7	Very high	45 Å²	45	90.8 Å²	90.8	37%	0.372	54%	0.538	S	S	.	.	H	α-helix	trans	-60.7	-42.7	178	0	0	0	0	0	111.7	L79 G80 G85 V86 L87	L79-A83 WeakPolarHBondContact O-CB 3.43Å; L79-A83 PolarHBondContact O-N 3.02Å; G80-A83 PolarHBondContact O-N 3.01Å; A83-G85 VanDerWaalsContact C-N 3.35Å; A83-V86 PolarHBondContact O-N 2.95Å; A83-L87 VanDerWaalsContact O-CB 3.28Å; A83-L87 WeakPolarHBondContact O-CB 3.43Å; A83-L87 WeakPolarHBondContact O-CG 3.44Å; A83-L87 PolarHBondContact O-N 2.9Å
84	L	95.4	Very high	94.1	Very high	125 Å²	125	94.4 Å²	94.4	65%	0.654	55%	0.554	S	S	*	*	H	α-helix	trans	-66.1	-36.3	175.7	-170	147.3	0	0	0	111.9	G80 L81 I82 G88	G80-L84 WeakPolarHBondContact O-CB 3.37Å; G80-L84 PolarHBondContact O-N 3.08Å; L81-L84 PolarHBondContact O-N 2.81Å; I82-L84 VanDerWaalsContact C-N 3.33Å; I82-L84 PolarHBondContact O-N 3.28Å; L84-G88 WeakPolarHBondContact O-CA 3.36Å; L84-G88 PolarHBondContact O-N 2.8Å
85	G	96.3	Very high	94.6	Very high	36 Å²	36	87.9 Å²	87.9	37%	0.371	54%	0.538	S	S	.	.	H	α-helix	trans	-62.2	-47.5	172.9	0	0	0	0	0	112.3	L81 I82 A83 T89	L81-G85 PolarHBondContact O-N 3.44Å; I82-G85 PolarHBondContact O-N 3.35Å; A83-G85 VanDerWaalsContact C-N 3.35Å; G85-T89 WeakPolarHBondContact O-CB 3.33Å; G85-T89 WeakPolarHBondContact O-CG2 3.48Å; G85-T89 PolarHBondContact O-N 3.25Å; G85-T89 PolarHBondContact O-OG1 3.32Å
86	V	96.2	Very high	95	Very high	92 Å²	92	85.6 Å²	85.6	56%	0.558	52%	0.518	S	S	*	.	H	α-helix	trans	-68.7	-49.7	179.9	176.6	0	0	0	0	111.4	I82 A83 T89 A90	I82-V86 WeakPolarHBondContact O-CG2 3.15Å; I82-V86 PolarHBondContact O-N 3.41Å; A83-V86 PolarHBondContact O-N 2.95Å; V86-T89 PolarHBondContact O-OG1 3.48Å; V86-A90 WeakPolarHBondContact O-CB 3.18Å; V86-A90 PolarHBondContact O-N 3.43Å; V86-A90 VanDerWaalsContact O-N 3.13Å
87	L	96.8	Very high	95.3	Very high	127 Å²	127	92.6 Å²	92.6	67%	0.665	54%	0.536	S	S	*	.	H	α-helix	trans	-70.3	-36.4	-180	-67.6	172.7	0	0	0	111.9	A83 A90 G91	A83-L87 VanDerWaalsContact O-CB 3.28Å; A83-L87 WeakPolarHBondContact O-CB 3.43Å; A83-L87 WeakPolarHBondContact O-CG 3.44Å; A83-L87 PolarHBondContact O-N 2.9Å; L87-A90 PolarHBondContact O-N 2.83Å; L87-G91 PolarHBondContact O-N 3.46Å
88	G	96	Very high	95.5	Very high	39 Å²	39	89 Å²	89	40%	0.402	52%	0.519	S	S	.	.	H	α-helix	trans	-66.2	-42.7	177.6	0	0	0	0	0	112.3	L84 G91 L92	L84-G88 WeakPolarHBondContact O-CA 3.36Å; L84-G88 PolarHBondContact O-N 2.8Å; G88-G91 PolarHBondContact O-N 3.13Å; G88-L92 VanDerWaalsContact O-CB 3.27Å; G88-L92 WeakPolarHBondContact O-CB 3.34Å; G88-L92 PolarHBondContact O-N 3.01Å
89	T	96.3	Very high	95.6	Very high	94 Å²	94	89.6 Å²	89.6	58%	0.577	52%	0.516	S	S	*	.	H	α-helix	trans	-65.2	-42.8	174.7	52	0	0	0	0	111.8	G85 V86 L92 A93	G85-T89 WeakPolarHBondContact O-CB 3.33Å; G85-T89 WeakPolarHBondContact O-CG2 3.48Å; G85-T89 PolarHBondContact O-N 3.25Å; G85-T89 PolarHBondContact O-OG1 3.32Å; V86-T89 PolarHBondContact O-OG1 3.48Å; T89-L92 PolarHBondContact O-N 3.01Å; T89-A93 WeakPolarHBondContact O-CB 3.28Å; T89-A93 PolarHBondContact O-N 3.49Å
90	A	96.7	Very high	95.7	Very high	52 Å²	52	90.5 Å²	90.5	43%	0.43	52%	0.521	S	S	.	.	H	α-helix	trans	-62.2	-45.4	174.6	0	0	0	0	0	112.2	V86 L87 A93 M94	V86-A90 WeakPolarHBondContact O-CB 3.18Å; V86-A90 PolarHBondContact O-N 3.43Å; V86-A90 VanDerWaalsContact O-N 3.13Å; L87-A90 PolarHBondContact O-N 2.83Å; A90-A93 PolarHBondContact O-N 2.96Å; A90-M94 PolarHBondContact O-N 3.44Å
91	G	97.1	Very high	95.6	Very high	33 Å²	33	95.3 Å²	95.3	34%	0.34	53%	0.53	S	S	.	.	H	α-helix	trans	-61.9	-43.7	176.5	0	0	0	0	0	112.3	L87 G88 A93 M94 V95	L87-G91 PolarHBondContact O-N 3.46Å; G88-G91 PolarHBondContact O-N 3.13Å; G91-A93 PolarHBondContact O-N 3.17Å; G91-M94 PolarHBondContact O-N 3.42Å; G91-V95 WeakPolarHBondContact O-CG2 3.42Å; G91-V95 PolarHBondContact O-N 2.86Å
92	L	97	Very high	95.5	Very high	105 Å²	105	96.7 Å²	96.7	55%	0.55	53%	0.531	S	S	.	.	H	α-helix	trans	-61.8	-43.8	176	-176.9	63.2	0	0	0	111.4	G88 T89 M94 V95 I96	G88-L92 VanDerWaalsContact O-CB 3.27Å; G88-L92 WeakPolarHBondContact O-CB 3.34Å; G88-L92 PolarHBondContact O-N 3.01Å; T89-L92 PolarHBondContact O-N 3.01Å; L92-M94 VanDerWaalsContact C-N 3.32Å; L92-M94 PolarHBondContact O-N 2.74Å; L92-V95 PolarHBondContact O-N 2.83Å; L92-I96 HydrophobicContact CD1-CD1 4.21Å; L92-I96 HydrophobicContact CD1-CG1 4.4Å; L92-I96 HydrophobicContact CG-CD1 3.9Å; L92-I96 HydrophobicContact CG-CG1 4.48Å; L92-I96 VanDerWaalsContact O-CG1 3.31Å; L92-I96 WeakPolarHBondContact O-CG1 3.41Å; L92-I96 PolarHBondContact O-N 3.36Å
93	A	97	Very high	95.2	Very high	57 Å²	57	99.6 Å²	99.6	47%	0.471	54%	0.535	S	S	.	.	H	α-helix	trans	-60.2	-41.6	176	0	0	0	0	0	111.8	T89 A90 G91 I96 R97	T89-A93 WeakPolarHBondContact O-CB 3.28Å; T89-A93 PolarHBondContact O-N 3.49Å; A90-A93 PolarHBondContact O-N 2.96Å; G91-A93 PolarHBondContact O-N 3.17Å; A93-I96 PolarHBondContact O-N 2.88Å; A93-R97 WeakPolarHBondContact O-CB 3.48Å; A93-R97 PolarHBondContact O-N 3.29Å
94	M	96.7	Very high	94.8	Very high	151 Å²	151	104.2 Å²	104.2	74%	0.744	54%	0.543	S	S	*	.	H	α-helix	trans	-63.1	-43.3	174.7	-74.6	-164	177.5	0	0	112.3	A90 G91 L92 R97 G98	A90-M94 PolarHBondContact O-N 3.44Å; G91-M94 PolarHBondContact O-N 3.42Å; L92-M94 VanDerWaalsContact C-N 3.32Å; L92-M94 PolarHBondContact O-N 2.74Å; M94-R97 PolarHBondContact O-N 3.06Å; M94-G98 PolarHBondContact O-N 3.48Å
95	V	97.2	Very high	94.4	Very high	76 Å²	76	102.9 Å²	102.9	46%	0.461	54%	0.536	S	S	.	.	H	α-helix	trans	-64.2	-45.4	178.1	171.5	0	0	0	0	111.2	G91 L92 G98 R99	G91-V95 WeakPolarHBondContact O-CG2 3.42Å; G91-V95 PolarHBondContact O-N 2.86Å; L92-V95 PolarHBondContact O-N 2.83Å; V95-G98 PolarHBondContact O-N 3.32Å; V95-R99 WeakPolarHBondContact O-CG 3.35Å; V95-R99 PolarHBondContact O-N 2.95Å
96	I	97	Very high	94	Very high	88 Å²	88	108 Å²	108	45%	0.451	55%	0.55	S	S	.	*	H	α-helix	trans	-59.7	-49.2	176.8	-69.4	168.7	0	0	0	110	L92 A93 G98 R99 L100	L92-I96 HydrophobicContact CD1-CD1 4.21Å; L92-I96 HydrophobicContact CD1-CG1 4.4Å; L92-I96 HydrophobicContact CG-CD1 3.9Å; L92-I96 HydrophobicContact CG-CG1 4.48Å; L92-I96 VanDerWaalsContact O-CG1 3.31Å; L92-I96 WeakPolarHBondContact O-CG1 3.41Å; L92-I96 PolarHBondContact O-N 3.36Å; A93-I96 PolarHBondContact O-N 2.88Å; I96-G98 VanDerWaalsContact C-N 3.29Å; I96-G98 PolarHBondContact O-N 3.37Å; I96-R99 PolarHBondContact O-N 2.89Å; I96-L100 HydrophobicContact CG2-CD1 3.92Å; I96-L100 HydrophobicContact CG2-CG 4.36Å; I96-L100 WeakPolarHBondContact O-CG 3.38Å; I96-L100 PolarHBondContact O-N 3.29Å
97	R	95.9	Very high	93.4	Very high	199 Å²	199	106.9 Å²	106.9	75%	0.751	54%	0.539	S	S	*	.	H	α-helix	trans	-58.7	-41	177.1	-175	177.9	168.3	94.2	-1.6	111.8	A93 M94 L100 K101	A93-R97 WeakPolarHBondContact O-CB 3.48Å; A93-R97 PolarHBondContact O-N 3.29Å; M94-R97 PolarHBondContact O-N 3.06Å; R97-L100 PolarHBondContact O-N 3.08Å; R97-K101 WeakPolarHBondContact O-CB 3.18Å; R97-K101 PolarHBondContact O-N 3.34Å
98	G	95.5	Very high	92.6	Very high	34 Å²	34	104.3 Å²	104.3	35%	0.351	52%	0.521	S	S	.	.	H	α-helix	trans	-62.2	-44.1	175.5	0	0	0	0	0	113	M94 V95 I96 K101 K102	M94-G98 PolarHBondContact O-N 3.48Å; V95-G98 PolarHBondContact O-N 3.32Å; I96-G98 VanDerWaalsContact C-N 3.29Å; I96-G98 PolarHBondContact O-N 3.37Å; G98-K101 PolarHBondContact O-N 3.48Å; G98-K102 WeakPolarHBondContact O-CG 3.5Å; G98-K102 PolarHBondContact O-N 2.93Å
99	R	95	Very high	91.9	Very high	183 Å²	183	105.9 Å²	105.9	69%	0.691	54%	0.537	S	S	*	.	H	α-helix	trans	-65.3	-43.6	176.5	-73.3	-175.7	179.2	178.1	0.4	112.3	V95 I96 K101 K102 R103	V95-R99 WeakPolarHBondContact O-CG 3.35Å; V95-R99 PolarHBondContact O-N 2.95Å; I96-R99 PolarHBondContact O-N 2.89Å; R99-K101 VanDerWaalsContact C-N 3.31Å; R99-K101 PolarHBondContact O-N 3.15Å; R99-K102 PolarHBondContact O-N 3.1Å; R99-R103 PolarHBondContact O-N 3.24Å
100	L	92.6	Very high	91.3	Very high	92 Å²	92	104.2 Å²	104.2	48%	0.482	54%	0.539	S	S	.	.	H	α-helix	trans	-62.2	-38.9	176	-69.2	173.5	0	0	0	111.9	I96 R97 R104	I96-L100 HydrophobicContact CG2-CD1 3.92Å; I96-L100 HydrophobicContact CG2-CG 4.36Å; I96-L100 WeakPolarHBondContact O-CG 3.38Å; I96-L100 PolarHBondContact O-N 3.29Å; R97-L100 PolarHBondContact O-N 3.08Å; L100-R104 PolarHBondContact O-N 2.99Å
101	K	90.4	Very high	90.4	Very high	141 Å²	141	104.6 Å²	104.6	61%	0.613	55%	0.547	S	S	*	.	H	α-helix	trans	-65	-43.3	175.1	-171.2	179	178.2	-176.9	0	111.6	R97 G98 R99 R104 L105	R97-K101 WeakPolarHBondContact O-CB 3.18Å; R97-K101 PolarHBondContact O-N 3.34Å; G98-K101 PolarHBondContact O-N 3.48Å; R99-K101 VanDerWaalsContact C-N 3.31Å; R99-K101 PolarHBondContact O-N 3.15Å; K101-R104 PolarHBondContact O-N 3.46Å; K101-L105 HydrophobicContact CG-CD1 4.14Å; K101-L105 WeakPolarHBondContact O-CD1 3.49Å; K101-L105 WeakPolarHBondContact O-CG 3.27Å; K101-L105 PolarHBondContact O-N 3.06Å
102	K	92.4	Very high	89.3	Confident	152 Å²	152	110.5 Å²	110.5	66%	0.661	57%	0.566	S	S	*	*	H	α-helix	trans	-63.2	-43.4	176.8	-74.1	-177.1	179.4	-173.5	0	112.2	G98 R99 L105 Q106	G98-K102 WeakPolarHBondContact O-CG 3.5Å; G98-K102 PolarHBondContact O-N 2.93Å; R99-K102 PolarHBondContact O-N 3.1Å; K102-L105 PolarHBondContact O-N 2.94Å; K102-Q106 WeakPolarHBondContact O-CG 3.44Å; K102-Q106 PolarHBondContact O-N 3.25Å
103	R	88.4	Confident	88.1	Confident	171 Å²	171	107.6 Å²	107.6	65%	0.645	55%	0.551	S	S	*	*	H	α-helix	trans	-58.6	-50.5	174.5	-84.1	-173.3	164.1	-171.9	-5.7	112	R99 L105 Q106 E107	R99-R103 PolarHBondContact O-N 3.24Å; R103-L105 VanDerWaalsContact C-N 3.27Å; R103-L105 PolarHBondContact O-N 3.31Å; R103-Q106 WeakPolarHBondContact O-CB 3.37Å; R103-Q106 PolarHBondContact O-N 3.38Å; R103-E107 WeakPolarHBondContact O-CB 3.46Å; R103-E107 PolarHBondContact O-N 2.93Å
104	R	84.8	Confident	86.9	Confident	141 Å²	141	108.7 Å²	108.7	53%	0.532	55%	0.552	S	S	.	*	H	α-helix	trans	-58.7	-36.7	175.7	-80.5	-162.9	-82.2	-168.3	-7.8	113.6	L100 K101 E107 Y108	L100-R104 PolarHBondContact O-N 2.99Å; K101-R104 PolarHBondContact O-N 3.46Å; R104-E107 WeakPolarHBondContact O-CB 3.36Å; R104-Y108 HydrophobicContact CB-CE2 4.38Å; R104-Y108 WeakPolarHBondContact O-CD1 3.38Å; R104-Y108 WeakPolarHBondContact O-CD2 3.31Å; R104-Y108 PolarHBondContact O-N 3.49Å
105	L	86.6	Confident	85.7	Confident	98 Å²	98	109.6 Å²	109.6	51%	0.513	55%	0.548	S	S	.	.	H	α-helix	trans	-66.4	-37.6	175.4	-78.6	160.9	0	0	0	112.6	K101 K102 R103 Y108 G109	K101-L105 HydrophobicContact CG-CD1 4.14Å; K101-L105 WeakPolarHBondContact O-CD1 3.49Å; K101-L105 WeakPolarHBondContact O-CG 3.27Å; K101-L105 PolarHBondContact O-N 3.06Å; K102-L105 PolarHBondContact O-N 2.94Å; R103-L105 VanDerWaalsContact C-N 3.27Å; R103-L105 PolarHBondContact O-N 3.31Å; L105-Y108 HydrophobicContact CD2-CD2 4.48Å; L105-Y108 PolarHBondContact O-N 3.42Å; L105-G109 PolarHBondContact O-N 3.17Å; L105-G109 VanDerWaalsContact O-N 3.11Å
106	Q	87.5	Confident	84.5	Confident	143 Å²	143	114 Å²	114	67%	0.668	56%	0.557	S	S	*	*	H	α-helix	trans	-66.2	-47.5	175.9	-72	174.8	-27.1	0	0	111.2	K102 R103 Y108 G109 G110	K102-Q106 WeakPolarHBondContact O-CG 3.44Å; K102-Q106 PolarHBondContact O-N 3.25Å; R103-Q106 WeakPolarHBondContact O-CB 3.37Å; R103-Q106 PolarHBondContact O-N 3.38Å; Q106-Y108 VanDerWaalsContact C-N 3.27Å; Q106-Y108 PolarHBondContact O-N 2.95Å; Q106-G109 CarbonylContact O-C 3.5Å; Q106-G109 PolarHBondContact O-N 3.44Å; Q106-G110 PolarHBondContact O-N 3.34Å
107	E	84.1	Confident	83.5	Confident	69 Å²	69	115.1 Å²	115.1	32%	0.322	56%	0.56	S	S	.	*	H	α-helix	trans	-51.3	-41.4	170.9	-92.2	166.8	-142.6	0	0	112.7	R103 R104 G111 E112 L113	R103-E107 WeakPolarHBondContact O-CB 3.46Å; R103-E107 PolarHBondContact O-N 2.93Å; R104-E107 WeakPolarHBondContact O-CB 3.36Å; E107-G111 PolarHBondContact O-N 2.89Å; E107-E112 PolarHBondContact O-N 3.22Å; E107-L113 HydrophobicContact CB-CD1 3.42Å; E107-L113 VanDerWaalsContact CB-CD1 3.42Å; E107-L113 HydrophobicContact CG-CD1 3.88Å; E107-L113 WeakPolarHBondContact OE2-CD1 3.49Å
108	Y	81.2	Confident	82.3	Confident	72 Å²	72	110.2 Å²	110.2	28%	0.282	54%	0.541	S	S	.	.	H	α-helix	trans	-69	-34.1	174.3	-62.5	-28.1	0	0	0	114.1	R104 L105 Q106 L113 R118	R104-Y108 HydrophobicContact CB-CE2 4.38Å; R104-Y108 WeakPolarHBondContact O-CD1 3.38Å; R104-Y108 WeakPolarHBondContact O-CD2 3.31Å; R104-Y108 PolarHBondContact O-N 3.49Å; L105-Y108 HydrophobicContact CD2-CD2 4.48Å; L105-Y108 PolarHBondContact O-N 3.42Å; Q106-Y108 VanDerWaalsContact C-N 3.27Å; Q106-Y108 PolarHBondContact O-N 2.95Å; Y108-L113 HydrophobicContact CD1-CD1 4.27Å; Y108-L113 HydrophobicContact CE1-CD1 4.33Å; Y108-R118 HydrophobicContact CD1-CG 4.14Å; Y108-R118 HydrophobicContact CE1-CB 4.37Å; Y108-R118 HydrophobicContact CE1-CG 3.85Å; Y108-R118 PolarHBondContact O-NH2 2.86Å
109	G	81.5	Confident	81	Confident	73 Å²	73	117.5 Å²	117.5	75%	0.753	56%	0.559	S	S	*	*	H	α-helix	trans	-78.1	-31.2	178.1	0	0	0	0	0	113.4	L105 Q106 G111	L105-G109 PolarHBondContact O-N 3.17Å; L105-G109 VanDerWaalsContact O-N 3.11Å; Q106-G109 CarbonylContact O-C 3.5Å; Q106-G109 PolarHBondContact O-N 3.44Å; G109-G111 VanDerWaalsContact C-N 3.31Å
110	G	83.5	Confident	79.6	Confident	59 Å²	59	110.5 Å²	110.5	61%	0.608	54%	0.543	S	S	*	.	H	α-helix	trans	-79.1	-9	178.9	0	0	0	0	0	114.7	Q106 E112	Q106-G110 PolarHBondContact O-N 3.34Å; G110-E112 PolarHBondContact O-N 3.42Å
111	G	76	Confident	78.2	Confident	59 Å²	59	108 Å²	108	61%	0.608	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	73.8	11.1	-179.2	0	0	0	0	0	114.4	E107 G109 L113	E107-G111 PolarHBondContact O-N 2.89Å; G109-G111 VanDerWaalsContact C-N 3.31Å; G111-L113 VanDerWaalsContact C-N 3.33Å; G111-L113 PolarHBondContact O-N 3.26Å
112	E	75.4	Confident	76.6	Confident	158 Å²	158	105.1 Å²	105.1	74%	0.738	53%	0.531	S	S	*	.			trans	-74.2	-22.5	-177.1	-64.8	-178.3	165.9	0	0	112.9	E107 G110	E107-E112 PolarHBondContact O-N 3.22Å; G110-E112 PolarHBondContact O-N 3.42Å
113	L	71.8	Confident	75.2	Confident	44 Å²	44	102.9 Å²	102.9	23%	0.23	53%	0.53	C	S	.	.	S	Bend	trans	-97.6	130.5	173.2	-82.4	112.5	0	0	0	112.6	E107 Y108 G111 E117	E107-L113 HydrophobicContact CB-CD1 3.42Å; E107-L113 VanDerWaalsContact CB-CD1 3.42Å; E107-L113 HydrophobicContact CG-CD1 3.88Å; E107-L113 WeakPolarHBondContact OE2-CD1 3.49Å; Y108-L113 HydrophobicContact CD1-CD1 4.27Å; Y108-L113 HydrophobicContact CE1-CD1 4.33Å; G111-L113 VanDerWaalsContact C-N 3.33Å; G111-L113 PolarHBondContact O-N 3.26Å; L113-E117 HydrophobicContact CD2-CB 3.8Å
114	T	71	Confident	73.7	Confident	80 Å²	80	106.2 Å²	106.2	49%	0.491	54%	0.543	S	S	.	.			trans	-63.6	147.6	171.5	63.1	0	0	0	0	110.7	R116 E117 R118	T114-R116 PolarHBondContact O-N 2.98Å; T114-R116 VanDerWaalsContact O-N 3.08Å; T114-E117 PolarHBondContact N-OE2 3Å; T114-E117 PolarHBondContact O-N 3.24Å; T114-E117 VanDerWaalsContact OG1-CD 3.3Å; T114-E117 WeakPolarHBondContact OG1-CG 3.45Å; T114-E117 PolarHBondContact OG1-OE2 3.38Å; T114-R118 PolarHBondContact O-N 3.02Å
115	Y	71.6	Confident	71.6	Confident	170 Å²	170	109.5 Å²	109.5	67%	0.667	57%	0.57	S	S	*	*	H	α-helix	trans	-55.5	-31.5	-179.6	-166.6	-92.9	0	0	0	112.4	R118 W119	Y115-R118 PolarHBondContact O-N 2.97Å; Y115-W119 AromaticContact CE1-CD1 3.63Å; Y115-W119 AromaticContact CE1-NE1 3.69Å; Y115-W119 AromaticContact CE2-NE1 3.86Å; Y115-W119 AromaticContact CZ-CD1 3.79Å; Y115-W119 AromaticContact CZ-NE1 3.36Å; Y115-W119 PolarHBondContact OH-NE1 3.48Å
116	R	73.1	Confident	70.8	Confident	168 Å²	168	110.1 Å²	110.1	63%	0.634	57%	0.573	S	S	*	*	H	α-helix	trans	-63.2	-40.5	176.6	-171.5	179	-176.2	172.2	6	112.8	T114 G121 N122	T114-R116 PolarHBondContact O-N 2.98Å; T114-R116 VanDerWaalsContact O-N 3.08Å; R116-G121 WeakPolarHBondContact O-CA 3.43Å; R116-G121 PolarHBondContact O-N 2.92Å; R116-N122 VanDerWaalsContact CZ-OD1 3.25Å; R116-N122 PolarHBondContact NE-OD1 3Å; R116-N122 VanDerWaalsContact NE-OD1 3.08Å; R116-N122 PolarHBondContact NH2-ND2 3.01Å; R116-N122 PolarHBondContact NH2-OD1 3.05Å
117	E	75	Confident	70	Confident	111 Å²	111	108.4 Å²	108.4	52%	0.519	57%	0.568	S	S	.	*	H	α-helix	trans	-76.4	-29.9	-179.6	-69.6	164.4	144.4	0	0	112.1	L113 T114 W119 G120	L113-E117 HydrophobicContact CD2-CB 3.8Å; T114-E117 PolarHBondContact N-OE2 3Å; T114-E117 PolarHBondContact O-N 3.24Å; T114-E117 VanDerWaalsContact OG1-CD 3.3Å; T114-E117 WeakPolarHBondContact OG1-CG 3.45Å; T114-E117 PolarHBondContact OG1-OE2 3.38Å; E117-W119 VanDerWaalsContact C-N 3.31Å; E117-W119 PolarHBondContact O-N 2.89Å; E117-G120 PolarHBondContact O-N 3.37Å
118	R	69.9	Low	69.2	Low	96 Å²	96	110.6 Å²	110.6	36%	0.362	58%	0.581	S	S	.	*	H	α-helix	trans	-61.9	-34.8	179.5	-171.6	179.3	-65.2	-163	-2.8	113.6	Y108 T114 Y115	Y108-R118 HydrophobicContact CD1-CG 4.14Å; Y108-R118 HydrophobicContact CE1-CB 4.37Å; Y108-R118 HydrophobicContact CE1-CG 3.85Å; Y108-R118 PolarHBondContact O-NH2 2.86Å; T114-R118 PolarHBondContact O-N 3.02Å; Y115-R118 PolarHBondContact O-N 2.97Å
119	W	69.9	Low	68.5	Low	188 Å²	188	112.8 Å²	112.8	71%	0.712	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.2	14.6	-178.4	-73	96.3	0	0	0	113.8	Y115 E117	Y115-W119 AromaticContact CE1-CD1 3.63Å; Y115-W119 AromaticContact CE1-NE1 3.69Å; Y115-W119 AromaticContact CE2-NE1 3.86Å; Y115-W119 AromaticContact CZ-CD1 3.79Å; Y115-W119 AromaticContact CZ-NE1 3.36Å; Y115-W119 PolarHBondContact OH-NE1 3.48Å; E117-W119 VanDerWaalsContact C-N 3.31Å; E117-W119 PolarHBondContact O-N 2.89Å
120	G	64.2	Low	67.6	Low	35 Å²	35	115.3 Å²	115.3	36%	0.361	59%	0.589	S	S	.	*			trans	84.5	70.5	178.8	0	0	0	0	0	111.2	E117 N122 T123	E117-G120 PolarHBondContact O-N 3.37Å; G120-N122 PolarHBondContact O-N 2.83Å; G120-T123 WeakPolarHBondContact O-CG2 3.45Å; G120-T123 PolarHBondContact O-N 3.28Å; G120-T123 PolarHBondContact O-OG1 3.11Å
121	G	63.4	Low	66.6	Low	39 Å²	39	119.1 Å²	119.1	40%	0.402	59%	0.588	S	S	.	*	T	Hydrogen-bonded Turn	trans	-37.2	130.4	179.7	0	0	0	0	0	113	R116 T123	R116-G121 WeakPolarHBondContact O-CA 3.43Å; R116-G121 PolarHBondContact O-N 2.92Å; G121-T123 PolarHBondContact O-N 3.48Å
122	N	58.2	Low	65.9	Low	82 Å²	82	123.4 Å²	123.4	44%	0.439	59%	0.587	S	S	.	*	T	Hydrogen-bonded Turn	trans	42	57.3	177.8	-54.7	6.6	0	0	0	115.2	R116 G120 W124	R116-N122 VanDerWaalsContact CZ-OD1 3.25Å; R116-N122 PolarHBondContact NE-OD1 3Å; R116-N122 VanDerWaalsContact NE-OD1 3.08Å; R116-N122 PolarHBondContact NH2-ND2 3.01Å; R116-N122 PolarHBondContact NH2-OD1 3.05Å; G120-N122 PolarHBondContact O-N 2.83Å; N122-W124 PolarHBondContact O-N 3.04Å; N122-W124 VanDerWaalsContact O-N 3.15Å
123	T	62.1	Low	65.2	Low	105 Å²	105	120.7 Å²	120.7	64%	0.644	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.8	20.5	163.3	46.9	0	0	0	0	113.9	G120 G121	G120-T123 WeakPolarHBondContact O-CG2 3.45Å; G120-T123 PolarHBondContact O-N 3.28Å; G120-T123 PolarHBondContact O-OG1 3.11Å; G121-T123 PolarHBondContact O-N 3.48Å
124	W	56.3	Low	64.6	Low	240 Å²	240	127.1 Å²	127.1	91%	0.909	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-131.5	19.5	-179	-63.6	95.5	0	0	0	113.8	N122	N122-W124 PolarHBondContact O-N 3.04Å; N122-W124 VanDerWaalsContact O-N 3.15Å
125	L	41	Very low	64.1	Low	211 Å²	211	131.4 Å²	131.4	100%	1.105	61%	0.614	S	S	*	*			trans	-131.7	0	166.9	-76.5	169	0	0	0	108.7

Retrieved 125 of 125 residues in 22.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).