G4VQH5_SCHMA Loading...

Huntingtin interacting protein-related

AlphaFold DB , UniProt , Accession G4VQH5, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 107 aa.

						>G4VQH5_SCHMA|G4VQH5
MTEDPEDNEKPKKPTTHDERGAADLERVTDYFEEKELSVGLDAVKAVSDTAGDADKAQKQKQMLKIKVKNEDVSLICQELEVSKLTAERYLKEHQGNVFETLVALCK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.8	Very low	51.2	Low	238 Å²	238	157.3 Å²	157.3	100%	1.172	82%	0.816	S	S	*	*				0	101.5	0	-80.6	165.3	138.9	0	0	104.8	E3	M1-E3 PolarHBondContact O-N 2.89Å
2	T	48.7	Very low	52.4	Low	148 Å²	148	160.8 Å²	160.8	91%	0.908	82%	0.82	S	S	*	*			trans	-86.6	107.8	-174.3	-44.9	0	0	0	0	106.6
3	E	44	Very low	53.8	Low	185 Å²	185	163.2 Å²	163.2	86%	0.864	82%	0.821	S	S	*	*			trans	-76.8	117	175.1	-62.8	177.5	153.9	0	0	107.8	M1	M1-E3 PolarHBondContact O-N 2.89Å
4	D	52.9	Low	54.9	Low	148 Å²	148	154.6 Å²	154.6	79%	0.791	78%	0.783	S	S	*	*			trans	-79.9	123.4	173.4	-160.1	-18.8	0	0	0	108	E6	D4-E6 PolarHBondContact O-N 3.4Å
5	P	52.9	Low	56.1	Low	110 Å²	110	152.3 Å²	152.3	71%	0.714	78%	0.78	S	S	*	*			trans	-72.9	114.3	179.8	28.4	-31.9	0	0	0	110.4	D7	P5-D7 PolarHBondContact O-N 3.21Å
6	E	46.3	Very low	57.4	Low	187 Å²	187	146.8 Å²	146.8	87%	0.874	76%	0.755	S	S	*	*			trans	-60	96.8	164.2	-67	-170.1	148.6	0	0	109.9	D4 N8	D4-E6 PolarHBondContact O-N 3.4Å; E6-N8 VanDerWaalsContact C-N 3.3Å; E6-N8 PolarHBondContact O-N 3.34Å
7	D	48.2	Very low	58.5	Low	138 Å²	138	148.1 Å²	148.1	74%	0.738	76%	0.757	S	S	*	*			trans	-73.9	84.1	168.6	-168.1	27.2	0	0	0	109.4	P5 E9	P5-D7 PolarHBondContact O-N 3.21Å; D7-E9 VanDerWaalsContact C-N 3.34Å; D7-E9 PolarHBondContact O-N 2.98Å
8	N	48.9	Very low	59.5	Low	129 Å²	129	147.1 Å²	147.1	69%	0.69	75%	0.753	S	S	*	*			trans	-94.7	59.9	173.8	-165.9	-3	0	0	0	110	E6 K10	E6-N8 VanDerWaalsContact C-N 3.3Å; E6-N8 PolarHBondContact O-N 3.34Å; N8-K10 PolarHBondContact O-N 3.26Å
9	E	56.8	Low	60.3	Low	167 Å²	167	143.8 Å²	143.8	78%	0.78	74%	0.735	S	S	*	*			trans	-75.4	101.4	168.7	-81.8	-157.8	149.9	0	0	110.1	D7	D7-E9 VanDerWaalsContact C-N 3.34Å; D7-E9 PolarHBondContact O-N 2.98Å
10	K	60.9	Low	61	Low	176 Å²	176	146.1 Å²	146.1	77%	0.765	73%	0.734	S	S	*	*	P	Polyproline II helix	trans	-58.3	128	172	-69.1	175.6	-179.3	173.3	0	110.3	N8 K12	N8-K10 PolarHBondContact O-N 3.26Å; K10-K12 PolarHBondContact O-N 2.89Å
11	P	62.9	Low	61.9	Low	104 Å²	104	141 Å²	141	68%	0.675	72%	0.718	S	S	*	*	P	Polyproline II helix	trans	-63.8	129.9	-178.1	21.1	-30.2	0	0	0	111.7
12	K	65.7	Low	63.8	Low	199 Å²	199	132.5 Å²	132.5	87%	0.865	69%	0.686	S	S	*	*	P	Polyproline II helix	trans	-64.4	138.7	176	-68.7	175.3	-175.9	164.7	0	109.7	K10	K10-K12 PolarHBondContact O-N 2.89Å
13	K	70.9	Confident	65.2	Low	192 Å²	192	126.2 Å²	126.2	84%	0.835	65%	0.649	S	S	*	*	P	Polyproline II helix	trans	-64	125.8	-179.9	-70	179.3	179.9	178.6	0	110.1
14	P	68.4	Low	67.1	Low	44 Å²	44	122.2 Å²	122.2	29%	0.286	63%	0.633	S	S	.	*	P	Polyproline II helix	trans	-66.4	134.9	177.3	26.7	-33.8	0	0	0	110.5	E19 R20 A23	P14-E19 HydrophobicContact CB-CB 3.57Å; P14-E19 WeakPolarHBondContact CB-O 3.44Å; P14-R20 HydrophobicContact CB-CB 4.29Å; P14-R20 HydrophobicContact CG-CB 4.27Å; P14-R20 HydrophobicContact CG-CG 4.23Å; P14-A23 HydrophobicContact CB-CB 4.22Å; P14-A23 HydrophobicContact CG-CB 3.98Å
15	T	73.1	Confident	68.7	Low	120 Å²	120	121.3 Å²	121.3	74%	0.736	63%	0.628	S	S	*	*			trans	-106.2	-23.9	-173.8	60.4	0	0	0	0	113.3	E19	T15-E19 PolarHBondContact N-OE2 2.91Å; T15-E19 PolarHBondContact OG1-OE2 3.26Å
16	T	76.7	Confident	70	Confident	64 Å²	64	122 Å²	122	39%	0.393	62%	0.622	S	S	.	*	S	Bend	trans	-106.5	160.9	177.7	67.5	0	0	0	0	111.8	D18 E19 R20	T16-D18 PolarHBondContact O-N 3.28Å; T16-E19 PolarHBondContact N-OE2 3.45Å; T16-E19 PolarHBondContact O-N 3.38Å; T16-E19 VanDerWaalsContact OG1-CB 3.32Å; T16-E19 WeakPolarHBondContact OG1-CB 3.44Å; T16-E19 VanDerWaalsContact OG1-CD 3.22Å; T16-E19 WeakPolarHBondContact OG1-CG 3.3Å; T16-E19 PolarHBondContact OG1-N 3.44Å; T16-E19 VanDerWaalsContact OG1-N 3.15Å; T16-R20 WeakPolarHBondContact O-CB 3.31Å; T16-R20 PolarHBondContact O-N 3.46Å
17	H	76.8	Confident	71.8	Confident	169 Å²	169	119.1 Å²	119.1	78%	0.782	60%	0.603	S	S	*	*	H	α-helix	trans	-56.8	-41.5	175.3	176.2	-87.3	0	0	0	111.3	R20 G21	H17-R20 PolarHBondContact O-N 3.24Å; H17-G21 PolarHBondContact O-N 3.06Å; H17-G21 VanDerWaalsContact O-N 3.16Å
18	D	77.1	Confident	73.7	Confident	129 Å²	129	118.1 Å²	118.1	69%	0.69	60%	0.601	S	S	*	*	H	α-helix	trans	-71	-40.8	-178.7	-58.6	-23.8	0	0	0	111.8	T16 R20 G21 A22	T16-D18 PolarHBondContact O-N 3.28Å; D18-R20 VanDerWaalsContact C-N 3.26Å; D18-R20 PolarHBondContact O-N 3.08Å; D18-G21 PolarHBondContact O-N 3.44Å; D18-A22 WeakPolarHBondContact O-CB 3.42Å; D18-A22 PolarHBondContact O-N 2.99Å
19	E	74.5	Confident	75.5	Confident	85 Å²	85	117.8 Å²	117.8	40%	0.397	60%	0.604	S	S	.	*	H	α-helix	trans	-62.9	-34	172.8	-74.8	165.4	-165.7	0	0	111.9	P14 T15 T16 A23	P14-E19 HydrophobicContact CB-CB 3.57Å; P14-E19 WeakPolarHBondContact CB-O 3.44Å; T15-E19 PolarHBondContact N-OE2 2.91Å; T15-E19 PolarHBondContact OG1-OE2 3.26Å; T16-E19 PolarHBondContact N-OE2 3.45Å; T16-E19 PolarHBondContact O-N 3.38Å; T16-E19 VanDerWaalsContact OG1-CB 3.32Å; T16-E19 WeakPolarHBondContact OG1-CB 3.44Å; T16-E19 VanDerWaalsContact OG1-CD 3.22Å; T16-E19 WeakPolarHBondContact OG1-CG 3.3Å; T16-E19 PolarHBondContact OG1-N 3.44Å; T16-E19 VanDerWaalsContact OG1-N 3.15Å; E19-A23 WeakPolarHBondContact O-CB 3.49Å; E19-A23 PolarHBondContact O-N 3.12Å
20	R	73.8	Confident	77	Confident	189 Å²	189	114.7 Å²	114.7	71%	0.713	59%	0.593	S	S	*	*	H	α-helix	trans	-69	-40.2	179	-161.8	179.1	-152.2	174.8	6.5	111.6	P14 T16 H17 D18 D24	P14-R20 HydrophobicContact CB-CB 4.29Å; P14-R20 HydrophobicContact CG-CB 4.27Å; P14-R20 HydrophobicContact CG-CG 4.23Å; T16-R20 WeakPolarHBondContact O-CB 3.31Å; T16-R20 PolarHBondContact O-N 3.46Å; H17-R20 PolarHBondContact O-N 3.24Å; D18-R20 VanDerWaalsContact C-N 3.26Å; D18-R20 PolarHBondContact O-N 3.08Å; R20-D24 PolarHBondContact O-N 3.29Å
21	G	79.9	Confident	78.4	Confident	40 Å²	40	116.1 Å²	116.1	41%	0.412	60%	0.595	S	S	.	*	H	α-helix	trans	-65.8	-46.2	173.2	0	0	0	0	0	112	H17 D18 A23 D24 L25	H17-G21 PolarHBondContact O-N 3.06Å; H17-G21 VanDerWaalsContact O-N 3.16Å; D18-G21 PolarHBondContact O-N 3.44Å; G21-A23 PolarHBondContact O-N 3.36Å; G21-D24 PolarHBondContact O-N 3.02Å; G21-L25 WeakPolarHBondContact O-CG 3.46Å; G21-L25 PolarHBondContact O-N 3.32Å
22	A	81	Confident	79.6	Confident	59 Å²	59	118.4 Å²	118.4	49%	0.488	60%	0.595	S	S	.	*	H	α-helix	trans	-62.5	-43.5	178	0	0	0	0	0	112.6	D18 D24 L25 E26	D18-A22 WeakPolarHBondContact O-CB 3.42Å; D18-A22 PolarHBondContact O-N 2.99Å; A22-D24 PolarHBondContact O-N 3.29Å; A22-L25 PolarHBondContact O-N 3.29Å; A22-E26 PolarHBondContact O-N 2.88Å; A22-E26 VanDerWaalsContact O-N 3.11Å
23	A	78.1	Confident	80.8	Confident	16 Å²	16	115.9 Å²	115.9	13%	0.132	59%	0.586	C	S	.	*	H	α-helix	trans	-68.5	-22.1	178.5	0	0	0	0	0	113.4	P14 E19 G21 R27	P14-A23 HydrophobicContact CB-CB 4.22Å; P14-A23 HydrophobicContact CG-CB 3.98Å; E19-A23 WeakPolarHBondContact O-CB 3.49Å; E19-A23 PolarHBondContact O-N 3.12Å; G21-A23 PolarHBondContact O-N 3.36Å; A23-R27 PolarHBondContact O-NH1 3.02Å
24	D	82.6	Confident	81.6	Confident	102 Å²	102	114.9 Å²	114.9	55%	0.545	58%	0.584	S	S	.	*	H	α-helix	trans	-75.5	-39.2	172.3	-157.9	54.4	0	0	0	111.3	R20 G21 A22 E26 R27	R20-D24 PolarHBondContact O-N 3.29Å; G21-D24 PolarHBondContact O-N 3.02Å; A22-D24 PolarHBondContact O-N 3.29Å; D24-E26 VanDerWaalsContact C-N 3.33Å; D24-E26 PolarHBondContact O-N 3.33Å; D24-R27 PolarHBondContact O-N 3.39Å; D24-R27 IonicContact OD1-NH1 3.5Å; D24-R27 PolarHBondContact OD1-NH1 3.08Å
25	L	87.7	Confident	82.6	Confident	128 Å²	128	121.1 Å²	121.1	67%	0.67	61%	0.607	S	S	*	*	H	α-helix	trans	-65.4	-34.5	176.1	-66.2	175.4	0	0	0	112.8	G21 A22 R27 V28	G21-L25 WeakPolarHBondContact O-CG 3.46Å; G21-L25 PolarHBondContact O-N 3.32Å; A22-L25 PolarHBondContact O-N 3.29Å; L25-R27 VanDerWaalsContact C-N 3.32Å; L25-R27 PolarHBondContact O-N 2.97Å; L25-V28 WeakPolarHBondContact O-CB 3.32Å; L25-V28 PolarHBondContact O-N 3.41Å
26	E	80.3	Confident	83.3	Confident	125 Å²	125	124.7 Å²	124.7	58%	0.584	62%	0.615	S	S	*	*	H	α-helix	trans	-62.6	-38.6	177.7	-170	172.6	-155.9	0	0	112.1	A22 D24 V28 T29	A22-E26 PolarHBondContact O-N 2.88Å; A22-E26 VanDerWaalsContact O-N 3.11Å; D24-E26 VanDerWaalsContact C-N 3.33Å; D24-E26 PolarHBondContact O-N 3.33Å; E26-V28 PolarHBondContact O-N 3.4Å; E26-T29 PolarHBondContact O-N 3.24Å; E26-T29 PolarHBondContact O-OG1 3.41Å
27	R	84	Confident	83.5	Confident	127 Å²	127	128.4 Å²	128.4	48%	0.479	63%	0.632	S	S	.	*	G	3₁₀ helix	trans	-67.6	-17.1	178.9	-64	-174	-162.9	94.4	16.6	114.2	A23 D24 L25 T29 D30	A23-R27 PolarHBondContact O-NH1 3.02Å; D24-R27 PolarHBondContact O-N 3.39Å; D24-R27 IonicContact OD1-NH1 3.5Å; D24-R27 PolarHBondContact OD1-NH1 3.08Å; L25-R27 VanDerWaalsContact C-N 3.32Å; L25-R27 PolarHBondContact O-N 2.97Å; R27-T29 PolarHBondContact O-N 2.95Å; R27-D30 PolarHBondContact O-N 2.98Å
28	V	86.9	Confident	83.6	Confident	116 Å²	116	126.7 Å²	126.7	70%	0.703	64%	0.639	S	S	*	*	G	3₁₀ helix	trans	-69.1	-23.9	179.1	177.5	0	0	0	0	111.4	L25 E26	L25-V28 WeakPolarHBondContact O-CB 3.32Å; L25-V28 PolarHBondContact O-N 3.41Å; E26-V28 PolarHBondContact O-N 3.4Å
29	T	88.4	Confident	83.6	Confident	123 Å²	123	124.9 Å²	124.9	76%	0.755	63%	0.632	S	S	*	*	G	3₁₀ helix	trans	-98.5	-4	178.4	55.1	0	0	0	0	114	E26 R27	E26-T29 PolarHBondContact O-N 3.24Å; E26-T29 PolarHBondContact O-OG1 3.41Å; R27-T29 PolarHBondContact O-N 2.95Å
30	D	87.9	Confident	83.8	Confident	102 Å²	102	123 Å²	123	55%	0.545	64%	0.636	S	S	.	*	S	Bend	trans	-63.8	152.9	177.5	-75.3	-19.3	0	0	0	110.9	R27 F32	R27-D30 PolarHBondContact O-N 2.98Å; D30-F32 PolarHBondContact O-N 3.42Å
31	Y	89.9	Confident	83.9	Confident	206 Å²	206	120.8 Å²	120.8	81%	0.808	64%	0.637	S	S	*	*			trans	-62	125.8	174.5	177.3	-94.3	0	0	0	110.7	E33	Y31-E33 HydrophobicContact CE1-CB 4.38Å
32	F	88.8	Confident	83.8	Confident	152 Å²	152	125.2 Å²	125.2	67%	0.667	65%	0.652	S	S	*	*			trans	-131.7	126.3	171.9	179.7	-94.1	0	0	0	109.4	D30 E34	D30-F32 PolarHBondContact O-N 3.42Å; F32-E34 PolarHBondContact O-N 3.42Å
33	E	90.3	Very high	83.6	Confident	145 Å²	145	125 Å²	125	68%	0.678	65%	0.65	S	S	*	*	P	Polyproline II helix	trans	-73.5	120.2	175.5	-174.6	174.3	-164.5	0	0	110.1	Y31 K35	Y31-E33 HydrophobicContact CE1-CB 4.38Å; E33-K35 PolarHBondContact O-N 2.98Å
34	E	88.5	Confident	83.5	Confident	171 Å²	171	128.3 Å²	128.3	80%	0.799	67%	0.668	S	S	*	*	P	Polyproline II helix	trans	-62.8	134.7	177.8	-65.9	-168.1	150.9	0	0	110.9	F32 E36	F32-E34 PolarHBondContact O-N 3.42Å; E34-E36 PolarHBondContact O-N 2.74Å
35	K	89.3	Confident	83.2	Confident	176 Å²	176	129.5 Å²	129.5	77%	0.765	67%	0.668	S	S	*	*	P	Polyproline II helix	trans	-76.4	123.2	176.1	-72.3	-175.7	179.7	175.9	0	110.2	E33 L37	E33-K35 PolarHBondContact O-N 2.98Å; K35-L37 PolarHBondContact O-N 3.49Å
36	E	86.3	Confident	82.4	Confident	194 Å²	194	125.8 Å²	125.8	91%	0.907	66%	0.656	S	S	*	*	P	Polyproline II helix	trans	-62.6	130.8	170.8	-63.3	-168	161	0	0	110.9	E34	E34-E36 PolarHBondContact O-N 2.74Å
37	L	81.1	Confident	82	Confident	143 Å²	143	124.7 Å²	124.7	75%	0.749	66%	0.658	S	S	*	*	P	Polyproline II helix	trans	-101.6	125.1	168.7	-64.7	175.3	0	0	0	108.5	K35 V39	K35-L37 PolarHBondContact O-N 3.49Å; L37-V39 HydrophobicContact CB-CG1 4.12Å; L37-V39 PolarHBondContact O-N 3.06Å
38	S	79.8	Confident	81.2	Confident	132 Å²	132	122.5 Å²	122.5	92%	0.923	66%	0.662	S	S	*	*			trans	-70.8	80.2	167.1	158	0	0	0	0	109.2
39	V	77.3	Confident	80.1	Confident	92 Å²	92	122.4 Å²	122.4	56%	0.558	66%	0.657	S	S	*	*			trans	-93.4	128.8	170.3	-66.7	0	0	0	0	109.6	L37 V44	L37-V39 HydrophobicContact CB-CG1 4.12Å; L37-V39 PolarHBondContact O-N 3.06Å; V39-V44 HydrophobicContact CG2-CG2 4.4Å
40	G	78.2	Confident	78.9	Confident	46 Å²	46	121.9 Å²	121.9	47%	0.474	65%	0.654	S	S	.	*			trans	-65.9	149.1	173.2	0	0	0	0	0	111	D42 A43	G40-D42 PolarHBondContact O-N 2.94Å; G40-A43 PolarHBondContact O-N 3.05Å
41	L	76.2	Confident	77.4	Confident	141 Å²	141	118.8 Å²	118.8	74%	0.738	64%	0.643	S	S	*	*	H	α-helix	trans	-51.7	-29.6	177.5	-177.2	62.2	0	0	0	112.8	A43 V44 K45	L41-A43 VanDerWaalsContact C-N 3.33Å; L41-A43 PolarHBondContact O-N 2.95Å; L41-V44 PolarHBondContact O-N 2.88Å; L41-K45 PolarHBondContact O-N 3.16Å
42	D	77.5	Confident	76	Confident	134 Å²	134	110.5 Å²	110.5	72%	0.717	62%	0.62	S	S	*	*	H	α-helix	trans	-62.2	-36.1	178.3	-61.7	-34.6	0	0	0	113.1	G40 K45 A46	G40-D42 PolarHBondContact O-N 2.94Å; D42-K45 PolarHBondContact O-N 3.2Å; D42-A46 WeakPolarHBondContact O-CB 3.46Å; D42-A46 PolarHBondContact O-N 2.74Å
43	A	75.6	Confident	74.8	Confident	54 Å²	54	107.8 Å²	107.8	45%	0.446	61%	0.613	S	S	.	*	H	α-helix	trans	-69.8	-40	177.1	0	0	0	0	0	111.4	G40 L41 K45 A46 V47	G40-A43 PolarHBondContact O-N 3.05Å; L41-A43 VanDerWaalsContact C-N 3.33Å; L41-A43 PolarHBondContact O-N 2.95Å; A43-K45 VanDerWaalsContact C-N 3.34Å; A43-A46 PolarHBondContact O-N 3.24Å; A43-V47 PolarHBondContact O-N 2.85Å
44	V	77	Confident	73.6	Confident	86 Å²	86	104.6 Å²	104.6	52%	0.521	61%	0.611	S	S	.	*	H	α-helix	trans	-63.7	-43.5	175.8	-177.3	0	0	0	0	110.3	V39 L41 V47 S48	V39-V44 HydrophobicContact CG2-CG2 4.4Å; L41-V44 PolarHBondContact O-N 2.88Å; V44-V47 PolarHBondContact O-N 3.12Å; V44-S48 PolarHBondContact O-N 2.96Å; V44-S48 VanDerWaalsContact O-N 3.09Å
45	K	75.4	Confident	72.9	Confident	127 Å²	127	102.1 Å²	102.1	55%	0.552	60%	0.603	S	S	*	*	H	α-helix	trans	-63.6	-40.8	176.6	-171.1	179.2	176	-170.7	0	112.1	L41 D42 A43 V47 S48 D49	L41-K45 PolarHBondContact O-N 3.16Å; D42-K45 PolarHBondContact O-N 3.2Å; A43-K45 VanDerWaalsContact C-N 3.34Å; K45-V47 VanDerWaalsContact C-N 3.29Å; K45-V47 PolarHBondContact O-N 3.49Å; K45-S48 CarbonylContact O-C 3.57Å; K45-S48 WeakPolarHBondContact O-CA 3.43Å; K45-S48 WeakPolarHBondContact O-CB 3.31Å; K45-S48 PolarHBondContact O-N 3.46Å; K45-S48 VanDerWaalsContact O-N 3.09Å; K45-D49 WeakPolarHBondContact O-CB 3.45Å; K45-D49 PolarHBondContact O-N 3.44Å
46	A	70.9	Confident	72.2	Confident	50 Å²	50	99.9 Å²	99.9	41%	0.413	59%	0.593	S	S	.	*	H	α-helix	trans	-61.4	-35.4	176.2	0	0	0	0	0	112.8	D42 A43 D49 T50	D42-A46 WeakPolarHBondContact O-CB 3.46Å; D42-A46 PolarHBondContact O-N 2.74Å; A43-A46 PolarHBondContact O-N 3.24Å; A46-D49 PolarHBondContact O-N 3.02Å; A46-T50 WeakPolarHBondContact O-CB 3.34Å; A46-T50 WeakPolarHBondContact O-CG2 3.47Å; A46-T50 PolarHBondContact O-N 3.08Å; A46-T50 PolarHBondContact O-OG1 3.5Å
47	V	72.7	Confident	71.7	Confident	101 Å²	101	92.6 Å²	92.6	61%	0.612	57%	0.566	S	S	*	*	H	α-helix	trans	-68.9	-40.5	173.4	179.4	0	0	0	0	110.9	A43 V44 K45 D49 T50 A51	A43-V47 PolarHBondContact O-N 2.85Å; V44-V47 PolarHBondContact O-N 3.12Å; K45-V47 VanDerWaalsContact C-N 3.29Å; K45-V47 PolarHBondContact O-N 3.49Å; V47-D49 VanDerWaalsContact C-N 3.29Å; V47-D49 PolarHBondContact O-N 3.03Å; V47-T50 WeakPolarHBondContact CA-OG1 3.38Å; V47-T50 PolarHBondContact O-N 2.95Å; V47-T50 PolarHBondContact O-OG1 3.22Å; V47-A51 PolarHBondContact O-N 2.91Å
48	S	67.7	Low	71.5	Confident	82 Å²	82	91.1 Å²	91.1	57%	0.573	56%	0.556	S	S	*	*	H	α-helix	trans	-64.7	-32.4	175.4	-168.4	0	0	0	0	113.1	V44 K45	V44-S48 PolarHBondContact O-N 2.96Å; V44-S48 VanDerWaalsContact O-N 3.09Å; K45-S48 CarbonylContact O-C 3.57Å; K45-S48 WeakPolarHBondContact O-CA 3.43Å; K45-S48 WeakPolarHBondContact O-CB 3.31Å; K45-S48 PolarHBondContact O-N 3.46Å; K45-S48 VanDerWaalsContact O-N 3.09Å
49	D	63.6	Low	71.5	Confident	113 Å²	113	90.7 Å²	90.7	60%	0.604	54%	0.537	S	S	*	.	H	α-helix	trans	-84.5	-26.4	-179.4	-69.8	-20.7	0	0	0	112.3	K45 A46 V47	K45-D49 WeakPolarHBondContact O-CB 3.45Å; K45-D49 PolarHBondContact O-N 3.44Å; A46-D49 PolarHBondContact O-N 3.02Å; V47-D49 VanDerWaalsContact C-N 3.29Å; V47-D49 PolarHBondContact O-N 3.03Å
50	T	62.2	Low	71.6	Confident	113 Å²	113	92.1 Å²	92.1	69%	0.693	54%	0.538	S	S	*	.	H	α-helix	trans	-86.7	-21.7	176.8	52.4	0	0	0	0	113.4	A46 V47 G52	A46-T50 WeakPolarHBondContact O-CB 3.34Å; A46-T50 WeakPolarHBondContact O-CG2 3.47Å; A46-T50 PolarHBondContact O-N 3.08Å; A46-T50 PolarHBondContact O-OG1 3.5Å; V47-T50 WeakPolarHBondContact CA-OG1 3.38Å; V47-T50 PolarHBondContact O-N 2.95Å; V47-T50 PolarHBondContact O-OG1 3.22Å; T50-G52 PolarHBondContact O-N 3.29Å
51	A	57.2	Low	71.7	Confident	36 Å²	36	97 Å²	97	30%	0.298	55%	0.546	S	S	.	.	S	Bend	trans	-61.8	106.6	161.1	0	0	0	0	0	106.4	V47 D53	V47-A51 PolarHBondContact O-N 2.91Å; A51-D53 PolarHBondContact O-N 3.16Å
52	G	59.7	Low	71.9	Confident	33 Å²	33	95.4 Å²	95.4	34%	0.34	54%	0.535	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.8	31.3	176.9	0	0	0	0	0	114.3	T50 A54 D55 K56	T50-G52 PolarHBondContact O-N 3.29Å; G52-A54 VanDerWaalsContact C-N 3.27Å; G52-A54 PolarHBondContact O-N 3.44Å; G52-D55 PolarHBondContact O-N 2.95Å; G52-K56 WeakPolarHBondContact O-CB 3.34Å; G52-K56 VanDerWaalsContact O-CG 3.25Å; G52-K56 WeakPolarHBondContact O-CG 2.98Å; G52-K56 PolarHBondContact O-N 3.3Å
53	D	63.6	Low	72.1	Confident	94 Å²	94	90.3 Å²	90.3	50%	0.503	51%	0.507	S	S	.	.	H	α-helix	trans	-64.9	-31	176.9	-69.9	-16.5	0	0	0	111	A51 A57	A51-D53 PolarHBondContact O-N 3.16Å; D53-A57 WeakPolarHBondContact O-CA 3.4Å; D53-A57 WeakPolarHBondContact O-CB 3.49Å; D53-A57 PolarHBondContact O-N 3.37Å
54	A	66.6	Low	72.4	Confident	78 Å²	78	93.9 Å²	93.9	65%	0.645	52%	0.518	S	S	*	.	H	α-helix	trans	-60.9	-50.3	172	0	0	0	0	0	111.4	G52 A57 Q58	G52-A54 VanDerWaalsContact C-N 3.27Å; G52-A54 PolarHBondContact O-N 3.44Å; A54-A57 PolarHBondContact O-N 3.03Å; A54-Q58 VanDerWaalsContact O-CB 3.29Å; A54-Q58 WeakPolarHBondContact O-CB 3.31Å; A54-Q58 PolarHBondContact O-N 3.2Å
55	D	72.3	Confident	72.9	Confident	119 Å²	119	98 Å²	98	64%	0.636	53%	0.529	S	S	*	.	H	α-helix	trans	-69.4	-42	178.9	-78.3	-25.1	0	0	0	112.2	G52 Q58 K59	G52-D55 PolarHBondContact O-N 2.95Å; D55-Q58 PolarHBondContact O-N 3.27Å; D55-K59 WeakPolarHBondContact O-CB 3.45Å; D55-K59 PolarHBondContact O-N 3.21Å
56	K	75.3	Confident	73.4	Confident	129 Å²	129	94.1 Å²	94.1	56%	0.561	51%	0.514	S	S	*	.	H	α-helix	trans	-63.5	-42	175.8	-71.8	172.6	-173.7	174.2	0	111.6	G52 K59 Q60	G52-K56 WeakPolarHBondContact O-CB 3.34Å; G52-K56 VanDerWaalsContact O-CG 3.25Å; G52-K56 WeakPolarHBondContact O-CG 2.98Å; G52-K56 PolarHBondContact O-N 3.3Å; K56-K59 PolarHBondContact O-N 3.44Å; K56-Q60 WeakPolarHBondContact O-CB 3.45Å; K56-Q60 VanDerWaalsContact O-CG 3.26Å; K56-Q60 WeakPolarHBondContact O-CG 3.41Å; K56-Q60 PolarHBondContact O-N 3.32Å; K56-Q60 PolarHBondContact O-NE2 3.33Å
57	A	76.2	Confident	74.2	Confident	41 Å²	41	101.3 Å²	101.3	34%	0.339	54%	0.536	S	S	.	.	H	α-helix	trans	-68.1	-39.6	177.5	0	0	0	0	0	110.9	D53 A54 Q60 K61	D53-A57 WeakPolarHBondContact O-CA 3.4Å; D53-A57 WeakPolarHBondContact O-CB 3.49Å; D53-A57 PolarHBondContact O-N 3.37Å; A54-A57 PolarHBondContact O-N 3.03Å; A57-Q60 PolarHBondContact O-N 3.06Å; A57-K61 WeakPolarHBondContact O-CB 3.33Å; A57-K61 VanDerWaalsContact O-CG 3.31Å; A57-K61 WeakPolarHBondContact O-CG 3.45Å; A57-K61 PolarHBondContact O-N 3.18Å
58	Q	77.5	Confident	75.1	Confident	113 Å²	113	98.3 Å²	98.3	53%	0.528	52%	0.518	S	S	.	.	H	α-helix	trans	-63.5	-45.3	174.5	-178.9	168.2	-51.4	0	0	111.5	A54 D55 Q60 K61 Q62	A54-Q58 VanDerWaalsContact O-CB 3.29Å; A54-Q58 WeakPolarHBondContact O-CB 3.31Å; A54-Q58 PolarHBondContact O-N 3.2Å; D55-Q58 PolarHBondContact O-N 3.27Å; Q58-Q60 PolarHBondContact O-N 3.04Å; Q58-K61 PolarHBondContact O-N 3.18Å; Q58-Q62 WeakPolarHBondContact O-CG 3.47Å; Q58-Q62 PolarHBondContact O-N 3.44Å
59	K	79.1	Confident	76.3	Confident	122 Å²	122	101 Å²	101	53%	0.53	52%	0.519	S	S	.	.	H	α-helix	trans	-59.7	-45.9	175.7	-173.4	176.6	178.1	-178	0	111.3	D55 K56 K61 Q62 M63	D55-K59 WeakPolarHBondContact O-CB 3.45Å; D55-K59 PolarHBondContact O-N 3.21Å; K56-K59 PolarHBondContact O-N 3.44Å; K59-K61 PolarHBondContact O-N 2.94Å; K59-Q62 WeakPolarHBondContact O-CB 3.29Å; K59-Q62 PolarHBondContact O-N 3.48Å; K59-Q62 VanDerWaalsContact O-N 3.16Å; K59-M63 HydrophobicContact CG-SD 4.23Å; K59-M63 WeakPolarHBondContact O-CG 3.31Å; K59-M63 PolarHBondContact O-N 3.46Å
60	Q	78.4	Confident	77.7	Confident	122 Å²	122	101.3 Å²	101.3	57%	0.57	52%	0.52	S	S	*	.	H	α-helix	trans	-61	-43.6	176	-75.5	174.3	77.8	0	0	112.2	K56 A57 Q58 Q62 M63 L64	K56-Q60 WeakPolarHBondContact O-CB 3.45Å; K56-Q60 VanDerWaalsContact O-CG 3.26Å; K56-Q60 WeakPolarHBondContact O-CG 3.41Å; K56-Q60 PolarHBondContact O-N 3.32Å; K56-Q60 PolarHBondContact O-NE2 3.33Å; A57-Q60 PolarHBondContact O-N 3.06Å; Q58-Q60 PolarHBondContact O-N 3.04Å; Q60-Q62 VanDerWaalsContact C-N 3.26Å; Q60-Q62 PolarHBondContact O-N 2.84Å; Q60-M63 PolarHBondContact O-N 2.97Å; Q60-L64 WeakPolarHBondContact O-CG 3.4Å; Q60-L64 PolarHBondContact O-N 3.46Å
61	K	81.8	Confident	79.3	Confident	148 Å²	148	103.2 Å²	103.2	64%	0.643	52%	0.522	S	S	*	.	H	α-helix	trans	-59.9	-35.9	175.1	-76.7	175.4	-178.9	177.9	0	112.6	A57 Q58 K59	A57-K61 WeakPolarHBondContact O-CB 3.33Å; A57-K61 VanDerWaalsContact O-CG 3.31Å; A57-K61 WeakPolarHBondContact O-CG 3.45Å; A57-K61 PolarHBondContact O-N 3.18Å; Q58-K61 PolarHBondContact O-N 3.18Å; K59-K61 PolarHBondContact O-N 2.94Å
62	Q	80.2	Confident	81.1	Confident	109 Å²	109	102.7 Å²	102.7	51%	0.509	51%	0.514	S	S	.	.	H	α-helix	trans	-69.4	-44.7	174.9	-68.1	176.4	31	0	0	111.3	Q58 K59 Q60 L64 K65	Q58-Q62 WeakPolarHBondContact O-CG 3.47Å; Q58-Q62 PolarHBondContact O-N 3.44Å; K59-Q62 WeakPolarHBondContact O-CB 3.29Å; K59-Q62 PolarHBondContact O-N 3.48Å; K59-Q62 VanDerWaalsContact O-N 3.16Å; Q60-Q62 VanDerWaalsContact C-N 3.26Å; Q60-Q62 PolarHBondContact O-N 2.84Å; Q62-L64 VanDerWaalsContact C-N 3.25Å; Q62-L64 PolarHBondContact O-N 3.27Å; Q62-K65 WeakPolarHBondContact O-CB 3.25Å; Q62-K65 PolarHBondContact O-N 2.92Å
63	M	82	Confident	82.8	Confident	26 Å²	26	101.3 Å²	101.3	13%	0.128	50%	0.499	C	S	.	.	H	α-helix	trans	-59.7	-33.2	177.7	-69.5	173	68.7	0	0	113.1	K59 Q60 K65 I66 R89 K92 E93	K59-M63 HydrophobicContact CG-SD 4.23Å; K59-M63 WeakPolarHBondContact O-CG 3.31Å; K59-M63 PolarHBondContact O-N 3.46Å; Q60-M63 PolarHBondContact O-N 2.97Å; M63-K65 PolarHBondContact O-N 3.16Å; M63-I66 WeakPolarHBondContact O-CB 3.39Å; M63-I66 PolarHBondContact O-N 3.02Å; M63-R89 HydrophobicContact CE-CG 4.13Å; M63-K92 HydrophobicContact CB-CB 4.12Å; M63-K92 HydrophobicContact CE-CB 3.88Å; M63-K92 WeakPolarHBondContact O-CD 3.15Å; M63-E93 HydrophobicContact CE-CB 4.43Å; M63-E93 HydrophobicContact CE-CG 3.32Å; M63-E93 HydrophobicContact SD-CG 4.1Å
64	L	80.6	Confident	84.3	Confident	129 Å²	129	99.2 Å²	99.2	68%	0.675	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.4	-22.4	176.7	-71.2	173.3	0	0	0	113.9	Q60 Q62 I66	Q60-L64 WeakPolarHBondContact O-CG 3.4Å; Q60-L64 PolarHBondContact O-N 3.46Å; Q62-L64 VanDerWaalsContact C-N 3.25Å; Q62-L64 PolarHBondContact O-N 3.27Å; L64-I66 VanDerWaalsContact C-N 3.3Å
65	K	87	Confident	85.6	Confident	174 Å²	174	99 Å²	99	76%	0.757	48%	0.479	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.9	-16.8	177.1	-62.8	177.4	-178.5	-179.9	0	112.5	Q62 M63 K67	Q62-K65 WeakPolarHBondContact O-CB 3.25Å; Q62-K65 PolarHBondContact O-N 2.92Å; M63-K65 PolarHBondContact O-N 3.16Å; K65-K67 PolarHBondContact O-N 2.83Å
66	I	86.4	Confident	86.7	Confident	45 Å²	45	93.3 Å²	93.3	23%	0.231	45%	0.448	C	S	.	.			trans	-80.6	117.5	-176.6	-60.7	171.6	0	0	0	108.5	M63 L64 V68 K92	M63-I66 WeakPolarHBondContact O-CB 3.39Å; M63-I66 PolarHBondContact O-N 3.02Å; L64-I66 VanDerWaalsContact C-N 3.3Å; I66-V68 HydrophobicContact CG2-CG1 4.39Å; I66-K92 HydrophobicContact CB-CG 4.5Å; I66-K92 WeakPolarHBondContact CD1-O 3.25Å
67	K	88.8	Confident	87.7	Confident	200 Å²	200	88.7 Å²	88.7	87%	0.87	43%	0.432	S	S	*	.			trans	-81	126.9	174.5	-66.3	-177.7	179.4	179.4	0	108.9	K65	K65-K67 PolarHBondContact O-N 2.83Å
68	V	91.3	Very high	88.5	Confident	39 Å²	39	93.1 Å²	93.1	24%	0.236	45%	0.446	C	S	.	.			trans	-114.4	144	175.3	-61	0	0	0	0	108.8	I66 V73 L91 K92	I66-V68 HydrophobicContact CG2-CG1 4.39Å; V68-V73 HydrophobicContact CG2-CG2 4.21Å; V68-L91 HydrophobicContact CB-CB 4.25Å; V68-L91 HydrophobicContact CB-CD1 4.41Å; V68-L91 HydrophobicContact CG1-CB 3.68Å; V68-K92 HydrophobicContact CG1-CG 3.89Å
69	K	93	Very high	89.3	Confident	138 Å²	138	94 Å²	94	60%	0.6	45%	0.45	S	S	*	.			trans	-80.9	142.3	177.3	-55.9	176.2	-177.9	171.5	0	109.5	E71 D72 V73	K69-E71 VanDerWaalsContact C-N 3.29Å; K69-E71 PolarHBondContact O-N 3.33Å; K69-D72 HydrophobicContact CB-CB 4.36Å; K69-D72 WeakPolarHBondContact CB-OD2 3.38Å; K69-D72 PolarHBondContact O-N 3.38Å; K69-V73 WeakPolarHBondContact O-CG2 3.04Å; K69-V73 PolarHBondContact O-N 2.94Å
70	N	93.2	Very high	90	Very high	119 Å²	119	90.9 Å²	90.9	64%	0.636	44%	0.439	S	S	*	.	H	α-helix	trans	-67	-33.4	178.1	-164.2	-16.4	0	0	0	111.6	D72 V73 S74	N70-D72 VanDerWaalsContact C-N 3.33Å; N70-D72 PolarHBondContact O-N 3.15Å; N70-V73 PolarHBondContact O-N 3.38Å; N70-S74 WeakPolarHBondContact O-CB 3.49Å; N70-S74 PolarHBondContact O-N 2.77Å
71	E	95.1	Very high	90.7	Very high	154 Å²	154	93.7 Å²	93.7	72%	0.72	45%	0.452	S	S	*	.	H	α-helix	trans	-56.5	-47	173.5	-67.3	171.6	-164.8	0	0	111.6	K69 V73 S74 L75	K69-E71 VanDerWaalsContact C-N 3.29Å; K69-E71 PolarHBondContact O-N 3.33Å; E71-V73 VanDerWaalsContact C-N 3.35Å; E71-V73 PolarHBondContact O-N 3.49Å; E71-S74 PolarHBondContact O-N 2.9Å; E71-L75 WeakPolarHBondContact O-CB 3.49Å; E71-L75 PolarHBondContact O-N 3.16Å
72	D	94.8	Very high	91.2	Very high	25 Å²	25	88.5 Å²	88.5	13%	0.134	43%	0.432	C	S	.	.	H	α-helix	trans	-62.8	-41.2	178.5	-58.2	-17.2	0	0	0	111.7	K69 N70 I76 L91 V98	K69-D72 HydrophobicContact CB-CB 4.36Å; K69-D72 WeakPolarHBondContact CB-OD2 3.38Å; K69-D72 PolarHBondContact O-N 3.38Å; N70-D72 VanDerWaalsContact C-N 3.33Å; N70-D72 PolarHBondContact O-N 3.15Å; D72-I76 WeakPolarHBondContact O-CD1 3.45Å; D72-I76 WeakPolarHBondContact O-CG1 3.44Å; D72-I76 PolarHBondContact O-N 3.34Å; D72-I76 VanDerWaalsContact O-N 3.12Å; D72-L91 HydrophobicContact CB-CD1 4.03Å; D72-L91 HydrophobicContact CB-CD2 4.28Å; D72-V98 HydrophobicContact CB-CG2 3.54Å; D72-V98 WeakPolarHBondContact OD1-CG2 3.28Å; D72-V98 WeakPolarHBondContact OD2-CG2 3.41Å
73	V	95.1	Very high	91.9	Very high	4 Å²	4	86.3 Å²	86.3	2%	0.024	43%	0.429	C	S	.	.	H	α-helix	trans	-63.4	-46.1	176.2	176.9	0	0	0	0	110.5	V68 K69 N70 E71 I76 C77 K84 A87 E88 L91	V68-V73 HydrophobicContact CG2-CG2 4.21Å; K69-V73 WeakPolarHBondContact O-CG2 3.04Å; K69-V73 PolarHBondContact O-N 2.94Å; N70-V73 PolarHBondContact O-N 3.38Å; E71-V73 VanDerWaalsContact C-N 3.35Å; E71-V73 PolarHBondContact O-N 3.49Å; V73-I76 PolarHBondContact O-N 2.98Å; V73-C77 PolarHBondContact O-N 3.19Å; V73-C77 PolarHBondContact O-SG 3.26Å; V73-K84 HydrophobicContact CG1-CG 3.88Å; V73-A87 HydrophobicContact CG1-CB 4.16Å; V73-E88 HydrophobicContact CG1-CG 3.89Å; V73-E88 HydrophobicContact CG2-CG 3.74Å; V73-L91 HydrophobicContact CB-CD1 4.3Å; V73-L91 HydrophobicContact CG2-CD1 3.5Å; V73-L91 VanDerWaalsContact CG2-CD1 3.5Å
74	S	94.7	Very high	92.5	Very high	50 Å²	50	90.8 Å²	90.8	35%	0.35	45%	0.448	S	S	.	.	H	α-helix	trans	-63.6	-42.7	-179.8	-171.2	0	0	0	0	111.7	N70 E71 C77 Q78	N70-S74 WeakPolarHBondContact O-CB 3.49Å; N70-S74 PolarHBondContact O-N 2.77Å; E71-S74 PolarHBondContact O-N 2.9Å; S74-C77 PolarHBondContact O-N 3.35Å; S74-Q78 WeakPolarHBondContact O-CB 3.34Å; S74-Q78 VanDerWaalsContact O-CG 3.31Å; S74-Q78 WeakPolarHBondContact O-CG 3.39Å; S74-Q78 PolarHBondContact O-N 3.38Å
75	L	95.5	Very high	93.1	Very high	72 Å²	72	91.1 Å²	91.1	38%	0.377	45%	0.45	S	S	.	.	H	α-helix	trans	-57.6	-50.9	175.9	-179.8	69	0	0	0	110.7	E71 C77 Q78 E79 V98	E71-L75 WeakPolarHBondContact O-CB 3.49Å; E71-L75 PolarHBondContact O-N 3.16Å; L75-C77 VanDerWaalsContact C-N 3.34Å; L75-C77 PolarHBondContact O-N 3.3Å; L75-Q78 PolarHBondContact O-N 2.9Å; L75-E79 HydrophobicContact CD1-CG 3.78Å; L75-E79 HydrophobicContact CG-CG 4.25Å; L75-E79 WeakPolarHBondContact O-CB 3.26Å; L75-E79 VanDerWaalsContact O-CG 3.3Å; L75-E79 WeakPolarHBondContact O-CG 3.42Å; L75-E79 PolarHBondContact O-N 2.83Å; L75-V98 HydrophobicContact CD2-CG1 4.19Å
76	I	94.8	Very high	93.4	Very high	0 Å²	0	85.2 Å²	85.2	0%	0	43%	0.428	C	S	.	.	H	α-helix	trans	-62.5	-41.4	180	-68.8	163.6	0	0	0	111.6	D72 V73 Q78 L80 V82 A87 L91 T101 L102 L105	D72-I76 WeakPolarHBondContact O-CD1 3.45Å; D72-I76 WeakPolarHBondContact O-CG1 3.44Å; D72-I76 PolarHBondContact O-N 3.34Å; D72-I76 VanDerWaalsContact O-N 3.12Å; V73-I76 PolarHBondContact O-N 2.98Å; I76-Q78 VanDerWaalsContact C-N 3.3Å; I76-Q78 PolarHBondContact O-N 3.39Å; I76-L80 HydrophobicContact CG2-CD1 4.37Å; I76-L80 WeakPolarHBondContact O-CB 3.44Å; I76-L80 PolarHBondContact O-N 2.77Å; I76-L80 VanDerWaalsContact O-N 3.08Å; I76-V82 HydrophobicContact CG2-CG2 3.62Å; I76-A87 HydrophobicContact CB-CB 4.07Å; I76-A87 HydrophobicContact CG2-CB 3.63Å; I76-L91 HydrophobicContact CD1-CD1 3.74Å; I76-L91 HydrophobicContact CD1-CD2 3.78Å; I76-L91 HydrophobicContact CD1-CG 3.61Å; I76-T101 HydrophobicContact CD1-CG2 3.59Å; I76-L102 HydrophobicContact CG1-CD2 4.01Å; I76-L105 HydrophobicContact CG2-CD1 3.74Å
77	C	95.7	Very high	93.8	Very high	32 Å²	32	83 Å²	83	22%	0.216	42%	0.417	C	S	.	.	H	α-helix	trans	-64.2	-36.1	178.3	-65.4	0	0	0	0	112.3	V73 S74 L75 E81	V73-C77 PolarHBondContact O-N 3.19Å; V73-C77 PolarHBondContact O-SG 3.26Å; S74-C77 PolarHBondContact O-N 3.35Å; L75-C77 VanDerWaalsContact C-N 3.34Å; L75-C77 PolarHBondContact O-N 3.3Å; C77-E81 WeakPolarHBondContact O-CA 3.47Å; C77-E81 PolarHBondContact O-N 3.18Å
78	Q	94.7	Very high	94	Very high	135 Å²	135	76 Å²	76	63%	0.631	39%	0.388	S	S	*	.	H	α-helix	trans	-77.6	-45.7	-179.8	-74.2	174.6	-17.8	0	0	112.3	S74 L75 I76	S74-Q78 WeakPolarHBondContact O-CB 3.34Å; S74-Q78 VanDerWaalsContact O-CG 3.31Å; S74-Q78 WeakPolarHBondContact O-CG 3.39Å; S74-Q78 PolarHBondContact O-N 3.38Å; L75-Q78 PolarHBondContact O-N 2.9Å; I76-Q78 VanDerWaalsContact C-N 3.3Å; I76-Q78 PolarHBondContact O-N 3.39Å
79	E	93.3	Very high	94	Very high	131 Å²	131	80.9 Å²	80.9	61%	0.612	40%	0.402	S	S	*	.	H	α-helix	trans	-78.7	-31.6	-173.2	-63.4	-61.2	144.8	0	0	113.1	L75	L75-E79 HydrophobicContact CD1-CG 3.78Å; L75-E79 HydrophobicContact CG-CG 4.25Å; L75-E79 WeakPolarHBondContact O-CB 3.26Å; L75-E79 VanDerWaalsContact O-CG 3.3Å; L75-E79 WeakPolarHBondContact O-CG 3.42Å; L75-E79 PolarHBondContact O-N 2.83Å
80	L	93.3	Very high	94.1	Very high	56 Å²	56	77.5 Å²	77.5	29%	0.293	39%	0.386	S	S	.	.	S	Bend	trans	-112.2	1.6	-176.5	-61.8	178.6	0	0	0	113.8	I76 V82 L102 L105	I76-L80 HydrophobicContact CG2-CD1 4.37Å; I76-L80 WeakPolarHBondContact O-CB 3.44Å; I76-L80 PolarHBondContact O-N 2.77Å; I76-L80 VanDerWaalsContact O-N 3.08Å; L80-V82 HydrophobicContact CB-CG1 4.15Å; L80-V82 HydrophobicContact CB-CG2 4.45Å; L80-V82 PolarHBondContact O-N 2.87Å; L80-L102 HydrophobicContact CD1-CD2 3.75Å; L80-L102 HydrophobicContact CG-CD2 4.32Å; L80-L105 HydrophobicContact CD1-CB 3.58Å; L80-L105 HydrophobicContact CD1-CD1 3.59Å; L80-L105 HydrophobicContact CD1-CG 4.21Å
81	E	92.8	Very high	94.1	Very high	182 Å²	182	71.9 Å²	71.9	85%	0.85	36%	0.355	S	S	*	.			trans	51.7	31.3	-179.1	-58.2	-169.6	150.8	0	0	114	C77	C77-E81 WeakPolarHBondContact O-CA 3.47Å; C77-E81 PolarHBondContact O-N 3.18Å
82	V	93.6	Very high	94	Very high	38 Å²	38	66.5 Å²	66.5	23%	0.23	33%	0.33	C	S	.	.			trans	-90	154.5	177.7	-63.1	0	0	0	0	111.7	I76 L80 T86 A87	I76-V82 HydrophobicContact CG2-CG2 3.62Å; L80-V82 HydrophobicContact CB-CG1 4.15Å; L80-V82 HydrophobicContact CB-CG2 4.45Å; L80-V82 PolarHBondContact O-N 2.87Å; V82-T86 HydrophobicContact CB-CG2 4.39Å; V82-A87 HydrophobicContact CG2-CB 4.11Å
83	S	95	Very high	93.8	Very high	64 Å²	64	68.4 Å²	68.4	45%	0.448	34%	0.338	S	S	.	.			trans	-61.9	149.2	174	86.6	0	0	0	0	111.4	L85 T86 A87	S83-L85 PolarHBondContact O-N 3.5Å; S83-L85 PolarHBondContact OG-N 3.11Å; S83-T86 WeakPolarHBondContact O-CA 3.39Å; S83-T86 WeakPolarHBondContact O-CB 3.35Å; S83-T86 PolarHBondContact O-N 3.33Å; S83-T86 PolarHBondContact OG-N 3.25Å; S83-T86 VanDerWaalsContact OG-N 3.12Å; S83-T86 PolarHBondContact OG-OG1 3.25Å; S83-A87 PolarHBondContact O-N 3.45Å
84	K	94.3	Very high	93.7	Very high	119 Å²	119	70.5 Å²	70.5	52%	0.517	35%	0.347	S	S	.	.	H	α-helix	trans	-53	-39.4	174.1	-175.2	178.5	175.4	-179.9	0	112.6	V73 T86 A87 E88	V73-K84 HydrophobicContact CG1-CG 3.88Å; K84-T86 VanDerWaalsContact C-N 3.34Å; K84-T86 PolarHBondContact O-N 3.22Å; K84-A87 PolarHBondContact O-N 3.36Å; K84-E88 WeakPolarHBondContact CE-OE1 3.46Å; K84-E88 HydrophobicContact CG-CG 4.44Å; K84-E88 IonicContact NZ-OE1 3.9Å; K84-E88 WeakPolarHBondContact O-CB 3.31Å; K84-E88 WeakPolarHBondContact O-CG 2.97Å; K84-E88 PolarHBondContact O-N 3.23Å
85	L	93.3	Very high	93.5	Very high	136 Å²	136	76.1 Å²	76.1	71%	0.712	37%	0.368	S	S	*	.	H	α-helix	trans	-63	-42	177.9	-175.9	68.6	0	0	0	111.4	S83 R89	S83-L85 PolarHBondContact O-N 3.5Å; S83-L85 PolarHBondContact OG-N 3.11Å; L85-R89 VanDerWaalsContact O-CB 3.25Å; L85-R89 WeakPolarHBondContact O-CB 3.13Å; L85-R89 PolarHBondContact O-N 3.19Å
86	T	93	Very high	93.2	Very high	50 Å²	50	73.6 Å²	73.6	31%	0.307	36%	0.359	S	S	.	.	H	α-helix	trans	-65.2	-49.2	176.4	-50.7	0	0	0	0	110.7	V82 S83 K84 E88 R89 Y90	V82-T86 HydrophobicContact CB-CG2 4.39Å; S83-T86 WeakPolarHBondContact O-CA 3.39Å; S83-T86 WeakPolarHBondContact O-CB 3.35Å; S83-T86 PolarHBondContact O-N 3.33Å; S83-T86 PolarHBondContact OG-N 3.25Å; S83-T86 VanDerWaalsContact OG-N 3.12Å; S83-T86 PolarHBondContact OG-OG1 3.25Å; K84-T86 VanDerWaalsContact C-N 3.34Å; K84-T86 PolarHBondContact O-N 3.22Å; T86-E88 PolarHBondContact O-N 2.96Å; T86-R89 PolarHBondContact O-N 3.27Å; T86-Y90 HydrophobicContact CG2-CD2 3.93Å; T86-Y90 HydrophobicContact CG2-CE2 3.91Å; T86-Y90 WeakPolarHBondContact O-CD2 3.29Å; T86-Y90 PolarHBondContact O-N 3.47Å
87	A	94	Very high	93.1	Very high	0 Å²	0	76.6 Å²	76.6	0%	0	38%	0.376	C	S	.	.	H	α-helix	trans	-58.2	-49	179.4	0	0	0	0	0	112.2	V73 I76 V82 S83 K84 R89 Y90 L91	V73-A87 HydrophobicContact CG1-CB 4.16Å; I76-A87 HydrophobicContact CB-CB 4.07Å; I76-A87 HydrophobicContact CG2-CB 3.63Å; V82-A87 HydrophobicContact CG2-CB 4.11Å; S83-A87 PolarHBondContact O-N 3.45Å; K84-A87 PolarHBondContact O-N 3.36Å; A87-R89 VanDerWaalsContact C-N 3.32Å; A87-R89 PolarHBondContact O-N 3.5Å; A87-Y90 PolarHBondContact O-N 2.99Å; A87-L91 WeakPolarHBondContact O-CB 3.32Å; A87-L91 WeakPolarHBondContact O-CG 3.45Å; A87-L91 PolarHBondContact O-N 2.64Å
88	E	93	Very high	93	Very high	53 Å²	53	76.5 Å²	76.5	25%	0.248	37%	0.374	C	S	.	.	H	α-helix	trans	-63	-38.8	177.7	-75.6	-175.1	-176.9	0	0	112.6	V73 K84 T86 K92	V73-E88 HydrophobicContact CG1-CG 3.89Å; V73-E88 HydrophobicContact CG2-CG 3.74Å; K84-E88 WeakPolarHBondContact CE-OE1 3.46Å; K84-E88 HydrophobicContact CG-CG 4.44Å; K84-E88 IonicContact NZ-OE1 3.9Å; K84-E88 WeakPolarHBondContact O-CB 3.31Å; K84-E88 WeakPolarHBondContact O-CG 2.97Å; K84-E88 PolarHBondContact O-N 3.23Å; T86-E88 PolarHBondContact O-N 2.96Å; E88-K92 WeakPolarHBondContact O-CB 3.49Å; E88-K92 VanDerWaalsContact O-CG 3.28Å; E88-K92 WeakPolarHBondContact O-CG 3.41Å; E88-K92 PolarHBondContact O-N 3.01Å
89	R	92.6	Very high	92.9	Very high	141 Å²	141	77.3 Å²	77.3	53%	0.532	38%	0.375	S	S	.	.	H	α-helix	trans	-61.7	-51.9	178	179.4	-178.5	165.5	-155.8	-11.3	110.6	M63 L85 T86 A87 K92 E93	M63-R89 HydrophobicContact CE-CG 4.13Å; L85-R89 VanDerWaalsContact O-CB 3.25Å; L85-R89 WeakPolarHBondContact O-CB 3.13Å; L85-R89 PolarHBondContact O-N 3.19Å; T86-R89 PolarHBondContact O-N 3.27Å; A87-R89 VanDerWaalsContact C-N 3.32Å; A87-R89 PolarHBondContact O-N 3.5Å; R89-K92 PolarHBondContact O-N 3.38Å; R89-K92 VanDerWaalsContact O-N 3.16Å; R89-E93 IonicContact CZ-OE1 3.38Å; R89-E93 IonicContact NE-OE1 2.84Å; R89-E93 PolarHBondContact NE-OE1 3.32Å; R89-E93 IonicContact NH2-OE1 3.04Å; R89-E93 PolarHBondContact NH2-OE1 3.5Å; R89-E93 WeakPolarHBondContact O-CG 3.44Å; R89-E93 PolarHBondContact O-N 3.28Å
90	Y	93.5	Very high	93	Very high	67 Å²	67	75.7 Å²	75.7	26%	0.263	37%	0.368	S	S	.	.	H	α-helix	trans	-63.8	-42.6	-179.8	-86.9	-101.6	0	0	0	111.9	T86 A87 K92 E93 H94 A104 L105	T86-Y90 HydrophobicContact CG2-CD2 3.93Å; T86-Y90 HydrophobicContact CG2-CE2 3.91Å; T86-Y90 WeakPolarHBondContact O-CD2 3.29Å; T86-Y90 PolarHBondContact O-N 3.47Å; A87-Y90 PolarHBondContact O-N 2.99Å; Y90-K92 VanDerWaalsContact C-N 3.26Å; Y90-K92 PolarHBondContact O-N 3.09Å; Y90-E93 PolarHBondContact O-N 3.19Å; Y90-E93 VanDerWaalsContact O-N 3.08Å; Y90-H94 PolarHBondContact O-CD2 3.2Å; Y90-H94 VanDerWaalsContact O-CD2 3.29Å; Y90-H94 PolarHBondContact O-N 3.09Å; Y90-A104 HydrophobicContact CD1-CB 4.44Å; Y90-L105 HydrophobicContact CD1-CD2 3.76Å; Y90-L105 HydrophobicContact CD1-CG 3.92Å; Y90-L105 HydrophobicContact CD2-CD2 3.84Å; Y90-L105 HydrophobicContact CE1-CD2 3.69Å; Y90-L105 HydrophobicContact CE1-CG 4.18Å; Y90-L105 HydrophobicContact CE2-CD2 3.78Å; Y90-L105 HydrophobicContact CG-CD2 3.82Å; Y90-L105 HydrophobicContact CG-CG 4.16Å
91	L	94.2	Very high	93	Very high	0 Å²	0	73 Å²	73	0%	0	35%	0.354	C	S	.	.	H	α-helix	trans	-57.5	-41	173.8	-80	168.8	0	0	0	111.7	V68 D72 V73 I76 A87 H94 Q95 G96 V98 T101	V68-L91 HydrophobicContact CB-CB 4.25Å; V68-L91 HydrophobicContact CB-CD1 4.41Å; V68-L91 HydrophobicContact CG1-CB 3.68Å; D72-L91 HydrophobicContact CB-CD1 4.03Å; D72-L91 HydrophobicContact CB-CD2 4.28Å; V73-L91 HydrophobicContact CB-CD1 4.3Å; V73-L91 HydrophobicContact CG2-CD1 3.5Å; V73-L91 VanDerWaalsContact CG2-CD1 3.5Å; I76-L91 HydrophobicContact CD1-CD1 3.74Å; I76-L91 HydrophobicContact CD1-CD2 3.78Å; I76-L91 HydrophobicContact CD1-CG 3.61Å; A87-L91 WeakPolarHBondContact O-CB 3.32Å; A87-L91 WeakPolarHBondContact O-CG 3.45Å; A87-L91 PolarHBondContact O-N 2.64Å; L91-H94 CarbonylContact O-C 3.44Å; L91-H94 PolarHBondContact O-N 3.44Å; L91-Q95 PolarHBondContact O-N 3.35Å; L91-G96 WeakPolarHBondContact O-CA 3.38Å; L91-G96 PolarHBondContact O-N 3.44Å; L91-V98 HydrophobicContact CD2-CG2 4.32Å; L91-T101 HydrophobicContact CD2-CG2 4.32Å; L91-T101 HydrophobicContact CG-CG2 4.27Å
92	K	93.1	Very high	93	Very high	42 Å²	42	66.7 Å²	66.7	18%	0.183	33%	0.326	C	S	.	.	H	α-helix	trans	-68.3	-37	175.4	-72.2	172.2	-176.4	172.6	0	112.5	M63 I66 V68 E88 R89 Y90 H94 Q95	M63-K92 HydrophobicContact CB-CB 4.12Å; M63-K92 HydrophobicContact CE-CB 3.88Å; M63-K92 WeakPolarHBondContact O-CD 3.15Å; I66-K92 HydrophobicContact CB-CG 4.5Å; I66-K92 WeakPolarHBondContact CD1-O 3.25Å; V68-K92 HydrophobicContact CG1-CG 3.89Å; E88-K92 WeakPolarHBondContact O-CB 3.49Å; E88-K92 VanDerWaalsContact O-CG 3.28Å; E88-K92 WeakPolarHBondContact O-CG 3.41Å; E88-K92 PolarHBondContact O-N 3.01Å; R89-K92 PolarHBondContact O-N 3.38Å; R89-K92 VanDerWaalsContact O-N 3.16Å; Y90-K92 VanDerWaalsContact C-N 3.26Å; Y90-K92 PolarHBondContact O-N 3.09Å; K92-H94 VanDerWaalsContact C-N 3.27Å; K92-H94 PolarHBondContact O-N 3.41Å; K92-Q95 PolarHBondContact O-N 2.96Å
93	E	91.3	Very high	93	Very high	65 Å²	65	67.7 Å²	67.7	30%	0.304	33%	0.332	S	S	.	.	H	α-helix	trans	-63.5	-34.6	175.1	-68	-176.1	-171.4	0	0	111.6	M63 R89 Y90	M63-E93 HydrophobicContact CE-CB 4.43Å; M63-E93 HydrophobicContact CE-CG 3.32Å; M63-E93 HydrophobicContact SD-CG 4.1Å; R89-E93 IonicContact CZ-OE1 3.38Å; R89-E93 IonicContact NE-OE1 2.84Å; R89-E93 PolarHBondContact NE-OE1 3.32Å; R89-E93 IonicContact NH2-OE1 3.04Å; R89-E93 PolarHBondContact NH2-OE1 3.5Å; R89-E93 WeakPolarHBondContact O-CG 3.44Å; R89-E93 PolarHBondContact O-N 3.28Å; Y90-E93 PolarHBondContact O-N 3.19Å; Y90-E93 VanDerWaalsContact O-N 3.08Å
94	H	92.8	Very high	92.9	Very high	48 Å²	48	65.8 Å²	65.8	22%	0.222	32%	0.32	C	S	.	.	T	Hydrogen-bonded Turn	trans	-99.9	25.9	179.9	-68.7	-80.4	0	0	0	114.3	Y90 L91 K92 G96 N97 E100 A104	Y90-H94 PolarHBondContact O-CD2 3.2Å; Y90-H94 VanDerWaalsContact O-CD2 3.29Å; Y90-H94 PolarHBondContact O-N 3.09Å; L91-H94 CarbonylContact O-C 3.44Å; L91-H94 PolarHBondContact O-N 3.44Å; K92-H94 VanDerWaalsContact C-N 3.27Å; K92-H94 PolarHBondContact O-N 3.41Å; H94-G96 PolarHBondContact O-N 2.85Å; H94-N97 VanDerWaalsContact O-CB 3.31Å; H94-N97 WeakPolarHBondContact O-CB 3.43Å; H94-N97 PolarHBondContact O-N 2.78Å; H94-E100 HydrophobicContact CB-CB 4.28Å; H94-E100 IonicContact ND1-OE2 3.57Å; H94-A104 WeakPolarHBondContact NE2-CB 3.48Å
95	Q	89	Confident	92.8	Very high	168 Å²	168	61.9 Å²	61.9	79%	0.785	31%	0.305	S	S	*	.	T	Hydrogen-bonded Turn	trans	56.6	26	174.2	-53	-177.9	12.6	0	0	115.2	L91 K92	L91-Q95 PolarHBondContact O-N 3.35Å; K92-Q95 PolarHBondContact O-N 2.96Å
96	G	89.6	Confident	92.6	Very high	19 Å²	19	59.9 Å²	59.9	20%	0.196	30%	0.301	C	S	.	.	T	Hydrogen-bonded Turn	trans	81.1	10.9	-177.3	0	0	0	0	0	114.4	L91 H94 V98	L91-G96 WeakPolarHBondContact O-CA 3.38Å; L91-G96 PolarHBondContact O-N 3.44Å; H94-G96 PolarHBondContact O-N 2.85Å; G96-V98 PolarHBondContact O-N 3.37Å
97	N	93.4	Very high	92	Very high	63 Å²	63	68 Å²	68	34%	0.337	33%	0.332	S	S	.	.			trans	-80.3	108.6	176.1	-172.2	-24.4	0	0	0	110.9	H94 F99 E100 T101	H94-N97 VanDerWaalsContact O-CB 3.31Å; H94-N97 WeakPolarHBondContact O-CB 3.43Å; H94-N97 PolarHBondContact O-N 2.78Å; N97-F99 PolarHBondContact O-N 2.92Å; N97-F99 PolarHBondContact OD1-N 3.48Å; N97-E100 HydrophobicContact CB-CB 4.17Å; N97-E100 HydrophobicContact CB-CG 4.38Å; N97-E100 PolarHBondContact ND2-OE1 3.43Å; N97-E100 VanDerWaalsContact ND2-OE1 3.16Å; N97-E100 PolarHBondContact OD1-N 3.27Å; N97-T101 WeakPolarHBondContact O-CB 3.43Å; N97-T101 PolarHBondContact O-N 3Å; N97-T101 PolarHBondContact O-OG1 3.34Å
98	V	93.3	Very high	91.9	Very high	30 Å²	30	71.5 Å²	71.5	18%	0.182	35%	0.349	C	S	.	.	H	α-helix	trans	-62.1	-42.6	179.5	-173.6	0	0	0	0	112.1	D72 L75 L91 G96 T101 L102	D72-V98 HydrophobicContact CB-CG2 3.54Å; D72-V98 WeakPolarHBondContact OD1-CG2 3.28Å; D72-V98 WeakPolarHBondContact OD2-CG2 3.41Å; L75-V98 HydrophobicContact CD2-CG1 4.19Å; L91-V98 HydrophobicContact CD2-CG2 4.32Å; G96-V98 PolarHBondContact O-N 3.37Å; V98-T101 PolarHBondContact O-N 3.23Å; V98-L102 HydrophobicContact CG1-CD1 3.9Å; V98-L102 HydrophobicContact CG1-CG 4.23Å; V98-L102 VanDerWaalsContact O-CG 3.31Å; V98-L102 WeakPolarHBondContact O-CG 3.42Å; V98-L102 PolarHBondContact O-N 3.42Å
99	F	93.4	Very high	91.8	Very high	151 Å²	151	72.4 Å²	72.4	66%	0.662	35%	0.354	S	S	*	.	H	α-helix	trans	-64.5	-48.9	-177	178	-97	0	0	0	111.3	N97 T101 L102 V103	N97-F99 PolarHBondContact O-N 2.92Å; N97-F99 PolarHBondContact OD1-N 3.48Å; F99-T101 VanDerWaalsContact C-N 3.28Å; F99-T101 PolarHBondContact O-N 2.96Å; F99-L102 PolarHBondContact O-N 2.94Å; F99-V103 HydrophobicContact CD1-CG2 4.33Å; F99-V103 HydrophobicContact CE1-CG2 3.96Å; F99-V103 HydrophobicContact CE2-CG2 4.3Å; F99-V103 HydrophobicContact CZ-CG2 3.94Å; F99-V103 VanDerWaalsContact O-CG2 3.31Å; F99-V103 WeakPolarHBondContact O-CG2 3.48Å; F99-V103 PolarHBondContact O-N 3.43Å
100	E	93.8	Very high	91.7	Very high	97 Å²	97	68.6 Å²	68.6	45%	0.453	34%	0.344	S	S	.	.	H	α-helix	trans	-62.3	-38.4	176.5	-73.7	-179.7	-155.3	0	0	112	H94 N97 V103 A104	H94-E100 HydrophobicContact CB-CB 4.28Å; H94-E100 IonicContact ND1-OE2 3.57Å; N97-E100 HydrophobicContact CB-CB 4.17Å; N97-E100 HydrophobicContact CB-CG 4.38Å; N97-E100 PolarHBondContact ND2-OE1 3.43Å; N97-E100 VanDerWaalsContact ND2-OE1 3.16Å; N97-E100 PolarHBondContact OD1-N 3.27Å; E100-V103 PolarHBondContact O-N 3.48Å; E100-A104 VanDerWaalsContact O-CB 3.29Å; E100-A104 WeakPolarHBondContact O-CB 3.5Å; E100-A104 PolarHBondContact O-N 3.4Å
101	T	93.5	Very high	91.6	Very high	0 Å²	0	68.7 Å²	68.7	0%	0	35%	0.349	C	S	.	.	H	α-helix	trans	-62.6	-46.8	177	-61.1	0	0	0	0	111.7	I76 L91 N97 V98 F99 A104 L105	I76-T101 HydrophobicContact CD1-CG2 3.59Å; L91-T101 HydrophobicContact CD2-CG2 4.32Å; L91-T101 HydrophobicContact CG-CG2 4.27Å; N97-T101 WeakPolarHBondContact O-CB 3.43Å; N97-T101 PolarHBondContact O-N 3Å; N97-T101 PolarHBondContact O-OG1 3.34Å; V98-T101 PolarHBondContact O-N 3.23Å; F99-T101 VanDerWaalsContact C-N 3.28Å; F99-T101 PolarHBondContact O-N 2.96Å; T101-A104 PolarHBondContact O-N 2.86Å; T101-L105 HydrophobicContact CG2-CD1 3.86Å; T101-L105 WeakPolarHBondContact O-CG 3.21Å; T101-L105 PolarHBondContact O-N 3.41Å
102	L	93.9	Very high	91.5	Very high	50 Å²	50	73 Å²	73	26%	0.262	37%	0.371	S	S	.	.	H	α-helix	trans	-63.5	-43.3	177.4	-71.1	173	0	0	0	111.3	I76 L80 V98 F99 A104 L105 C106	I76-L102 HydrophobicContact CG1-CD2 4.01Å; L80-L102 HydrophobicContact CD1-CD2 3.75Å; L80-L102 HydrophobicContact CG-CD2 4.32Å; V98-L102 HydrophobicContact CG1-CD1 3.9Å; V98-L102 HydrophobicContact CG1-CG 4.23Å; V98-L102 VanDerWaalsContact O-CG 3.31Å; V98-L102 WeakPolarHBondContact O-CG 3.42Å; V98-L102 PolarHBondContact O-N 3.42Å; F99-L102 PolarHBondContact O-N 2.94Å; L102-A104 VanDerWaalsContact C-N 3.28Å; L102-A104 PolarHBondContact O-N 3.46Å; L102-L105 PolarHBondContact O-N 3.25Å; L102-C106 WeakPolarHBondContact O-CB 3.36Å; L102-C106 PolarHBondContact O-N 2.99Å; L102-C106 PolarHBondContact O-SG 3.02Å
103	V	94	Very high	91.4	Very high	58 Å²	58	75.1 Å²	75.1	35%	0.352	38%	0.383	S	S	.	.	H	α-helix	trans	-62.6	-36.4	175.6	171.8	0	0	0	0	111.6	F99 E100 K107	F99-V103 HydrophobicContact CD1-CG2 4.33Å; F99-V103 HydrophobicContact CE1-CG2 3.96Å; F99-V103 HydrophobicContact CE2-CG2 4.3Å; F99-V103 HydrophobicContact CZ-CG2 3.94Å; F99-V103 VanDerWaalsContact O-CG2 3.31Å; F99-V103 WeakPolarHBondContact O-CG2 3.48Å; F99-V103 PolarHBondContact O-N 3.43Å; E100-V103 PolarHBondContact O-N 3.48Å; V103-K107 WeakPolarHBondContact O-CG 3.42Å
104	A	92.8	Very high	91.4	Very high	25 Å²	25	75.8 Å²	75.8	21%	0.207	39%	0.389	C	S	.	.	H	α-helix	trans	-72.9	-33.2	178.1	0	0	0	0	0	113	Y90 H94 E100 T101 L102	Y90-A104 HydrophobicContact CD1-CB 4.44Å; H94-A104 WeakPolarHBondContact NE2-CB 3.48Å; E100-A104 VanDerWaalsContact O-CB 3.29Å; E100-A104 WeakPolarHBondContact O-CB 3.5Å; E100-A104 PolarHBondContact O-N 3.4Å; T101-A104 PolarHBondContact O-N 2.86Å; L102-A104 VanDerWaalsContact C-N 3.28Å; L102-A104 PolarHBondContact O-N 3.46Å
105	L	90.6	Very high	91.3	Very high	37 Å²	37	77.9 Å²	77.9	19%	0.194	40%	0.402	C	S	.	.	H	α-helix	trans	-79.8	-25.3	178.3	-73.9	168.4	0	0	0	113.4	I76 L80 Y90 T101 L102 K107	I76-L105 HydrophobicContact CG2-CD1 3.74Å; L80-L105 HydrophobicContact CD1-CB 3.58Å; L80-L105 HydrophobicContact CD1-CD1 3.59Å; L80-L105 HydrophobicContact CD1-CG 4.21Å; Y90-L105 HydrophobicContact CD1-CD2 3.76Å; Y90-L105 HydrophobicContact CD1-CG 3.92Å; Y90-L105 HydrophobicContact CD2-CD2 3.84Å; Y90-L105 HydrophobicContact CE1-CD2 3.69Å; Y90-L105 HydrophobicContact CE1-CG 4.18Å; Y90-L105 HydrophobicContact CE2-CD2 3.78Å; Y90-L105 HydrophobicContact CG-CD2 3.82Å; Y90-L105 HydrophobicContact CG-CG 4.16Å; T101-L105 HydrophobicContact CG2-CD1 3.86Å; T101-L105 WeakPolarHBondContact O-CG 3.21Å; T101-L105 PolarHBondContact O-N 3.41Å; L102-L105 PolarHBondContact O-N 3.25Å; L105-K107 VanDerWaalsContact C-N 3.32Å
106	C	88.8	Confident	91.5	Very high	94 Å²	94	70.4 Å²	70.4	64%	0.635	37%	0.37	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.1	1.8	176.4	-66.7	0	0	0	0	114.1	L102	L102-C106 WeakPolarHBondContact O-CB 3.36Å; L102-C106 PolarHBondContact O-N 2.99Å; L102-C106 PolarHBondContact O-SG 3.02Å
107	K	80.3	Confident	91.6	Very high	221 Å²	221	75.1 Å²	75.1	96%	0.961	39%	0.386	S	S	*	.			trans	-96.7	0	175.5	-79.3	175.6	-178.7	-179.7	0	110.9	V103 L105	V103-K107 WeakPolarHBondContact O-CG 3.42Å; L105-K107 VanDerWaalsContact C-N 3.32Å

Retrieved 107 of 107 residues in 20.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).