G4VQS3_SCHMA Loading...

Clathrin light chain

AlphaFold DB , UniProt , Accession G4VQS3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 94 aa.

						>G4VQS3_SCHMA|G4VQS3
MSQTYEWKSEVIKKQAQKEREKDVEKRWEDVMSKNGEGAPEWLKEAAMRKKQKQILKLKDENLAPWLKEVQKKNAGLARRISDATNSEIESNLS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.2	Low	71.7	Confident	215 Å²	215	121.2 Å²	121.2	100%	1.059	60%	0.601	S	S	*	*				0	4.5	0	-60.7	-150.3	-147.9	0	0	114	T4	M1-T4 PolarHBondContact O-OG1 2.93Å; M1-T4 VanDerWaalsContact O-OG1 3.13Å
2	S	59.9	Low	72.8	Confident	95 Å²	95	120.8 Å²	120.8	66%	0.664	60%	0.601	S	S	*	*			trans	-80.4	-30.9	-172.9	-50.8	0	0	0	0	114.9	T4 Y5	S2-T4 VanDerWaalsContact C-N 3.27Å; S2-T4 PolarHBondContact O-N 3.13Å; S2-Y5 PolarHBondContact O-N 3.47Å
3	Q	59.8	Low	73.8	Confident	166 Å²	166	123.4 Å²	123.4	78%	0.776	61%	0.606	S	S	*	*	H	α-helix	trans	-63.8	-27.2	-175.3	-121.2	172.4	-7.1	0	0	114.1	Y5	Q3-Y5 VanDerWaalsContact C-N 3.26Å; Q3-Y5 PolarHBondContact O-N 3.21Å
4	T	61.5	Low	74.6	Confident	84 Å²	84	124.2 Å²	124.2	52%	0.515	61%	0.605	S	S	.	*	H	α-helix	trans	-73.2	-13.9	-178.8	43	0	0	0	0	114.2	M1 S2 W7	M1-T4 PolarHBondContact O-OG1 2.93Å; M1-T4 VanDerWaalsContact O-OG1 3.13Å; S2-T4 VanDerWaalsContact C-N 3.27Å; S2-T4 PolarHBondContact O-N 3.13Å; T4-W7 VanDerWaalsContact O-CD1 3.27Å; T4-W7 PolarHBondContact O-NE1 2.98Å
5	Y	66.9	Low	75.4	Confident	153 Å²	153	122 Å²	122	60%	0.6	59%	0.593	S	S	*	*	H	α-helix	trans	-101.7	-16.4	-178.4	-67.2	-80.9	0	0	0	113.8	S2 Q3 S9	S2-Y5 PolarHBondContact O-N 3.47Å; Q3-Y5 VanDerWaalsContact C-N 3.26Å; Q3-Y5 PolarHBondContact O-N 3.21Å; Y5-S9 PolarHBondContact O-N 2.88Å; Y5-S9 PolarHBondContact O-OG 2.95Å
6	E	74.9	Confident	76	Confident	116 Å²	116	116.6 Å²	116.6	54%	0.542	57%	0.574	S	S	.	*	H	α-helix	trans	-66.9	-47.6	-177.8	-72.2	179.6	173.2	0	0	112	K8 S9 E10	E6-K8 VanDerWaalsContact C-N 3.29Å; E6-K8 PolarHBondContact O-N 3.26Å; E6-S9 WeakPolarHBondContact O-CB 3.29Å; E6-S9 PolarHBondContact O-N 3.31Å; E6-E10 PolarHBondContact O-N 3.02Å
7	W	80	Confident	76.5	Confident	146 Å²	146	114.4 Å²	114.4	55%	0.553	56%	0.562	S	S	*	*	H	α-helix	trans	-61.9	-34.9	-179.5	74.5	-92.5	0	0	0	112.7	T4 S9 E10 V11	T4-W7 VanDerWaalsContact O-CD1 3.27Å; T4-W7 PolarHBondContact O-NE1 2.98Å; W7-S9 VanDerWaalsContact C-N 3.32Å; W7-S9 PolarHBondContact O-N 3.32Å; W7-E10 PolarHBondContact O-N 3.27Å; W7-V11 HydrophobicContact CE3-CG2 3.94Å; W7-V11 HydrophobicContact CZ3-CG2 4.31Å; W7-V11 VanDerWaalsContact O-CG2 3.29Å; W7-V11 WeakPolarHBondContact O-CG2 3.26Å; W7-V11 PolarHBondContact O-N 3.48Å
8	K	81.3	Confident	76.9	Confident	106 Å²	106	114.8 Å²	114.8	46%	0.461	56%	0.56	S	S	.	*	H	α-helix	trans	-62.7	-43	175.6	-70.6	-173.4	178.1	-178.8	0	110.6	E6 V11 I12	E6-K8 VanDerWaalsContact C-N 3.29Å; E6-K8 PolarHBondContact O-N 3.26Å; K8-V11 PolarHBondContact O-N 3.19Å; K8-I12 WeakPolarHBondContact O-CD1 3.48Å; K8-I12 VanDerWaalsContact O-CG1 3.26Å; K8-I12 WeakPolarHBondContact O-CG1 3.39Å; K8-I12 PolarHBondContact O-N 3.38Å
9	S	82.8	Confident	77.4	Confident	64 Å²	64	114.5 Å²	114.5	45%	0.448	56%	0.557	S	S	.	*	H	α-helix	trans	-65.5	-40.2	177.3	-57.8	0	0	0	0	111.6	Y5 E6 W7 I12 K13	Y5-S9 PolarHBondContact O-N 2.88Å; Y5-S9 PolarHBondContact O-OG 2.95Å; E6-S9 WeakPolarHBondContact O-CB 3.29Å; E6-S9 PolarHBondContact O-N 3.31Å; W7-S9 VanDerWaalsContact C-N 3.32Å; W7-S9 PolarHBondContact O-N 3.32Å; S9-I12 PolarHBondContact O-N 3.35Å; S9-K13 WeakPolarHBondContact O-CG 3.5Å; S9-K13 PolarHBondContact O-N 3.3Å
10	E	83.4	Confident	77.6	Confident	108 Å²	108	115.9 Å²	115.9	51%	0.505	56%	0.557	S	S	.	*	H	α-helix	trans	-63.8	-43.3	173.9	-71	-174.4	-173.6	0	0	112.9	E6 W7 K13 K14	E6-E10 PolarHBondContact O-N 3.02Å; W7-E10 PolarHBondContact O-N 3.27Å; E10-K13 PolarHBondContact O-N 2.95Å; E10-K14 WeakPolarHBondContact O-CB 3.35Å; E10-K14 WeakPolarHBondContact O-CG 3.49Å; E10-K14 PolarHBondContact O-N 3.38Å
11	V	84.7	Confident	77.9	Confident	80 Å²	80	115.3 Å²	115.3	49%	0.485	55%	0.553	S	S	.	*	H	α-helix	trans	-62.2	-44.5	177.7	169.6	0	0	0	0	110.6	W7 K8 K13 K14 Q15	W7-V11 HydrophobicContact CE3-CG2 3.94Å; W7-V11 HydrophobicContact CZ3-CG2 4.31Å; W7-V11 VanDerWaalsContact O-CG2 3.29Å; W7-V11 WeakPolarHBondContact O-CG2 3.26Å; W7-V11 PolarHBondContact O-N 3.48Å; K8-V11 PolarHBondContact O-N 3.19Å; V11-K13 VanDerWaalsContact C-N 3.35Å; V11-K13 PolarHBondContact O-N 3.05Å; V11-K14 PolarHBondContact O-N 3.28Å; V11-Q15 WeakPolarHBondContact O-CB 3.46Å; V11-Q15 PolarHBondContact O-N 3.28Å
12	I	85.3	Confident	79.4	Confident	117 Å²	117	111.8 Å²	111.8	60%	0.6	53%	0.532	S	S	*	.	H	α-helix	trans	-61	-44.4	176.1	-67.2	164.3	0	0	0	110.7	K8 S9 K14 Q15 A16	K8-I12 WeakPolarHBondContact O-CD1 3.48Å; K8-I12 VanDerWaalsContact O-CG1 3.26Å; K8-I12 WeakPolarHBondContact O-CG1 3.39Å; K8-I12 PolarHBondContact O-N 3.38Å; S9-I12 PolarHBondContact O-N 3.35Å; I12-K14 PolarHBondContact O-N 3.49Å; I12-Q15 PolarHBondContact O-N 3Å; I12-A16 WeakPolarHBondContact O-CB 3.38Å; I12-A16 PolarHBondContact O-N 2.86Å
13	K	85.7	Confident	80.7	Confident	154 Å²	154	110.6 Å²	110.6	67%	0.67	52%	0.518	S	S	*	.	H	α-helix	trans	-61.1	-44.5	175.8	-75.8	177.8	-177.9	179	0	112.2	S9 E10 V11 Q15 A16 Q17	S9-K13 WeakPolarHBondContact O-CG 3.5Å; S9-K13 PolarHBondContact O-N 3.3Å; E10-K13 PolarHBondContact O-N 2.95Å; V11-K13 VanDerWaalsContact C-N 3.35Å; V11-K13 PolarHBondContact O-N 3.05Å; K13-Q15 VanDerWaalsContact C-N 3.34Å; K13-A16 PolarHBondContact O-N 3.5Å; K13-Q17 WeakPolarHBondContact O-CB 3.39Å; K13-Q17 PolarHBondContact O-N 3.48Å
14	K	85.7	Confident	81.9	Confident	135 Å²	135	107.2 Å²	107.2	59%	0.587	51%	0.509	S	S	*	.	H	α-helix	trans	-64	-39.2	176.9	-74.3	-177.6	-174.9	177.2	0	111.7	E10 V11 I12 Q17 K18	E10-K14 WeakPolarHBondContact O-CB 3.35Å; E10-K14 WeakPolarHBondContact O-CG 3.49Å; E10-K14 PolarHBondContact O-N 3.38Å; V11-K14 PolarHBondContact O-N 3.28Å; I12-K14 PolarHBondContact O-N 3.49Å; K14-Q17 PolarHBondContact O-N 2.86Å; K14-K18 WeakPolarHBondContact O-CG 3.44Å; K14-K18 PolarHBondContact O-N 3.47Å
15	Q	85.3	Confident	83.1	Confident	91 Å²	91	109 Å²	109	43%	0.425	51%	0.511	S	S	.	.	H	α-helix	trans	-65.7	-48.2	177.5	-175.6	58.8	28.5	0	0	111.2	V11 I12 K13 Q17 K18 E19	V11-Q15 WeakPolarHBondContact O-CB 3.46Å; V11-Q15 PolarHBondContact O-N 3.28Å; I12-Q15 PolarHBondContact O-N 3Å; K13-Q15 VanDerWaalsContact C-N 3.34Å; Q15-Q17 VanDerWaalsContact C-N 3.25Å; Q15-Q17 PolarHBondContact O-N 2.97Å; Q15-K18 PolarHBondContact O-N 3.17Å; Q15-E19 PolarHBondContact NE2-OE1 2.93Å; Q15-E19 WeakPolarHBondContact O-CG 3.41Å; Q15-E19 PolarHBondContact O-N 3.32Å
16	A	85.8	Confident	84.1	Confident	36 Å²	36	108 Å²	108	30%	0.298	51%	0.51	S	S	.	.	H	α-helix	trans	-59.9	-36.7	175.1	0	0	0	0	0	112.1	I12 K13 E19 R20	I12-A16 WeakPolarHBondContact O-CB 3.38Å; I12-A16 PolarHBondContact O-N 2.86Å; K13-A16 PolarHBondContact O-N 3.5Å; A16-E19 PolarHBondContact O-N 2.95Å; A16-R20 WeakPolarHBondContact O-CG 3.39Å; A16-R20 PolarHBondContact O-N 3.36Å; A16-R20 VanDerWaalsContact O-N 3.09Å
17	Q	84.4	Confident	84.6	Confident	79 Å²	79	109.9 Å²	109.9	37%	0.369	51%	0.512	S	S	.	.	H	α-helix	trans	-65.3	-46.6	174.6	-179	60.8	20.8	0	0	112.1	K13 K14 Q15 E19 R20 E21	K13-Q17 WeakPolarHBondContact O-CB 3.39Å; K13-Q17 PolarHBondContact O-N 3.48Å; K14-Q17 PolarHBondContact O-N 2.86Å; Q15-Q17 VanDerWaalsContact C-N 3.25Å; Q15-Q17 PolarHBondContact O-N 2.97Å; Q17-E19 VanDerWaalsContact C-N 3.27Å; Q17-E19 PolarHBondContact O-N 3.09Å; Q17-R20 WeakPolarHBondContact O-CB 3.34Å; Q17-R20 PolarHBondContact O-N 3Å; Q17-E21 WeakPolarHBondContact CG-OE1 3.37Å; Q17-E21 PolarHBondContact NE2-OE1 3.27Å; Q17-E21 WeakPolarHBondContact O-CG 3.48Å; Q17-E21 PolarHBondContact O-N 3.4Å
18	K	84.2	Confident	84.8	Confident	121 Å²	121	105.9 Å²	105.9	53%	0.526	50%	0.497	S	S	.	.	H	α-helix	trans	-60	-37.9	176.1	-75.7	-179.7	178.3	-175.8	0	112.3	K14 Q15 E21 K22	K14-K18 WeakPolarHBondContact O-CG 3.44Å; K14-K18 PolarHBondContact O-N 3.47Å; Q15-K18 PolarHBondContact O-N 3.17Å; K18-E21 PolarHBondContact O-N 3.2Å; K18-K22 WeakPolarHBondContact O-CG 3.43Å; K18-K22 PolarHBondContact O-N 2.96Å
19	E	84.9	Confident	85.1	Confident	109 Å²	109	106.3 Å²	106.3	51%	0.509	50%	0.501	S	S	.	.	H	α-helix	trans	-66.4	-41.2	176.9	-75.4	169.6	-167.9	0	0	111.9	Q15 A16 Q17 K22 D23	Q15-E19 PolarHBondContact NE2-OE1 2.93Å; Q15-E19 WeakPolarHBondContact O-CG 3.41Å; Q15-E19 PolarHBondContact O-N 3.32Å; A16-E19 PolarHBondContact O-N 2.95Å; Q17-E19 VanDerWaalsContact C-N 3.27Å; Q17-E19 PolarHBondContact O-N 3.09Å; E19-K22 PolarHBondContact O-N 3.03Å; E19-D23 PolarHBondContact O-N 3.03Å
20	R	81.7	Confident	85.4	Confident	143 Å²	143	107 Å²	107	54%	0.54	50%	0.499	S	S	.	.	H	α-helix	trans	-61.4	-43.2	172.3	-72.7	-172.4	-67.2	-114.8	4.6	112.3	A16 Q17 D23 V24	A16-R20 WeakPolarHBondContact O-CG 3.39Å; A16-R20 PolarHBondContact O-N 3.36Å; A16-R20 VanDerWaalsContact O-N 3.09Å; Q17-R20 WeakPolarHBondContact O-CB 3.34Å; Q17-R20 PolarHBondContact O-N 3Å; R20-D23 PolarHBondContact O-N 3.2Å; R20-V24 WeakPolarHBondContact O-CG2 3.38Å; R20-V24 PolarHBondContact O-N 3.48Å
21	E	84.8	Confident	85.6	Confident	104 Å²	104	103.3 Å²	103.3	49%	0.486	48%	0.484	S	S	.	.	H	α-helix	trans	-62.4	-43.4	178.4	-74.4	166.6	-171.2	0	0	111.6	Q17 K18 D23 V24 E25	Q17-E21 WeakPolarHBondContact CG-OE1 3.37Å; Q17-E21 PolarHBondContact NE2-OE1 3.27Å; Q17-E21 WeakPolarHBondContact O-CG 3.48Å; Q17-E21 PolarHBondContact O-N 3.4Å; K18-E21 PolarHBondContact O-N 3.2Å; E21-D23 VanDerWaalsContact C-N 3.34Å; E21-D23 PolarHBondContact O-N 2.88Å; E21-V24 PolarHBondContact O-N 3.46Å; E21-E25 PolarHBondContact O-N 2.97Å
22	K	84.9	Confident	85.8	Confident	141 Å²	141	100.3 Å²	100.3	61%	0.613	47%	0.465	S	S	*	.	H	α-helix	trans	-61.6	-39.6	174.5	-74.2	179.1	179.4	-173.4	0	112.8	K18 E19 E25 K26	K18-K22 WeakPolarHBondContact O-CG 3.43Å; K18-K22 PolarHBondContact O-N 2.96Å; E19-K22 PolarHBondContact O-N 3.03Å; K22-E25 PolarHBondContact O-N 3.45Å; K22-K26 WeakPolarHBondContact O-CB 3.41Å; K22-K26 PolarHBondContact O-N 3.4Å
23	D	87.4	Confident	85.9	Confident	69 Å²	69	98.4 Å²	98.4	37%	0.369	46%	0.462	S	S	.	.	H	α-helix	trans	-65.2	-42.2	177.2	-176	55.8	0	0	0	111.5	E19 R20 E21 K26 R27	E19-D23 PolarHBondContact O-N 3.03Å; R20-D23 PolarHBondContact O-N 3.2Å; E21-D23 VanDerWaalsContact C-N 3.34Å; E21-D23 PolarHBondContact O-N 2.88Å; D23-K26 PolarHBondContact O-N 3.18Å; D23-R27 WeakPolarHBondContact O-CB 3.48Å; D23-R27 VanDerWaalsContact O-CG 3.28Å; D23-R27 WeakPolarHBondContact O-CG 3.42Å; D23-R27 PolarHBondContact O-N 3.45Å; D23-R27 IonicContact OD1-NE 3.06Å; D23-R27 PolarHBondContact OD1-NE 3.38Å; D23-R27 IonicContact OD1-NH2 2.74Å; D23-R27 IonicContact OD2-CZ 3.85Å; D23-R27 IonicContact OD2-NE 3.25Å; D23-R27 PolarHBondContact OD2-NE 2.93Å; D23-R27 IonicContact OD2-NH2 3.21Å; D23-R27 PolarHBondContact OD2-NH2 3.38Å
24	V	85	Confident	86	Confident	96 Å²	96	96.9 Å²	96.9	58%	0.582	46%	0.455	S	S	*	.	H	α-helix	trans	-64.1	-43.7	175.9	172.8	0	0	0	0	111.4	R20 E21 R27 W28	R20-V24 WeakPolarHBondContact O-CG2 3.38Å; R20-V24 PolarHBondContact O-N 3.48Å; E21-V24 PolarHBondContact O-N 3.46Å; V24-R27 PolarHBondContact O-N 2.87Å; V24-W28 WeakPolarHBondContact O-CB 3.49Å; V24-W28 PolarHBondContact O-N 2.93Å
25	E	86.1	Confident	85.8	Confident	122 Å²	122	94.3 Å²	94.3	57%	0.57	45%	0.448	S	S	*	.	H	α-helix	trans	-62.6	-44.8	178.4	-171.5	164	-143.5	0	0	111.4	E21 K22 W28 E29	E21-E25 PolarHBondContact O-N 2.97Å; K22-E25 PolarHBondContact O-N 3.45Å; E25-W28 WeakPolarHBondContact O-CB 3.28Å; E25-W28 PolarHBondContact O-N 3.45Å; E25-E29 WeakPolarHBondContact O-CG 3.48Å; E25-E29 PolarHBondContact O-N 2.8Å
26	K	87.9	Confident	85.6	Confident	131 Å²	131	90 Å²	90	57%	0.57	43%	0.428	S	S	*	.	H	α-helix	trans	-62.1	-45.7	175.6	-171.2	-179.9	-179.3	-177.9	0	112.4	K22 D23 W28 E29 D30	K22-K26 WeakPolarHBondContact O-CB 3.41Å; K22-K26 PolarHBondContact O-N 3.4Å; D23-K26 PolarHBondContact O-N 3.18Å; K26-W28 VanDerWaalsContact C-N 3.26Å; K26-W28 PolarHBondContact O-N 2.9Å; K26-E29 WeakPolarHBondContact O-CB 3.25Å; K26-E29 PolarHBondContact O-N 3.36Å; K26-D30 PolarHBondContact O-N 2.74Å
27	R	84.9	Confident	85.4	Confident	156 Å²	156	95.6 Å²	95.6	59%	0.589	45%	0.448	S	S	*	.	H	α-helix	trans	-60.8	-38.9	175	-73	176.3	-166.9	-159	7.4	111.4	D23 V24 D30 V31	D23-R27 WeakPolarHBondContact O-CB 3.48Å; D23-R27 VanDerWaalsContact O-CG 3.28Å; D23-R27 WeakPolarHBondContact O-CG 3.42Å; D23-R27 PolarHBondContact O-N 3.45Å; D23-R27 IonicContact OD1-NE 3.06Å; D23-R27 PolarHBondContact OD1-NE 3.38Å; D23-R27 IonicContact OD1-NH2 2.74Å; D23-R27 IonicContact OD2-CZ 3.85Å; D23-R27 IonicContact OD2-NE 3.25Å; D23-R27 PolarHBondContact OD2-NE 2.93Å; D23-R27 IonicContact OD2-NH2 3.21Å; D23-R27 PolarHBondContact OD2-NH2 3.38Å; V24-R27 PolarHBondContact O-N 2.87Å; R27-D30 PolarHBondContact O-N 3.31Å; R27-V31 VanDerWaalsContact O-CG2 3.25Å; R27-V31 WeakPolarHBondContact O-CG2 3.46Å; R27-V31 PolarHBondContact O-N 2.94Å
28	W	85.5	Confident	85.3	Confident	61 Å²	61	96 Å²	96	23%	0.231	47%	0.474	C	S	.	.	H	α-helix	trans	-65.2	-41.7	176.1	177.8	-100.8	0	0	0	112	V24 E25 K26 D30 V31 M32 L43 A46 A47 K50	V24-W28 WeakPolarHBondContact O-CB 3.49Å; V24-W28 PolarHBondContact O-N 2.93Å; E25-W28 WeakPolarHBondContact O-CB 3.28Å; E25-W28 PolarHBondContact O-N 3.45Å; K26-W28 VanDerWaalsContact C-N 3.26Å; K26-W28 PolarHBondContact O-N 2.9Å; W28-D30 VanDerWaalsContact C-N 3.33Å; W28-V31 HydrophobicContact CZ3-CG1 4.36Å; W28-V31 PolarHBondContact O-N 3.37Å; W28-M32 HydrophobicContact CD2-CG 4.23Å; W28-M32 HydrophobicContact CG-CG 4.5Å; W28-M32 HydrophobicContact CH2-SD 4.28Å; W28-M32 HydrophobicContact CZ2-CG 3.83Å; W28-M32 HydrophobicContact CZ2-SD 3.53Å; W28-M32 VanDerWaalsContact CZ2-SD 3.53Å; W28-M32 WeakPolarHBondContact O-CB 3.26Å; W28-M32 VanDerWaalsContact O-CG 3.23Å; W28-M32 WeakPolarHBondContact O-CG 3.41Å; W28-M32 PolarHBondContact O-N 3.46Å; W28-L43 HydrophobicContact CE3-CD2 4.13Å; W28-L43 HydrophobicContact CZ3-CD2 3.63Å; W28-A46 HydrophobicContact CH2-CB 4.02Å; W28-A47 HydrophobicContact CH2-CB 3.97Å; W28-A47 HydrophobicContact CZ2-CB 4.48Å; W28-A47 HydrophobicContact CZ3-CB 4.48Å; W28-K50 HydrophobicContact CZ2-CB 4.34Å; W28-K50 HydrophobicContact CZ2-CD 3.6Å; W28-K50 VanDerWaalsContact NE1-NZ 3.12Å
29	E	87.7	Confident	85.4	Confident	116 Å²	116	91.3 Å²	91.3	54%	0.542	46%	0.458	S	S	.	.	H	α-helix	trans	-61	-41.3	173.3	-73	177.6	173.2	0	0	112.1	E25 K26 M32 S33	E25-E29 WeakPolarHBondContact O-CG 3.48Å; E25-E29 PolarHBondContact O-N 2.8Å; K26-E29 WeakPolarHBondContact O-CB 3.25Å; K26-E29 PolarHBondContact O-N 3.36Å; E29-M32 PolarHBondContact O-N 3.36Å; E29-S33 WeakPolarHBondContact O-CB 3.36Å; E29-S33 PolarHBondContact O-N 3.13Å; E29-S33 PolarHBondContact O-OG 3.4Å
30	D	88.2	Confident	85.5	Confident	79 Å²	79	89.6 Å²	89.6	42%	0.422	46%	0.456	S	S	.	.	H	α-helix	trans	-63.6	-45.3	175.5	-75.5	-18.2	0	0	0	111.8	K26 R27 W28 M32 S33 K34	K26-D30 PolarHBondContact O-N 2.74Å; R27-D30 PolarHBondContact O-N 3.31Å; W28-D30 VanDerWaalsContact C-N 3.33Å; D30-M32 VanDerWaalsContact C-N 3.32Å; D30-M32 PolarHBondContact O-N 3.38Å; D30-S33 PolarHBondContact O-N 3.18Å; D30-S33 PolarHBondContact O-OG 3.37Å; D30-K34 WeakPolarHBondContact O-CG 3.23Å; D30-K34 PolarHBondContact O-N 2.87Å; D30-K34 VanDerWaalsContact O-N 3.13Å
31	V	88.2	Confident	85.7	Confident	29 Å²	29	90.9 Å²	90.9	18%	0.176	47%	0.468	C	S	.	.	H	α-helix	trans	-60.5	-44.2	174.8	169.8	0	0	0	0	110.5	R27 W28 K34 N35 G36 A39 A47	R27-V31 VanDerWaalsContact O-CG2 3.25Å; R27-V31 WeakPolarHBondContact O-CG2 3.46Å; R27-V31 PolarHBondContact O-N 2.94Å; W28-V31 HydrophobicContact CZ3-CG1 4.36Å; W28-V31 PolarHBondContact O-N 3.37Å; V31-K34 PolarHBondContact O-N 3.3Å; V31-N35 PolarHBondContact O-N 2.86Å; V31-G36 PolarHBondContact O-N 2.68Å; V31-A39 HydrophobicContact CG1-CB 3.97Å; V31-A39 HydrophobicContact CG2-CB 4.2Å; V31-A47 HydrophobicContact CG1-CB 4.04Å
32	M	88.1	Confident	85.9	Confident	17 Å²	17	94.2 Å²	94.2	8%	0.084	48%	0.476	C	S	.	.	H	α-helix	trans	-61.3	-52.2	176.3	-75.4	-72.8	-68.6	0	0	110.6	W28 E29 D30 K34 N35 A47 K50 K51	W28-M32 HydrophobicContact CD2-CG 4.23Å; W28-M32 HydrophobicContact CG-CG 4.5Å; W28-M32 HydrophobicContact CH2-SD 4.28Å; W28-M32 HydrophobicContact CZ2-CG 3.83Å; W28-M32 HydrophobicContact CZ2-SD 3.53Å; W28-M32 VanDerWaalsContact CZ2-SD 3.53Å; W28-M32 WeakPolarHBondContact O-CB 3.26Å; W28-M32 VanDerWaalsContact O-CG 3.23Å; W28-M32 WeakPolarHBondContact O-CG 3.41Å; W28-M32 PolarHBondContact O-N 3.46Å; E29-M32 PolarHBondContact O-N 3.36Å; D30-M32 VanDerWaalsContact C-N 3.32Å; D30-M32 PolarHBondContact O-N 3.38Å; M32-K34 PolarHBondContact O-N 2.94Å; M32-N35 PolarHBondContact O-N 3.46Å; M32-A47 VanDerWaalsContact SD-CA 3.5Å; M32-A47 HydrophobicContact SD-CB 3.71Å; M32-A47 VanDerWaalsContact SD-O 3.37Å; M32-K50 HydrophobicContact CE-CB 3.86Å; M32-K50 HydrophobicContact CE-CD 3.99Å; M32-K50 HydrophobicContact CE-CG 3.84Å; M32-K50 HydrophobicContact SD-CB 3.97Å; M32-K50 HydrophobicContact SD-CD 4.09Å; M32-K50 HydrophobicContact SD-CG 4.32Å; M32-K51 HydrophobicContact CE-CB 4.4Å; M32-K51 HydrophobicContact CE-CG 3.48Å; M32-K51 VanDerWaalsContact CE-CG 3.48Å; M32-K51 WeakPolarHBondContact O-CE 3.27Å; M32-K51 PolarHBondContact O-NZ 3.4Å; M32-K51 HydrophobicContact SD-CG 4.33Å
33	S	87.4	Confident	85.9	Confident	78 Å²	78	89.3 Å²	89.3	55%	0.545	46%	0.457	S	S	.	.	H	α-helix	trans	-55.9	-39.3	-177.3	68.3	0	0	0	0	111.9	E29 D30 N35 K51	E29-S33 WeakPolarHBondContact O-CB 3.36Å; E29-S33 PolarHBondContact O-N 3.13Å; E29-S33 PolarHBondContact O-OG 3.4Å; D30-S33 PolarHBondContact O-N 3.18Å; D30-S33 PolarHBondContact O-OG 3.37Å; S33-N35 VanDerWaalsContact C-N 3.35Å; S33-N35 PolarHBondContact O-N 3.48Å; S33-K51 PolarHBondContact O-NZ 2.96Å
34	K	88	Confident	85.9	Confident	121 Å²	121	91.2 Å²	91.2	53%	0.526	46%	0.462	S	S	.	.	T	Hydrogen-bonded Turn	trans	-85.8	13.8	178.9	-62.8	179.6	-179.5	177.3	0	115.7	D30 V31 M32 G36 E37	D30-K34 WeakPolarHBondContact O-CG 3.23Å; D30-K34 PolarHBondContact O-N 2.87Å; D30-K34 VanDerWaalsContact O-N 3.13Å; V31-K34 PolarHBondContact O-N 3.3Å; M32-K34 PolarHBondContact O-N 2.94Å; K34-G36 PolarHBondContact O-N 2.67Å; K34-G36 VanDerWaalsContact O-N 3.08Å; K34-E37 HydrophobicContact CB-CB 4.16Å; K34-E37 VanDerWaalsContact O-CB 3.26Å; K34-E37 WeakPolarHBondContact O-CB 3.39Å; K34-E37 PolarHBondContact O-N 2.86Å
35	N	81.3	Confident	86	Confident	82 Å²	82	91.4 Å²	91.4	44%	0.439	46%	0.456	S	S	.	.	T	Hydrogen-bonded Turn	trans	53.9	29.8	-177.2	-60.9	-44.5	0	0	0	113.7	V31 M32 S33 E37 M48 K51	V31-N35 PolarHBondContact O-N 2.86Å; M32-N35 PolarHBondContact O-N 3.46Å; S33-N35 VanDerWaalsContact C-N 3.35Å; S33-N35 PolarHBondContact O-N 3.48Å; N35-E37 VanDerWaalsContact C-N 3.34Å; N35-M48 HydrophobicContact CB-SD 4.05Å; N35-K51 WeakPolarHBondContact OD1-CD 3.49Å; N35-K51 PolarHBondContact OD1-NZ 3.47Å
36	G	80.5	Confident	86.1	Confident	1 Å²	1	87.4 Å²	87.4	1%	0.01	44%	0.444	C	S	.	.	T	Hydrogen-bonded Turn	trans	75.2	15	-176.9	0	0	0	0	0	115.5	V31 K34 G38 A39	V31-G36 PolarHBondContact O-N 2.68Å; K34-G36 PolarHBondContact O-N 2.67Å; K34-G36 VanDerWaalsContact O-N 3.08Å; G36-G38 PolarHBondContact O-N 3.08Å; G36-A39 WeakPolarHBondContact O-CB 2.82Å; G36-A39 PolarHBondContact O-N 3.03Å; G36-A39 VanDerWaalsContact O-N 3.12Å
37	E	82.3	Confident	86	Confident	152 Å²	152	81.1 Å²	81.1	71%	0.71	42%	0.416	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.1	128.1	173.1	-168.6	175	-163.5	0	0	111.2	K34 N35 A39	K34-E37 HydrophobicContact CB-CB 4.16Å; K34-E37 VanDerWaalsContact O-CB 3.26Å; K34-E37 WeakPolarHBondContact O-CB 3.39Å; K34-E37 PolarHBondContact O-N 2.86Å; N35-E37 VanDerWaalsContact C-N 3.34Å; E37-A39 PolarHBondContact O-N 2.81Å
38	G	82.4	Confident	86	Confident	89 Å²	89	77.3 Å²	77.3	92%	0.918	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.9	-4.5	-174.7	0	0	0	0	0	115.2	G36	G36-G38 PolarHBondContact O-N 3.08Å
39	A	85.9	Confident	86	Confident	22 Å²	22	81 Å²	81	18%	0.182	42%	0.42	C	S	.	.	S	Bend	trans	-89	153.2	174.6	0	0	0	0	0	111.4	V31 G36 E37 L43	V31-A39 HydrophobicContact CG1-CB 3.97Å; V31-A39 HydrophobicContact CG2-CB 4.2Å; G36-A39 WeakPolarHBondContact O-CB 2.82Å; G36-A39 PolarHBondContact O-N 3.03Å; G36-A39 VanDerWaalsContact O-N 3.12Å; E37-A39 PolarHBondContact O-N 2.81Å; A39-L43 HydrophobicContact CB-CB 3.96Å
40	P	88.1	Confident	85.9	Confident	72 Å²	72	79.9 Å²	79.9	47%	0.468	41%	0.413	S	S	.	.			trans	-50.6	149.2	165.5	-26.1	33.1	0	0	0	112.1	W42 L43 K44	P40-W42 VanDerWaalsContact C-N 3.3Å; P40-W42 PolarHBondContact O-N 3.33Å; P40-L43 HydrophobicContact CG-CD1 4.22Å; P40-L43 WeakPolarHBondContact O-CA 3.48Å; P40-L43 WeakPolarHBondContact O-CB 3.44Å; P40-L43 PolarHBondContact O-N 3.12Å; P40-K44 PolarHBondContact O-N 3.43Å
41	E	86	Confident	85.6	Confident	170 Å²	170	78.5 Å²	78.5	79%	0.794	40%	0.404	S	S	*	.	H	α-helix	trans	-55.6	-41.8	-172.5	-171.2	168.6	-158.2	0	0	113.5	L43 K44 E45	E41-L43 VanDerWaalsContact C-N 3.31Å; E41-L43 PolarHBondContact O-N 2.81Å; E41-K44 WeakPolarHBondContact O-CB 3.46Å; E41-K44 PolarHBondContact O-N 3.37Å; E41-E45 PolarHBondContact O-N 2.95Å
42	W	87.4	Confident	85.4	Confident	175 Å²	175	82.4 Å²	82.4	66%	0.663	42%	0.42	S	S	*	.	H	α-helix	trans	-63.1	-34.9	177.1	70.6	-91.2	0	0	0	113	P40 A46	P40-W42 VanDerWaalsContact C-N 3.3Å; P40-W42 PolarHBondContact O-N 3.33Å; W42-A46 WeakPolarHBondContact O-CB 3.41Å; W42-A46 PolarHBondContact O-N 3.27Å
43	L	86.7	Confident	85.1	Confident	38 Å²	38	88.4 Å²	88.4	20%	0.199	45%	0.445	C	S	.	.	H	α-helix	trans	-73.6	-38.5	175.3	-84.8	167.9	0	0	0	111.1	W28 A39 P40 E41 E45 A46 A47	W28-L43 HydrophobicContact CE3-CD2 4.13Å; W28-L43 HydrophobicContact CZ3-CD2 3.63Å; A39-L43 HydrophobicContact CB-CB 3.96Å; P40-L43 HydrophobicContact CG-CD1 4.22Å; P40-L43 WeakPolarHBondContact O-CA 3.48Å; P40-L43 WeakPolarHBondContact O-CB 3.44Å; P40-L43 PolarHBondContact O-N 3.12Å; E41-L43 VanDerWaalsContact C-N 3.31Å; E41-L43 PolarHBondContact O-N 2.81Å; L43-E45 VanDerWaalsContact C-N 3.35Å; L43-A46 PolarHBondContact O-N 3.4Å; L43-A47 VanDerWaalsContact O-CB 3.27Å; L43-A47 WeakPolarHBondContact O-CB 3.48Å; L43-A47 PolarHBondContact O-N 2.91Å
44	K	86.2	Confident	84.8	Confident	109 Å²	109	89.3 Å²	89.3	47%	0.474	44%	0.441	S	S	.	.	H	α-helix	trans	-60.3	-46.9	173.8	-177.7	-179.9	-177.8	-177.5	0	110.9	P40 E41 A47 M48	P40-K44 PolarHBondContact O-N 3.43Å; E41-K44 WeakPolarHBondContact O-CB 3.46Å; E41-K44 PolarHBondContact O-N 3.37Å; K44-A47 PolarHBondContact O-N 3.19Å; K44-M48 WeakPolarHBondContact O-CB 3.37Å; K44-M48 VanDerWaalsContact O-CG 3.3Å; K44-M48 WeakPolarHBondContact O-CG 3.41Å; K44-M48 PolarHBondContact O-N 2.91Å
45	E	87.6	Confident	84.4	Confident	100 Å²	100	87.8 Å²	87.8	47%	0.467	44%	0.438	S	S	.	.	H	α-helix	trans	-62	-45.9	176.5	-166.2	-174.3	-173.2	0	0	111.4	E41 L43 A47 M48 R49	E41-E45 PolarHBondContact O-N 2.95Å; L43-E45 VanDerWaalsContact C-N 3.35Å; E45-A47 VanDerWaalsContact C-N 3.32Å; E45-A47 PolarHBondContact O-N 3.29Å; E45-M48 PolarHBondContact O-N 3.44Å; E45-R49 WeakPolarHBondContact O-CB 3.34Å; E45-R49 VanDerWaalsContact O-CG 3.29Å; E45-R49 WeakPolarHBondContact O-CG 3.31Å; E45-R49 PolarHBondContact O-N 3.16Å; E45-R49 IonicContact OE1-CZ 3.85Å; E45-R49 IonicContact OE1-NE 3.47Å; E45-R49 PolarHBondContact OE1-NE 2.99Å; E45-R49 IonicContact OE1-NH2 2.9Å; E45-R49 PolarHBondContact OE1-NH2 3.5Å; E45-R49 IonicContact OE2-NH2 2.63Å
46	A	87	Confident	84.1	Confident	37 Å²	37	88.6 Å²	88.6	31%	0.306	44%	0.442	S	S	.	.	H	α-helix	trans	-59.6	-41.9	175.9	0	0	0	0	0	112.3	W28 W42 L43 R49 K50	W28-A46 HydrophobicContact CH2-CB 4.02Å; W42-A46 WeakPolarHBondContact O-CB 3.41Å; W42-A46 PolarHBondContact O-N 3.27Å; L43-A46 PolarHBondContact O-N 3.4Å; A46-R49 PolarHBondContact O-N 3.45Å; A46-K50 WeakPolarHBondContact O-CB 3.3Å; A46-K50 PolarHBondContact O-N 2.9Å
47	A	86.4	Confident	84	Confident	0 Å²	0	95.2 Å²	95.2	0%	0	47%	0.47	C	S	.	.	H	α-helix	trans	-65	-45.7	179	0	0	0	0	0	111.3	W28 V31 M32 L43 K44 E45 K50 K51	W28-A47 HydrophobicContact CH2-CB 3.97Å; W28-A47 HydrophobicContact CZ2-CB 4.48Å; W28-A47 HydrophobicContact CZ3-CB 4.48Å; V31-A47 HydrophobicContact CG1-CB 4.04Å; M32-A47 VanDerWaalsContact SD-CA 3.5Å; M32-A47 HydrophobicContact SD-CB 3.71Å; M32-A47 VanDerWaalsContact SD-O 3.37Å; L43-A47 VanDerWaalsContact O-CB 3.27Å; L43-A47 WeakPolarHBondContact O-CB 3.48Å; L43-A47 PolarHBondContact O-N 2.91Å; K44-A47 PolarHBondContact O-N 3.19Å; E45-A47 VanDerWaalsContact C-N 3.32Å; E45-A47 PolarHBondContact O-N 3.29Å; A47-K50 PolarHBondContact O-N 3.4Å; A47-K51 PolarHBondContact O-N 3.29Å
48	M	85	Confident	83.6	Confident	76 Å²	76	92.7 Å²	92.7	37%	0.374	46%	0.461	S	S	.	.	H	α-helix	trans	-62.5	-45.2	176.3	-70.7	-62.5	-70.6	0	0	111.9	N35 K44 E45 K50 K51 Q52	N35-M48 HydrophobicContact CB-SD 4.05Å; K44-M48 WeakPolarHBondContact O-CB 3.37Å; K44-M48 VanDerWaalsContact O-CG 3.3Å; K44-M48 WeakPolarHBondContact O-CG 3.41Å; K44-M48 PolarHBondContact O-N 2.91Å; E45-M48 PolarHBondContact O-N 3.44Å; M48-K50 VanDerWaalsContact C-N 3.31Å; M48-K50 PolarHBondContact O-N 3.28Å; M48-K51 PolarHBondContact O-N 2.93Å; M48-Q52 VanDerWaalsContact O-CG 3.31Å; M48-Q52 WeakPolarHBondContact O-CG 3.33Å; M48-Q52 PolarHBondContact O-N 2.94Å
49	R	85.7	Confident	83.3	Confident	139 Å²	139	94.7 Å²	94.7	53%	0.525	44%	0.444	S	S	.	.	H	α-helix	trans	-59.6	-40.9	174.7	-73.4	176.9	-178.9	-169.8	-0.2	111.7	E45 A46 Q52 K53	E45-R49 WeakPolarHBondContact O-CB 3.34Å; E45-R49 VanDerWaalsContact O-CG 3.29Å; E45-R49 WeakPolarHBondContact O-CG 3.31Å; E45-R49 PolarHBondContact O-N 3.16Å; E45-R49 IonicContact OE1-CZ 3.85Å; E45-R49 IonicContact OE1-NE 3.47Å; E45-R49 PolarHBondContact OE1-NE 2.99Å; E45-R49 IonicContact OE1-NH2 2.9Å; E45-R49 PolarHBondContact OE1-NH2 3.5Å; E45-R49 IonicContact OE2-NH2 2.63Å; A46-R49 PolarHBondContact O-N 3.45Å; R49-Q52 PolarHBondContact O-N 3.35Å; R49-K53 WeakPolarHBondContact O-CG 3.44Å; R49-K53 PolarHBondContact O-N 3.29Å
50	K	84.9	Confident	82.6	Confident	91 Å²	91	96.4 Å²	96.4	40%	0.396	45%	0.45	S	S	.	.	H	α-helix	trans	-67.2	-43.1	177.5	-168.7	174.9	-176.5	173.1	0	111.5	W28 M32 A46 A47 M48 K53 Q54	W28-K50 HydrophobicContact CZ2-CB 4.34Å; W28-K50 HydrophobicContact CZ2-CD 3.6Å; W28-K50 VanDerWaalsContact NE1-NZ 3.12Å; M32-K50 HydrophobicContact CE-CB 3.86Å; M32-K50 HydrophobicContact CE-CD 3.99Å; M32-K50 HydrophobicContact CE-CG 3.84Å; M32-K50 HydrophobicContact SD-CB 3.97Å; M32-K50 HydrophobicContact SD-CD 4.09Å; M32-K50 HydrophobicContact SD-CG 4.32Å; A46-K50 WeakPolarHBondContact O-CB 3.3Å; A46-K50 PolarHBondContact O-N 2.9Å; A47-K50 PolarHBondContact O-N 3.4Å; M48-K50 VanDerWaalsContact C-N 3.31Å; M48-K50 PolarHBondContact O-N 3.28Å; K50-K53 PolarHBondContact O-N 2.9Å; K50-Q54 WeakPolarHBondContact O-CG 3.49Å; K50-Q54 PolarHBondContact O-N 3.41Å
51	K	83.4	Confident	82	Confident	51 Å²	51	99.7 Å²	99.7	22%	0.222	46%	0.46	C	S	.	.	H	α-helix	trans	-59.8	-45.9	174	-81.4	-165	168.9	179.3	0	112	M32 S33 N35 A47 M48 K53 Q54 I55	M32-K51 HydrophobicContact CE-CB 4.4Å; M32-K51 HydrophobicContact CE-CG 3.48Å; M32-K51 VanDerWaalsContact CE-CG 3.48Å; M32-K51 WeakPolarHBondContact O-CE 3.27Å; M32-K51 PolarHBondContact O-NZ 3.4Å; M32-K51 HydrophobicContact SD-CG 4.33Å; S33-K51 PolarHBondContact O-NZ 2.96Å; N35-K51 WeakPolarHBondContact OD1-CD 3.49Å; N35-K51 PolarHBondContact OD1-NZ 3.47Å; A47-K51 PolarHBondContact O-N 3.29Å; M48-K51 PolarHBondContact O-N 2.93Å; K51-K53 VanDerWaalsContact C-N 3.32Å; K51-K53 PolarHBondContact O-N 3.25Å; K51-Q54 PolarHBondContact O-N 2.83Å; K51-Q54 VanDerWaalsContact O-N 3.16Å; K51-I55 WeakPolarHBondContact O-CG1 3.35Å; K51-I55 PolarHBondContact O-N 3.36Å
52	Q	83.6	Confident	81.6	Confident	110 Å²	110	98.3 Å²	98.3	51%	0.514	46%	0.458	S	S	.	.	H	α-helix	trans	-58.2	-45.1	176.5	-73.7	172	-6.8	0	0	111.4	M48 R49 Q54 I55 L56	M48-Q52 VanDerWaalsContact O-CG 3.31Å; M48-Q52 WeakPolarHBondContact O-CG 3.33Å; M48-Q52 PolarHBondContact O-N 2.94Å; R49-Q52 PolarHBondContact O-N 3.35Å; Q52-Q54 PolarHBondContact O-N 2.87Å; Q52-I55 PolarHBondContact O-N 3.36Å; Q52-L56 WeakPolarHBondContact O-CB 2.71Å; Q52-L56 VanDerWaalsContact O-CG 3.27Å; Q52-L56 WeakPolarHBondContact O-CG 3.38Å; Q52-L56 PolarHBondContact O-N 2.94Å
53	K	82.3	Confident	81	Confident	143 Å²	143	92.1 Å²	92.1	62%	0.622	44%	0.437	S	S	*	.	H	α-helix	trans	-61	-40.5	175.3	-74.3	178.1	179.7	-177.4	0	112.9	R49 K50 K51 L56 K57	R49-K53 WeakPolarHBondContact O-CG 3.44Å; R49-K53 PolarHBondContact O-N 3.29Å; K50-K53 PolarHBondContact O-N 2.9Å; K51-K53 VanDerWaalsContact C-N 3.32Å; K51-K53 PolarHBondContact O-N 3.25Å; K53-L56 PolarHBondContact O-N 3.21Å; K53-K57 WeakPolarHBondContact O-CG 3.43Å; K53-K57 PolarHBondContact O-N 3.18Å
54	Q	80.5	Confident	80.8	Confident	98 Å²	98	92 Å²	92	46%	0.458	44%	0.442	S	S	.	.	H	α-helix	trans	-64.7	-44.1	176.1	-74	175.1	-22.1	0	0	111.6	K50 K51 Q52 L56 K57 L58	K50-Q54 WeakPolarHBondContact O-CG 3.49Å; K50-Q54 PolarHBondContact O-N 3.41Å; K51-Q54 PolarHBondContact O-N 2.83Å; K51-Q54 VanDerWaalsContact O-N 3.16Å; Q52-Q54 PolarHBondContact O-N 2.87Å; Q54-L56 VanDerWaalsContact C-N 3.32Å; Q54-L56 PolarHBondContact O-N 3.2Å; Q54-K57 PolarHBondContact O-N 2.98Å; Q54-L58 WeakPolarHBondContact O-CG 3.48Å; Q54-L58 PolarHBondContact O-N 3.1Å
55	I	78.9	Confident	80.7	Confident	89 Å²	89	91.7 Å²	91.7	46%	0.456	45%	0.451	S	S	.	.	H	α-helix	trans	-61.6	-42.5	175.8	-67.3	164.8	0	0	0	110.6	K51 Q52 L58 K59	K51-I55 WeakPolarHBondContact O-CG1 3.35Å; K51-I55 PolarHBondContact O-N 3.36Å; Q52-I55 PolarHBondContact O-N 3.36Å; I55-L58 PolarHBondContact O-N 3.24Å; I55-K59 HydrophobicContact CG2-CD 4.34Å; I55-K59 WeakPolarHBondContact O-CG 3.43Å; I55-K59 PolarHBondContact O-N 2.86Å
56	L	76.3	Confident	80.7	Confident	99 Å²	99	94.6 Å²	94.6	52%	0.518	46%	0.458	S	S	.	.	H	α-helix	trans	-62.4	-45	176.2	-72.2	170.3	0	0	0	111.5	Q52 K53 Q54 L58 K59 D60	Q52-L56 WeakPolarHBondContact O-CB 2.71Å; Q52-L56 VanDerWaalsContact O-CG 3.27Å; Q52-L56 WeakPolarHBondContact O-CG 3.38Å; Q52-L56 PolarHBondContact O-N 2.94Å; K53-L56 PolarHBondContact O-N 3.21Å; Q54-L56 VanDerWaalsContact C-N 3.32Å; Q54-L56 PolarHBondContact O-N 3.2Å; L56-L58 VanDerWaalsContact C-N 3.35Å; L56-L58 PolarHBondContact O-N 3.13Å; L56-K59 WeakPolarHBondContact O-CB 3.38Å; L56-K59 PolarHBondContact O-N 3.23Å; L56-D60 WeakPolarHBondContact O-CB 3.47Å; L56-D60 VanDerWaalsContact O-CG 3.29Å; L56-D60 PolarHBondContact O-N 3.48Å
57	K	76.7	Confident	80.7	Confident	139 Å²	139	95.6 Å²	95.6	60%	0.604	46%	0.458	S	S	*	.	H	α-helix	trans	-59.2	-44.1	175	-75.3	-176.8	177.8	-167.5	0	112.5	K53 Q54 K59 D60 E61	K53-K57 WeakPolarHBondContact O-CG 3.43Å; K53-K57 PolarHBondContact O-N 3.18Å; Q54-K57 PolarHBondContact O-N 2.98Å; K57-K59 VanDerWaalsContact C-N 3.33Å; K57-K59 PolarHBondContact O-N 3Å; K57-D60 PolarHBondContact O-N 2.94Å; K57-E61 WeakPolarHBondContact O-CG 3.27Å; K57-E61 PolarHBondContact O-N 2.87Å
58	L	74.9	Confident	80.7	Confident	99 Å²	99	99.8 Å²	99.8	52%	0.518	48%	0.476	S	S	.	.	H	α-helix	trans	-64.1	-38.7	176.8	-73.3	168.3	0	0	0	111.9	Q54 I55 L56 N62	Q54-L58 WeakPolarHBondContact O-CG 3.48Å; Q54-L58 PolarHBondContact O-N 3.1Å; I55-L58 PolarHBondContact O-N 3.24Å; L56-L58 VanDerWaalsContact C-N 3.35Å; L56-L58 PolarHBondContact O-N 3.13Å; L58-N62 PolarHBondContact O-N 3.44Å; L58-N62 PolarHBondContact O-ND2 2.89Å
59	K	74.8	Confident	80.8	Confident	131 Å²	131	102 Å²	102	57%	0.57	49%	0.485	S	S	*	.	H	α-helix	trans	-62.8	-47.9	172.5	-75	-179.5	177.5	-172.3	0	110.2	I55 L56 K57 E61 N62 L63	I55-K59 HydrophobicContact CG2-CD 4.34Å; I55-K59 WeakPolarHBondContact O-CG 3.43Å; I55-K59 PolarHBondContact O-N 2.86Å; L56-K59 WeakPolarHBondContact O-CB 3.38Å; L56-K59 PolarHBondContact O-N 3.23Å; K57-K59 VanDerWaalsContact C-N 3.33Å; K57-K59 PolarHBondContact O-N 3Å; K59-E61 PolarHBondContact O-N 2.81Å; K59-N62 CarbonylContact O-C 3.55Å; K59-N62 PolarHBondContact O-N 3.05Å; K59-N62 VanDerWaalsContact O-N 3.13Å; K59-L63 WeakPolarHBondContact O-CG 3.4Å; K59-L63 PolarHBondContact O-N 3Å; K59-L63 VanDerWaalsContact O-N 3.1Å
60	D	72.6	Confident	80.9	Confident	58 Å²	58	98.1 Å²	98.1	31%	0.31	48%	0.477	S	S	.	.	H	α-helix	trans	-60.7	-43.1	179.9	-71	-14	0	0	0	112	L56 K57 N62 L63 K68 Q71	L56-D60 WeakPolarHBondContact O-CB 3.47Å; L56-D60 VanDerWaalsContact O-CG 3.29Å; L56-D60 PolarHBondContact O-N 3.48Å; K57-D60 PolarHBondContact O-N 2.94Å; D60-N62 PolarHBondContact O-N 3.25Å; D60-L63 WeakPolarHBondContact O-CB 3.47Å; D60-L63 PolarHBondContact O-N 3.14Å; D60-K68 WeakPolarHBondContact O-CE 3.34Å; D60-K68 PolarHBondContact O-NZ 3.33Å; D60-Q71 PolarHBondContact OD1-NE2 3.42Å; D60-Q71 PolarHBondContact OD1-OE1 3.47Å
61	E	75.1	Confident	81	Confident	142 Å²	142	98 Å²	98	66%	0.664	48%	0.478	S	S	*	.	H	α-helix	trans	-57.1	-37.1	176.5	-77.1	176.2	-175.7	0	0	112.3	K57 K59	K57-E61 WeakPolarHBondContact O-CG 3.27Å; K57-E61 PolarHBondContact O-N 2.87Å; K59-E61 PolarHBondContact O-N 2.81Å
62	N	76.8	Confident	81.2	Confident	141 Å²	141	103.6 Å²	103.6	75%	0.754	50%	0.502	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.4	-6	177.2	-69.3	-60.6	0	0	0	114.4	L58 K59 D60	L58-N62 PolarHBondContact O-N 3.44Å; L58-N62 PolarHBondContact O-ND2 2.89Å; K59-N62 CarbonylContact O-C 3.55Å; K59-N62 PolarHBondContact O-N 3.05Å; K59-N62 VanDerWaalsContact O-N 3.13Å; D60-N62 PolarHBondContact O-N 3.25Å
63	L	76.5	Confident	81.5	Confident	44 Å²	44	105.2 Å²	105.2	23%	0.23	51%	0.507	C	S	.	.	S	Bend	trans	-75.2	137.8	177.2	-73	174.7	0	0	0	111.1	K59 D60 L67 K68 Q71	K59-L63 WeakPolarHBondContact O-CG 3.4Å; K59-L63 PolarHBondContact O-N 3Å; K59-L63 VanDerWaalsContact O-N 3.1Å; D60-L63 WeakPolarHBondContact O-CB 3.47Å; D60-L63 PolarHBondContact O-N 3.14Å; L63-L67 HydrophobicContact CB-CB 4.21Å; L63-L67 HydrophobicContact CD2-CB 4.18Å; L63-L67 HydrophobicContact CD2-CD1 3.84Å; L63-K68 HydrophobicContact CB-CG 4.12Å; L63-K68 WeakPolarHBondContact O-CE 3.47Å; L63-Q71 VanDerWaalsContact CD1-CD 3.47Å; L63-Q71 VanDerWaalsContact CD1-OE1 3.28Å
64	A	81.2	Confident	81.9	Confident	37 Å²	37	102.7 Å²	102.7	31%	0.306	50%	0.501	S	S	.	.			trans	-55	144.7	168.8	0	0	0	0	0	110.4	W66 L67 K68	A64-W66 VanDerWaalsContact C-N 3.26Å; A64-W66 PolarHBondContact O-N 3.3Å; A64-W66 VanDerWaalsContact O-N 3.14Å; A64-L67 HydrophobicContact CB-CD1 4.26Å; A64-L67 WeakPolarHBondContact O-CB 3.42Å; A64-L67 PolarHBondContact O-N 2.63Å; A64-K68 PolarHBondContact O-N 3.14Å
65	P	85.3	Confident	82.4	Confident	101 Å²	101	101.1 Å²	101.1	66%	0.656	51%	0.505	S	S	*	.	H	α-helix	trans	-52.3	-40.1	-176.6	-29.4	35.2	0	0	0	114.4	L67 K68 E69	P65-L67 VanDerWaalsContact C-N 3.31Å; P65-L67 PolarHBondContact O-N 3.2Å; P65-K68 WeakPolarHBondContact O-CB 3.29Å; P65-K68 PolarHBondContact O-N 3.39Å; P65-E69 PolarHBondContact O-N 2.93Å; P65-E69 VanDerWaalsContact O-N 3.14Å
66	W	86	Confident	82.9	Confident	162 Å²	162	98.4 Å²	98.4	61%	0.614	50%	0.498	S	S	*	.	H	α-helix	trans	-65.9	-31.8	178.5	70.9	-94.8	0	0	0	112.9	A64 E69 V70	A64-W66 VanDerWaalsContact C-N 3.26Å; A64-W66 PolarHBondContact O-N 3.3Å; A64-W66 VanDerWaalsContact O-N 3.14Å; W66-E69 PolarHBondContact O-N 3.42Å; W66-V70 HydrophobicContact CE3-CG2 4.08Å; W66-V70 HydrophobicContact CZ3-CG2 4.37Å; W66-V70 WeakPolarHBondContact O-CG2 3.43Å; W66-V70 PolarHBondContact O-N 3.49Å
67	L	88.1	Confident	83.7	Confident	57 Å²	57	97.9 Å²	97.9	30%	0.298	50%	0.496	S	S	.	.	H	α-helix	trans	-68.6	-37.4	175.2	-78	166.6	0	0	0	111.3	L63 A64 P65 E69 V70 Q71	L63-L67 HydrophobicContact CB-CB 4.21Å; L63-L67 HydrophobicContact CD2-CB 4.18Å; L63-L67 HydrophobicContact CD2-CD1 3.84Å; A64-L67 HydrophobicContact CB-CD1 4.26Å; A64-L67 WeakPolarHBondContact O-CB 3.42Å; A64-L67 PolarHBondContact O-N 2.63Å; P65-L67 VanDerWaalsContact C-N 3.31Å; P65-L67 PolarHBondContact O-N 3.2Å; L67-E69 VanDerWaalsContact C-N 3.31Å; L67-E69 PolarHBondContact O-N 3.48Å; L67-V70 PolarHBondContact O-N 2.92Å; L67-Q71 WeakPolarHBondContact O-CG 3.39Å; L67-Q71 PolarHBondContact O-N 3Å
68	K	85.5	Confident	84.3	Confident	89 Å²	89	94.1 Å²	94.1	39%	0.387	49%	0.491	S	S	.	.	H	α-helix	trans	-61.3	-41.9	173	-63.2	176.4	175.4	170.4	0	111.1	D60 L63 A64 P65 Q71 K72	D60-K68 WeakPolarHBondContact O-CE 3.34Å; D60-K68 PolarHBondContact O-NZ 3.33Å; L63-K68 HydrophobicContact CB-CG 4.12Å; L63-K68 WeakPolarHBondContact O-CE 3.47Å; A64-K68 PolarHBondContact O-N 3.14Å; P65-K68 WeakPolarHBondContact O-CB 3.29Å; P65-K68 PolarHBondContact O-N 3.39Å; K68-Q71 PolarHBondContact O-N 3.38Å; K68-K72 WeakPolarHBondContact O-CB 3.41Å; K68-K72 PolarHBondContact O-N 2.97Å
69	E	87	Confident	85.1	Confident	121 Å²	121	98 Å²	98	57%	0.565	50%	0.498	S	S	*	.	H	α-helix	trans	-64.1	-42.8	175.4	-70.1	-172.6	178.1	0	0	112.5	P65 W66 L67 K72 K73	P65-E69 PolarHBondContact O-N 2.93Å; P65-E69 VanDerWaalsContact O-N 3.14Å; W66-E69 PolarHBondContact O-N 3.42Å; L67-E69 VanDerWaalsContact C-N 3.31Å; L67-E69 PolarHBondContact O-N 3.48Å; E69-K72 PolarHBondContact O-N 2.9Å; E69-K73 WeakPolarHBondContact O-CG 3.44Å; E69-K73 PolarHBondContact O-N 3.29Å
70	V	88.5	Confident	86	Confident	59 Å²	59	100.3 Å²	100.3	36%	0.358	50%	0.504	S	S	.	.	H	α-helix	trans	-61.7	-47.6	176	169.4	0	0	0	0	110.8	W66 L67 K72 K73 N74	W66-V70 HydrophobicContact CE3-CG2 4.08Å; W66-V70 HydrophobicContact CZ3-CG2 4.37Å; W66-V70 WeakPolarHBondContact O-CG2 3.43Å; W66-V70 PolarHBondContact O-N 3.49Å; L67-V70 PolarHBondContact O-N 2.92Å; V70-K72 VanDerWaalsContact C-N 3.31Å; V70-K72 PolarHBondContact O-N 2.85Å; V70-K73 PolarHBondContact O-N 3.12Å; V70-N74 WeakPolarHBondContact O-CB 3.42Å; V70-N74 PolarHBondContact O-N 3.32Å; V70-N74 PolarHBondContact O-OD1 3.48Å
71	Q	87.1	Confident	86.9	Confident	87 Å²	87	102.8 Å²	102.8	41%	0.407	52%	0.516	S	S	.	.	H	α-helix	trans	-57.2	-44.2	175.5	-76.4	177.2	-32	0	0	111.9	D60 L63 L67 K68 N74 A75	D60-Q71 PolarHBondContact OD1-NE2 3.42Å; D60-Q71 PolarHBondContact OD1-OE1 3.47Å; L63-Q71 VanDerWaalsContact CD1-CD 3.47Å; L63-Q71 VanDerWaalsContact CD1-OE1 3.28Å; L67-Q71 WeakPolarHBondContact O-CG 3.39Å; L67-Q71 PolarHBondContact O-N 3Å; K68-Q71 PolarHBondContact O-N 3.38Å; Q71-N74 PolarHBondContact O-N 2.9Å; Q71-A75 WeakPolarHBondContact O-CB 3.37Å; Q71-A75 PolarHBondContact O-N 3.36Å
72	K	87.6	Confident	87.7	Confident	170 Å²	170	98.9 Å²	98.9	74%	0.739	50%	0.504	S	S	*	.	H	α-helix	trans	-61.8	-45.7	177.2	-176.7	179.5	178.2	-179.1	0	111.9	K68 E69 V70 A75 G76	K68-K72 WeakPolarHBondContact O-CB 3.41Å; K68-K72 PolarHBondContact O-N 2.97Å; E69-K72 PolarHBondContact O-N 2.9Å; V70-K72 VanDerWaalsContact C-N 3.31Å; V70-K72 PolarHBondContact O-N 2.85Å; K72-A75 PolarHBondContact O-N 3.2Å; K72-G76 PolarHBondContact O-N 2.87Å; K72-G76 VanDerWaalsContact O-N 3.12Å
73	K	89.9	Confident	88.4	Confident	143 Å²	143	96 Å²	96	62%	0.622	49%	0.489	S	S	*	.	H	α-helix	trans	-63	-44.2	176.6	-75.4	-178.9	178.8	173	0	111.1	E69 V70 A75 G76 L77	E69-K73 WeakPolarHBondContact O-CG 3.44Å; E69-K73 PolarHBondContact O-N 3.29Å; V70-K73 PolarHBondContact O-N 3.12Å; K73-A75 PolarHBondContact O-N 3.45Å; K73-G76 PolarHBondContact O-N 3.25Å; K73-L77 WeakPolarHBondContact O-CG 3.41Å; K73-L77 PolarHBondContact O-N 2.91Å
74	N	91.7	Very high	89.1	Confident	90 Å²	90	96.1 Å²	96.1	48%	0.481	50%	0.496	S	S	.	.	H	α-helix	trans	-64.1	-41.1	179	-70.2	-6.9	0	0	0	112.4	V70 Q71 G76 L77 A78	V70-N74 WeakPolarHBondContact O-CB 3.42Å; V70-N74 PolarHBondContact O-N 3.32Å; V70-N74 PolarHBondContact O-OD1 3.48Å; Q71-N74 PolarHBondContact O-N 2.9Å; N74-G76 VanDerWaalsContact C-N 3.31Å; N74-G76 PolarHBondContact O-N 3.12Å; N74-L77 PolarHBondContact O-N 3.5Å; N74-A78 WeakPolarHBondContact O-CB 3.45Å; N74-A78 PolarHBondContact O-N 3.24Å
75	A	89	Confident	89.5	Confident	65 Å²	65	97.4 Å²	97.4	54%	0.537	50%	0.5	S	S	.	.	H	α-helix	trans	-62.2	-39.7	174.4	0	0	0	0	0	111.9	Q71 K72 K73 R79	Q71-A75 WeakPolarHBondContact O-CB 3.37Å; Q71-A75 PolarHBondContact O-N 3.36Å; K72-A75 PolarHBondContact O-N 3.2Å; K73-A75 PolarHBondContact O-N 3.45Å; A75-R79 PolarHBondContact O-N 3.49Å; A75-R79 VanDerWaalsContact O-N 3.12Å
76	G	91.4	Very high	89.6	Confident	32 Å²	32	96.2 Å²	96.2	33%	0.33	49%	0.488	S	S	.	.	H	α-helix	trans	-64.4	-41.2	173.6	0	0	0	0	0	113	K72 K73 N74 R79 R80	K72-G76 PolarHBondContact O-N 2.87Å; K72-G76 VanDerWaalsContact O-N 3.12Å; K73-G76 PolarHBondContact O-N 3.25Å; N74-G76 VanDerWaalsContact C-N 3.31Å; N74-G76 PolarHBondContact O-N 3.12Å; G76-R79 PolarHBondContact O-N 3.44Å; G76-R80 WeakPolarHBondContact O-CG 3.37Å; G76-R80 PolarHBondContact O-N 2.86Å; G76-R80 VanDerWaalsContact O-N 3.13Å
77	L	91.7	Very high	89.6	Confident	88 Å²	88	91.9 Å²	91.9	46%	0.461	48%	0.483	S	S	.	.	H	α-helix	trans	-65.1	-45.8	175.5	-71.2	172.5	0	0	0	111.7	K73 N74 R79 R80 I81	K73-L77 WeakPolarHBondContact O-CG 3.41Å; K73-L77 PolarHBondContact O-N 2.91Å; N74-L77 PolarHBondContact O-N 3.5Å; L77-R79 VanDerWaalsContact C-N 3.28Å; L77-R79 PolarHBondContact O-N 2.91Å; L77-R80 PolarHBondContact O-N 3.13Å; L77-R80 VanDerWaalsContact O-N 3.13Å; L77-I81 WeakPolarHBondContact O-CG1 3.38Å; L77-I81 PolarHBondContact O-N 3.34Å
78	A	90.7	Very high	89.4	Confident	60 Å²	60	95.1 Å²	95.1	50%	0.496	50%	0.496	S	S	.	.	H	α-helix	trans	-58.5	-40.9	177.8	0	0	0	0	0	112	N74 I81 S82	N74-A78 WeakPolarHBondContact O-CB 3.45Å; N74-A78 PolarHBondContact O-N 3.24Å; A78-I81 PolarHBondContact O-N 2.99Å; A78-S82 PolarHBondContact O-N 3.4Å
79	R	91.2	Very high	89.4	Confident	181 Å²	181	95 Å²	95	68%	0.683	50%	0.499	S	S	*	.	H	α-helix	trans	-61.7	-47.9	174	-175	176.3	179	165.7	1.8	111.9	A75 G76 L77 I81 S82 D83	A75-R79 PolarHBondContact O-N 3.49Å; A75-R79 VanDerWaalsContact O-N 3.12Å; G76-R79 PolarHBondContact O-N 3.44Å; L77-R79 VanDerWaalsContact C-N 3.28Å; L77-R79 PolarHBondContact O-N 2.91Å; R79-I81 VanDerWaalsContact C-N 3.31Å; R79-I81 PolarHBondContact O-N 3.45Å; R79-S82 WeakPolarHBondContact O-CB 3.36Å; R79-S82 PolarHBondContact O-N 3.13Å; R79-S82 VanDerWaalsContact O-N 3.17Å; R79-D83 PolarHBondContact O-N 3.17Å
80	R	92.9	Very high	89	Confident	180 Å²	180	95.7 Å²	95.7	68%	0.679	50%	0.502	S	S	*	.	H	α-helix	trans	-61.7	-38.8	178.7	-70.6	174.6	-173.1	179.2	0.3	112.6	G76 L77 D83 A84	G76-R80 WeakPolarHBondContact O-CG 3.37Å; G76-R80 PolarHBondContact O-N 2.86Å; G76-R80 VanDerWaalsContact O-N 3.13Å; L77-R80 PolarHBondContact O-N 3.13Å; L77-R80 VanDerWaalsContact O-N 3.13Å; R80-D83 PolarHBondContact O-N 3.31Å; R80-A84 WeakPolarHBondContact O-CB 3.46Å; R80-A84 PolarHBondContact O-N 3.49Å
81	I	92.1	Very high	88.6	Confident	110 Å²	110	97 Å²	97	56%	0.564	51%	0.514	S	S	*	.	H	α-helix	trans	-63	-47.5	174.9	-67.9	166.4	0	0	0	109.6	L77 A78 R79 D83 A84 T85	L77-I81 WeakPolarHBondContact O-CG1 3.38Å; L77-I81 PolarHBondContact O-N 3.34Å; A78-I81 PolarHBondContact O-N 2.99Å; R79-I81 VanDerWaalsContact C-N 3.31Å; R79-I81 PolarHBondContact O-N 3.45Å; I81-D83 VanDerWaalsContact C-N 3.33Å; I81-D83 PolarHBondContact O-N 2.94Å; I81-A84 PolarHBondContact O-N 3.34Å; I81-T85 PolarHBondContact O-N 3.42Å; I81-T85 PolarHBondContact O-OG1 2.97Å
82	S	90.7	Very high	88.1	Confident	60 Å²	60	99.3 Å²	99.3	42%	0.42	53%	0.529	S	S	.	.	H	α-helix	trans	-60.4	-42.5	177.2	-170.7	0	0	0	0	112.4	A78 R79 T85 N86	A78-S82 PolarHBondContact O-N 3.4Å; R79-S82 WeakPolarHBondContact O-CB 3.36Å; R79-S82 PolarHBondContact O-N 3.13Å; R79-S82 VanDerWaalsContact O-N 3.17Å; S82-T85 PolarHBondContact O-N 2.89Å; S82-N86 WeakPolarHBondContact O-CB 3.26Å; S82-N86 PolarHBondContact O-N 3.39Å; S82-N86 PolarHBondContact O-ND2 3.48Å
83	D	92.3	Very high	87.6	Confident	80 Å²	80	98.1 Å²	98.1	43%	0.428	53%	0.53	S	S	.	.	H	α-helix	trans	-63.7	-44.7	178.1	-65.4	-20.9	0	0	0	110.3	R79 R80 I81 N86 S87	R79-D83 PolarHBondContact O-N 3.17Å; R80-D83 PolarHBondContact O-N 3.31Å; I81-D83 VanDerWaalsContact C-N 3.33Å; I81-D83 PolarHBondContact O-N 2.94Å; D83-N86 PolarHBondContact O-N 3.27Å; D83-S87 PolarHBondContact O-N 3.17Å; D83-S87 PolarHBondContact O-OG 2.95Å
84	A	90.2	Very high	86.3	Confident	47 Å²	47	98.9 Å²	98.9	39%	0.388	55%	0.553	S	S	.	*	H	α-helix	trans	-62.1	-45.4	176.2	0	0	0	0	0	112.5	R80 I81 N86 S87 E88	R80-A84 WeakPolarHBondContact O-CB 3.46Å; R80-A84 PolarHBondContact O-N 3.49Å; I81-A84 PolarHBondContact O-N 3.34Å; A84-N86 VanDerWaalsContact C-N 3.33Å; A84-N86 PolarHBondContact O-N 3Å; A84-S87 PolarHBondContact O-N 3.26Å; A84-E88 WeakPolarHBondContact O-CG 3.42Å; A84-E88 PolarHBondContact O-N 3.02Å
85	T	89.7	Confident	86	Confident	63 Å²	63	99.3 Å²	99.3	39%	0.387	56%	0.557	S	S	.	*	H	α-helix	trans	-62.1	-40.6	176.7	-57.2	0	0	0	0	111.7	I81 S82 E88 I89	I81-T85 PolarHBondContact O-N 3.42Å; I81-T85 PolarHBondContact O-OG1 2.97Å; S82-T85 PolarHBondContact O-N 2.89Å; T85-E88 PolarHBondContact O-N 3.26Å; T85-I89 HydrophobicContact CG2-CD1 4.03Å; T85-I89 VanDerWaalsContact O-CG1 3.26Å; T85-I89 WeakPolarHBondContact O-CG1 3.43Å; T85-I89 PolarHBondContact O-N 3.44Å
86	N	88.9	Confident	85.9	Confident	77 Å²	77	101.1 Å²	101.1	41%	0.412	56%	0.558	S	S	.	*	H	α-helix	trans	-65.4	-42.5	176.3	-70.8	-18.7	0	0	0	111.5	S82 D83 A84 E88 I89 E90	S82-N86 WeakPolarHBondContact O-CB 3.26Å; S82-N86 PolarHBondContact O-N 3.39Å; S82-N86 PolarHBondContact O-ND2 3.48Å; D83-N86 PolarHBondContact O-N 3.27Å; A84-N86 VanDerWaalsContact C-N 3.33Å; A84-N86 PolarHBondContact O-N 3Å; N86-E88 PolarHBondContact O-N 3.47Å; N86-I89 PolarHBondContact O-N 2.91Å; N86-E90 WeakPolarHBondContact O-CG 3.34Å; N86-E90 PolarHBondContact O-N 2.91Å
87	S	85.9	Confident	85.6	Confident	71 Å²	71	104.9 Å²	104.9	50%	0.497	57%	0.571	S	S	.	*	H	α-helix	trans	-63.7	-37.3	175.3	-64.1	0	0	0	0	113	D83 A84 E90 S91	D83-S87 PolarHBondContact O-N 3.17Å; D83-S87 PolarHBondContact O-OG 2.95Å; A84-S87 PolarHBondContact O-N 3.26Å; S87-E90 PolarHBondContact O-N 2.92Å; S87-S91 WeakPolarHBondContact O-CB 3.34Å; S87-S91 PolarHBondContact O-N 3.49Å
88	E	83.9	Confident	85.2	Confident	124 Å²	124	105.9 Å²	105.9	58%	0.579	58%	0.577	S	S	*	*	H	α-helix	trans	-65.2	-41.6	173.6	-75.1	172.5	-165.7	0	0	111.7	A84 T85 N86 S91 N92	A84-E88 WeakPolarHBondContact O-CG 3.42Å; A84-E88 PolarHBondContact O-N 3.02Å; T85-E88 PolarHBondContact O-N 3.26Å; N86-E88 PolarHBondContact O-N 3.47Å; E88-S91 PolarHBondContact O-N 2.81Å; E88-N92 WeakPolarHBondContact O-CB 3.48Å; E88-N92 VanDerWaalsContact O-CG 3.31Å; E88-N92 PolarHBondContact O-N 3.46Å; E88-N92 PolarHBondContact O-ND2 3.13Å
89	I	84	Confident	84.9	Confident	88 Å²	88	108.8 Å²	108.8	45%	0.451	58%	0.582	S	S	.	*	H	α-helix	trans	-63.4	-46.5	175.8	-68.5	164.7	0	0	0	110.4	T85 N86 S91 N92 L93	T85-I89 HydrophobicContact CG2-CD1 4.03Å; T85-I89 VanDerWaalsContact O-CG1 3.26Å; T85-I89 WeakPolarHBondContact O-CG1 3.43Å; T85-I89 PolarHBondContact O-N 3.44Å; N86-I89 PolarHBondContact O-N 2.91Å; I89-S91 VanDerWaalsContact C-N 3.34Å; I89-S91 PolarHBondContact O-N 3.07Å; I89-N92 PolarHBondContact O-N 3.42Å; I89-L93 HydrophobicContact CG2-CD1 3.77Å; I89-L93 HydrophobicContact CG2-CG 4.44Å; I89-L93 VanDerWaalsContact O-CG 3.29Å; I89-L93 WeakPolarHBondContact O-CG 3.29Å; I89-L93 PolarHBondContact O-N 3.21Å; I89-L93 VanDerWaalsContact O-N 3.13Å
90	E	78.8	Confident	84.4	Confident	134 Å²	134	104 Å²	104	63%	0.626	58%	0.576	S	S	*	*	H	α-helix	trans	-61.4	-41	177.3	-72.8	173.1	-177.8	0	0	112	N86 S87 N92 L93 S94	N86-E90 WeakPolarHBondContact O-CG 3.34Å; N86-E90 PolarHBondContact O-N 2.91Å; S87-E90 PolarHBondContact O-N 2.92Å; E90-N92 VanDerWaalsContact C-N 3.3Å; E90-N92 PolarHBondContact O-N 3.41Å; E90-L93 PolarHBondContact O-N 3.32Å; E90-S94 PolarHBondContact O-N 3.34Å
91	S	80.2	Confident	83.8	Confident	88 Å²	88	98.6 Å²	98.6	62%	0.615	57%	0.568	S	S	*	*	H	α-helix	trans	-67.5	-27.2	176.8	-175	0	0	0	0	113.5	S87 E88 I89	S87-S91 WeakPolarHBondContact O-CB 3.34Å; S87-S91 PolarHBondContact O-N 3.49Å; E88-S91 PolarHBondContact O-N 2.81Å; I89-S91 VanDerWaalsContact C-N 3.34Å; I89-S91 PolarHBondContact O-N 3.07Å
92	N	77	Confident	83.2	Confident	134 Å²	134	97.7 Å²	97.7	72%	0.717	57%	0.568	S	S	*	*	H	α-helix	trans	-87	-14.3	178	-73.4	-50.2	0	0	0	113.1	E88 I89 E90	E88-N92 WeakPolarHBondContact O-CB 3.48Å; E88-N92 VanDerWaalsContact O-CG 3.31Å; E88-N92 PolarHBondContact O-N 3.46Å; E88-N92 PolarHBondContact O-ND2 3.13Å; I89-N92 PolarHBondContact O-N 3.42Å; E90-N92 VanDerWaalsContact C-N 3.3Å; E90-N92 PolarHBondContact O-N 3.41Å
93	L	76.3	Confident	82.6	Confident	145 Å²	145	100.8 Å²	100.8	76%	0.759	58%	0.581	S	S	*	*	H	α-helix	trans	-94.7	-11.7	177.6	-70.6	172.4	0	0	0	113.3	I89 E90	I89-L93 HydrophobicContact CG2-CD1 3.77Å; I89-L93 HydrophobicContact CG2-CG 4.44Å; I89-L93 VanDerWaalsContact O-CG 3.29Å; I89-L93 WeakPolarHBondContact O-CG 3.29Å; I89-L93 PolarHBondContact O-N 3.21Å; I89-L93 VanDerWaalsContact O-N 3.13Å; E90-L93 PolarHBondContact O-N 3.32Å
94	S	63.4	Low	81.7	Confident	159 Å²	159	102.7 Å²	102.7	100%	1.112	60%	0.595	S	S	*	*			trans	-94	0	174.3	-173.7	0	0	0	0	112.4	E90	E90-S94 PolarHBondContact O-N 3.34Å

Retrieved 94 of 94 residues in 37.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).