G4VQX1_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession G4VQX1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 57 aa.

						>G4VQX1_SCHMA|G4VQX1
MFTLDSTASHYSFLLNYHLASLSDNNQQVLSMKCFQIAYLRYIKRNNKHINKGLKKM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.6	Very low	65.1	Low	233 Å²	233	111.5 Å²	111.5	100%	1.148	59%	0.586	S	S	*	*				0	91.3	0	-168.7	99.5	154.9	0	0	107.4
2	F	46.7	Very low	66	Low	179 Å²	179	104.8 Å²	104.8	79%	0.785	56%	0.555	S	S	*	*			trans	-134.7	14.7	-170.8	-127.2	-84.7	0	0	0	113.3	S6	F2-S6 WeakPolarHBondContact O-CB 3.49Å; F2-S6 PolarHBondContact O-OG 3.13Å
3	T	56.2	Low	66.8	Low	114 Å²	114	106.9 Å²	106.9	70%	0.699	56%	0.557	S	S	*	*	S	Bend	trans	-104.8	-11.2	-159.6	17.5	0	0	0	0	116.7	T7	T3-T7 PolarHBondContact O-OG1 3.2Å
4	L	59.8	Low	67.7	Low	120 Å²	120	104.3 Å²	104.3	63%	0.628	54%	0.544	S	S	*	.	S	Bend	trans	-109.4	-46	176.8	-82.5	160.1	0	0	0	112.7	S6 T7 A8	L4-S6 VanDerWaalsContact C-N 3.3Å; L4-S6 PolarHBondContact O-N 3.21Å; L4-T7 PolarHBondContact O-N 3.03Å; L4-A8 PolarHBondContact O-N 3.44Å; L4-A8 VanDerWaalsContact O-N 3.15Å
5	D	60.9	Low	68.3	Low	138 Å²	138	100.7 Å²	100.7	74%	0.738	53%	0.525	S	S	*	.	H	α-helix	trans	-64.5	-34.9	179.2	-67.7	-49.7	0	0	0	112.5	S9	D5-S9 WeakPolarHBondContact O-CB 3.23Å; D5-S9 PolarHBondContact O-N 3.2Å; D5-S9 PolarHBondContact O-OG 2.96Å
6	S	67.5	Low	68.4	Low	48 Å²	48	98.2 Å²	98.2	34%	0.336	51%	0.512	S	S	.	.	H	α-helix	trans	-69.5	-41.6	177.8	61.5	0	0	0	0	112.4	F2 L4 S9 H10	F2-S6 WeakPolarHBondContact O-CB 3.49Å; F2-S6 PolarHBondContact O-OG 3.13Å; L4-S6 VanDerWaalsContact C-N 3.3Å; L4-S6 PolarHBondContact O-N 3.21Å; S6-S9 PolarHBondContact O-N 3.21Å; S6-H10 WeakPolarHBondContact O-CB 3.29Å; S6-H10 PolarHBondContact O-N 3.4Å
7	T	76.3	Confident	68.9	Low	54 Å²	54	101.9 Å²	101.9	33%	0.331	52%	0.52	S	S	.	.	H	α-helix	trans	-65.6	-43.6	178.2	-55.9	0	0	0	0	111.5	T3 L4 S9 H10 Y11	T3-T7 PolarHBondContact O-OG1 3.2Å; L4-T7 PolarHBondContact O-N 3.03Å; T7-S9 VanDerWaalsContact C-N 3.31Å; T7-S9 PolarHBondContact O-N 2.84Å; T7-H10 PolarHBondContact O-N 3.49Å; T7-Y11 HydrophobicContact CG2-CD2 3.78Å; T7-Y11 HydrophobicContact CG2-CE2 3.46Å; T7-Y11 VanDerWaalsContact CG2-CE2 3.46Å; T7-Y11 WeakPolarHBondContact O-CD2 3.37Å; T7-Y11 PolarHBondContact O-N 3.15Å
8	A	75.2	Confident	69.3	Low	33 Å²	33	103.2 Å²	103.2	27%	0.273	52%	0.523	S	S	.	.	H	α-helix	trans	-61.6	-41.9	175.1	0	0	0	0	0	111.3	L4 S12 Y39	L4-A8 PolarHBondContact O-N 3.44Å; L4-A8 VanDerWaalsContact O-N 3.15Å; A8-S12 VanDerWaalsContact O-CB 3.25Å; A8-S12 WeakPolarHBondContact O-CB 3.42Å; A8-S12 PolarHBondContact O-N 3.33Å; A8-Y39 HydrophobicContact CB-CE1 4.02Å
9	S	74.7	Confident	69.5	Low	73 Å²	73	98.9 Å²	98.9	51%	0.51	50%	0.501	S	S	.	.	H	α-helix	trans	-64.5	-39.2	175.3	-59.5	0	0	0	0	112.3	D5 S6 T7 S12 F13	D5-S9 WeakPolarHBondContact O-CB 3.23Å; D5-S9 PolarHBondContact O-N 3.2Å; D5-S9 PolarHBondContact O-OG 2.96Å; S6-S9 PolarHBondContact O-N 3.21Å; T7-S9 VanDerWaalsContact C-N 3.31Å; T7-S9 PolarHBondContact O-N 2.84Å; S9-S12 WeakPolarHBondContact O-CB 3.44Å; S9-S12 PolarHBondContact O-N 3.04Å; S9-F13 WeakPolarHBondContact O-CB 3.39Å; S9-F13 PolarHBondContact O-N 3.21Å
10	H	79.4	Confident	69.5	Low	111 Å²	111	97.1 Å²	97.1	51%	0.514	50%	0.502	S	S	.	.	H	α-helix	trans	-64.8	-46.9	178.7	-170.9	90	0	0	0	111.8	S6 T7 S12 F13 L14	S6-H10 WeakPolarHBondContact O-CB 3.29Å; S6-H10 PolarHBondContact O-N 3.4Å; T7-H10 PolarHBondContact O-N 3.49Å; H10-S12 VanDerWaalsContact C-N 3.33Å; H10-S12 PolarHBondContact O-N 2.9Å; H10-F13 PolarHBondContact O-N 2.81Å; H10-L14 WeakPolarHBondContact NE2-CD1 3.38Å; H10-L14 PolarHBondContact O-N 2.88Å
11	Y	76.9	Confident	69.6	Low	124 Å²	124	97.4 Å²	97.4	49%	0.486	51%	0.513	S	S	.	.	H	α-helix	trans	-65.2	-38.1	174.6	-73.7	-60.8	0	0	0	112.1	T7 F13 L14 L15	T7-Y11 HydrophobicContact CG2-CD2 3.78Å; T7-Y11 HydrophobicContact CG2-CE2 3.46Å; T7-Y11 VanDerWaalsContact CG2-CE2 3.46Å; T7-Y11 WeakPolarHBondContact O-CD2 3.37Å; T7-Y11 PolarHBondContact O-N 3.15Å; Y11-F13 VanDerWaalsContact C-N 3.34Å; Y11-L14 PolarHBondContact O-N 2.82Å; Y11-L15 WeakPolarHBondContact O-CB 3.37Å; Y11-L15 PolarHBondContact O-N 2.89Å
12	S	75.3	Confident	70.7	Confident	31 Å²	31	91.9 Å²	91.9	22%	0.217	49%	0.487	C	S	.	.	H	α-helix	trans	-60.4	-44	174.5	179.2	0	0	0	0	111.7	A8 S9 H10 N16 M32	A8-S12 VanDerWaalsContact O-CB 3.25Å; A8-S12 WeakPolarHBondContact O-CB 3.42Å; A8-S12 PolarHBondContact O-N 3.33Å; S9-S12 WeakPolarHBondContact O-CB 3.44Å; S9-S12 PolarHBondContact O-N 3.04Å; H10-S12 VanDerWaalsContact C-N 3.33Å; H10-S12 PolarHBondContact O-N 2.9Å; S12-N16 VanDerWaalsContact O-CB 3.31Å; S12-N16 WeakPolarHBondContact O-CB 3.46Å; S12-N16 PolarHBondContact O-N 2.91Å; S12-N16 PolarHBondContact O-ND2 3.2Å; S12-M32 VanDerWaalsContact O-CE 3.28Å; S12-M32 WeakPolarHBondContact O-CE 3.39Å; S12-M32 WeakPolarHBondContact OG-CE 3.36Å; S12-M32 PolarHBondContact OG-SD 2.8Å; S12-M32 VanDerWaalsContact OG-SD 3.35Å
13	F	76.2	Confident	71.6	Confident	132 Å²	132	88.4 Å²	88.4	58%	0.579	49%	0.485	S	S	*	.	H	α-helix	trans	-63.4	-51.5	176.8	178.4	-94.6	0	0	0	112.2	S9 H10 Y11 L15 N16 Y17	S9-F13 WeakPolarHBondContact O-CB 3.39Å; S9-F13 PolarHBondContact O-N 3.21Å; H10-F13 PolarHBondContact O-N 2.81Å; Y11-F13 VanDerWaalsContact C-N 3.34Å; F13-L15 VanDerWaalsContact C-N 3.29Å; F13-L15 PolarHBondContact O-N 2.91Å; F13-N16 PolarHBondContact O-N 2.83Å; F13-Y17 WeakPolarHBondContact O-CB 3.41Å; F13-Y17 PolarHBondContact O-N 3.36Å
14	L	79.4	Confident	72.5	Confident	70 Å²	70	87 Å²	87	37%	0.366	47%	0.474	S	S	.	.	H	α-helix	trans	-60.2	-41.2	179.4	-73.1	177.1	0	0	0	111.9	H10 Y11 Y17 H18	H10-L14 WeakPolarHBondContact NE2-CD1 3.38Å; H10-L14 PolarHBondContact O-N 2.88Å; Y11-L14 PolarHBondContact O-N 2.82Å; L14-Y17 PolarHBondContact O-N 3.19Å; L14-H18 PolarHBondContact O-N 3.46Å; L14-H18 VanDerWaalsContact O-N 3.07Å; L14-H18 PolarHBondContact O-ND1 3.44Å
15	L	76.6	Confident	73.1	Confident	51 Å²	51	86.9 Å²	86.9	27%	0.267	47%	0.473	S	S	.	.	H	α-helix	trans	-65.7	-47.2	177.6	-175.8	67.6	0	0	0	111.1	Y11 F13 Y17 H18 L19 M32 F35	Y11-L15 WeakPolarHBondContact O-CB 3.37Å; Y11-L15 PolarHBondContact O-N 2.89Å; F13-L15 VanDerWaalsContact C-N 3.29Å; F13-L15 PolarHBondContact O-N 2.91Å; L15-Y17 VanDerWaalsContact C-N 3.31Å; L15-Y17 PolarHBondContact O-N 2.96Å; L15-H18 PolarHBondContact O-N 3.47Å; L15-L19 HydrophobicContact CD1-CD1 4.06Å; L15-L19 HydrophobicContact CD1-CG 4.49Å; L15-L19 HydrophobicContact CD2-CD1 4.39Å; L15-L19 HydrophobicContact CG-CD1 3.73Å; L15-L19 WeakPolarHBondContact O-CB 3.35Å; L15-L19 WeakPolarHBondContact O-CD1 3.38Å; L15-L19 VanDerWaalsContact O-CG 3.23Å; L15-L19 WeakPolarHBondContact O-CG 3.47Å; L15-L19 PolarHBondContact O-N 3.18Å; L15-M32 HydrophobicContact CD2-CE 4.21Å; L15-F35 HydrophobicContact CD2-CB 3.82Å; L15-F35 HydrophobicContact CD2-CD1 4.47Å; L15-F35 HydrophobicContact CD2-CD2 4.38Å; L15-F35 HydrophobicContact CD2-CG 3.98Å
16	N	70.5	Confident	73.7	Confident	60 Å²	60	86.5 Å²	86.5	32%	0.321	47%	0.472	S	S	.	.	H	α-helix	trans	-60.7	-39.5	174.8	-81.1	-25.6	0	0	0	112.1	S12 F13 H18 L19 A20 M32	S12-N16 VanDerWaalsContact O-CB 3.31Å; S12-N16 WeakPolarHBondContact O-CB 3.46Å; S12-N16 PolarHBondContact O-N 2.91Å; S12-N16 PolarHBondContact O-ND2 3.2Å; F13-N16 PolarHBondContact O-N 2.83Å; N16-H18 PolarHBondContact O-N 2.88Å; N16-L19 PolarHBondContact O-N 3.47Å; N16-A20 VanDerWaalsContact O-CB 3.26Å; N16-A20 WeakPolarHBondContact O-CB 3.33Å; N16-A20 PolarHBondContact O-N 3.3Å; N16-M32 HydrophobicContact CB-CE 4.47Å; N16-M32 VanDerWaalsContact ND2-CE 3.34Å; N16-M32 WeakPolarHBondContact ND2-CE 3.25Å; N16-M32 WeakPolarHBondContact OD1-CE 3.45Å
17	Y	77	Confident	73.9	Confident	162 Å²	162	89.4 Å²	89.4	64%	0.635	48%	0.48	S	S	*	.	H	α-helix	trans	-61.6	-43.3	177	179.7	-94.5	0	0	0	111.8	F13 L14 L15	F13-Y17 WeakPolarHBondContact O-CB 3.41Å; F13-Y17 PolarHBondContact O-N 3.36Å; L14-Y17 PolarHBondContact O-N 3.19Å; L15-Y17 VanDerWaalsContact C-N 3.31Å; L15-Y17 PolarHBondContact O-N 2.96Å
18	H	76.6	Confident	73.7	Confident	124 Å²	124	88.3 Å²	88.3	57%	0.574	47%	0.471	S	S	*	.	H	α-helix	trans	-67.5	-39.6	175.6	-76.3	76.6	0	0	0	112.1	L14 L15 N16 S21	L14-H18 PolarHBondContact O-N 3.46Å; L14-H18 VanDerWaalsContact O-N 3.07Å; L14-H18 PolarHBondContact O-ND1 3.44Å; L15-H18 PolarHBondContact O-N 3.47Å; N16-H18 PolarHBondContact O-N 2.88Å; H18-S21 WeakPolarHBondContact O-CB 3.37Å; H18-S21 PolarHBondContact O-N 3.01Å
19	L	71.6	Confident	73.7	Confident	22 Å²	22	90.6 Å²	90.6	12%	0.115	48%	0.481	C	S	.	.	H	α-helix	trans	-74	-31	-179.4	-70.2	168.5	0	0	0	112.8	L15 N16 S21 L22 Q28	L15-L19 HydrophobicContact CD1-CD1 4.06Å; L15-L19 HydrophobicContact CD1-CG 4.49Å; L15-L19 HydrophobicContact CD2-CD1 4.39Å; L15-L19 HydrophobicContact CG-CD1 3.73Å; L15-L19 WeakPolarHBondContact O-CB 3.35Å; L15-L19 WeakPolarHBondContact O-CD1 3.38Å; L15-L19 VanDerWaalsContact O-CG 3.23Å; L15-L19 WeakPolarHBondContact O-CG 3.47Å; L15-L19 PolarHBondContact O-N 3.18Å; N16-L19 PolarHBondContact O-N 3.47Å; L19-S21 PolarHBondContact O-N 3.39Å; L19-L22 CarbonylContact O-C 3.5Å; L19-L22 PolarHBondContact O-N 3.4Å; L19-Q28 HydrophobicContact CB-CB 3.99Å; L19-Q28 HydrophobicContact CB-CG 3.81Å; L19-Q28 HydrophobicContact CD1-CB 4.45Å; L19-Q28 PolarHBondContact O-NE2 3.07Å
20	A	70	Confident	74	Confident	63 Å²	63	92.8 Å²	92.8	52%	0.521	49%	0.486	S	S	.	.	H	α-helix	trans	-56	-31.9	170.3	0	0	0	0	0	111.9	N16 L22 Q28	N16-A20 VanDerWaalsContact O-CB 3.26Å; N16-A20 WeakPolarHBondContact O-CB 3.33Å; N16-A20 PolarHBondContact O-N 3.3Å; A20-L22 VanDerWaalsContact C-N 3.31Å; A20-L22 PolarHBondContact O-N 2.95Å; A20-Q28 VanDerWaalsContact CA-NE2 3.32Å
21	S	73	Confident	73.9	Confident	103 Å²	103	89.7 Å²	89.7	72%	0.72	48%	0.478	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.3	-17.1	175.5	-170.3	0	0	0	0	113.9	H18 L19	H18-S21 WeakPolarHBondContact O-CB 3.37Å; H18-S21 PolarHBondContact O-N 3.01Å; L19-S21 PolarHBondContact O-N 3.39Å
22	L	65.7	Low	74.2	Confident	117 Å²	117	84.7 Å²	84.7	61%	0.613	46%	0.459	S	S	*	.	S	Bend	trans	-108	72.7	180	-65.1	173.2	0	0	0	108.8	L19 A20 D24	L19-L22 CarbonylContact O-C 3.5Å; L19-L22 PolarHBondContact O-N 3.4Å; A20-L22 VanDerWaalsContact C-N 3.31Å; A20-L22 PolarHBondContact O-N 2.95Å; L22-D24 PolarHBondContact O-N 3.04Å
23	S	65.4	Low	74.5	Confident	107 Å²	107	89.1 Å²	89.1	75%	0.748	47%	0.474	S	S	*	.	S	Bend	trans	4.4	-12.5	174.2	-159.9	0	0	0	0	124.2
24	D	75.2	Confident	74.9	Confident	85 Å²	85	86.9 Å²	86.9	46%	0.455	47%	0.474	S	S	.	.			trans	-103.8	96.7	-176.5	-73.9	-28.9	0	0	0	111.8	L22 N26 Q27 Q28	L22-D24 PolarHBondContact O-N 3.04Å; D24-N26 PolarHBondContact O-N 3.36Å; D24-Q27 HydrophobicContact CB-CB 4.04Å; D24-Q27 HydrophobicContact CB-CG 3.68Å; D24-Q27 PolarHBondContact O-N 3.2Å; D24-Q27 PolarHBondContact OD2-NE2 2.74Å; D24-Q28 WeakPolarHBondContact O-CG 3.36Å; D24-Q28 PolarHBondContact O-N 3.12Å
25	N	70.8	Confident	75.1	Confident	116 Å²	116	87.2 Å²	87.2	62%	0.62	47%	0.473	S	S	*	.	H	α-helix	trans	-47.7	-35.7	176.7	-69.6	-39	0	0	0	113.3	Q28 V29	N25-Q28 PolarHBondContact O-N 3.15Å; N25-V29 PolarHBondContact O-N 3.43Å
26	N	73.4	Confident	75.5	Confident	131 Å²	131	90.1 Å²	90.1	70%	0.701	49%	0.485	S	S	*	.	H	α-helix	trans	-69.2	-38.5	179.3	-72.3	7	0	0	0	112.7	D24 Q28 L30	D24-N26 PolarHBondContact O-N 3.36Å; N26-Q28 PolarHBondContact O-N 3.38Å; N26-L30 WeakPolarHBondContact O-CD1 3.46Å; N26-L30 WeakPolarHBondContact O-CG 3.25Å; N26-L30 PolarHBondContact O-N 3.22Å
27	Q	73.3	Confident	76.4	Confident	108 Å²	108	91.6 Å²	91.6	51%	0.505	49%	0.492	S	S	.	.	H	α-helix	trans	-66.5	-31.1	176.9	-63.1	-169.8	27.2	0	0	111	D24 S31	D24-Q27 HydrophobicContact CB-CB 4.04Å; D24-Q27 HydrophobicContact CB-CG 3.68Å; D24-Q27 PolarHBondContact O-N 3.2Å; D24-Q27 PolarHBondContact OD2-NE2 2.74Å; Q27-S31 VanDerWaalsContact O-CB 3.26Å; Q27-S31 WeakPolarHBondContact O-CB 3.46Å; Q27-S31 PolarHBondContact O-N 3.37Å; Q27-S31 PolarHBondContact O-OG 2.62Å
28	Q	70.7	Confident	76.7	Confident	31 Å²	31	86.4 Å²	86.4	15%	0.145	48%	0.482	C	S	.	.	H	α-helix	trans	-66.1	-50.1	178.5	-41	-176.7	-4.3	0	0	111.9	L19 A20 D24 N25 N26 L30 S31 M32	L19-Q28 HydrophobicContact CB-CB 3.99Å; L19-Q28 HydrophobicContact CB-CG 3.81Å; L19-Q28 HydrophobicContact CD1-CB 4.45Å; L19-Q28 PolarHBondContact O-NE2 3.07Å; A20-Q28 VanDerWaalsContact CA-NE2 3.32Å; D24-Q28 WeakPolarHBondContact O-CG 3.36Å; D24-Q28 PolarHBondContact O-N 3.12Å; N25-Q28 PolarHBondContact O-N 3.15Å; N26-Q28 PolarHBondContact O-N 3.38Å; Q28-L30 VanDerWaalsContact C-N 3.33Å; Q28-L30 PolarHBondContact O-N 2.91Å; Q28-S31 PolarHBondContact O-N 3.27Å; Q28-M32 WeakPolarHBondContact O-CB 3.44Å; Q28-M32 PolarHBondContact O-N 2.92Å
29	V	76.9	Confident	77.3	Confident	81 Å²	81	83.2 Å²	83.2	49%	0.491	47%	0.466	S	S	.	.	H	α-helix	trans	-62	-42.2	179.7	176.9	0	0	0	0	111.1	N25 K33	N25-V29 PolarHBondContact O-N 3.43Å; V29-K33 HydrophobicContact CG1-CD 4.27Å; V29-K33 WeakPolarHBondContact O-CG 3.21Å; V29-K33 PolarHBondContact O-N 3.3Å
30	L	80.8	Confident	78	Confident	119 Å²	119	86.6 Å²	86.6	62%	0.623	48%	0.483	S	S	*	.	H	α-helix	trans	-63.6	-47	177	-74.1	165.8	0	0	0	111.6	N26 Q28 M32 K33 C34	N26-L30 WeakPolarHBondContact O-CD1 3.46Å; N26-L30 WeakPolarHBondContact O-CG 3.25Å; N26-L30 PolarHBondContact O-N 3.22Å; Q28-L30 VanDerWaalsContact C-N 3.33Å; Q28-L30 PolarHBondContact O-N 2.91Å; L30-M32 VanDerWaalsContact C-N 3.34Å; L30-M32 PolarHBondContact O-N 3.49Å; L30-K33 PolarHBondContact O-N 3.46Å; L30-C34 WeakPolarHBondContact O-CB 3.36Å; L30-C34 PolarHBondContact O-N 2.8Å
31	S	77.4	Confident	78.8	Confident	47 Å²	47	92.2 Å²	92.2	33%	0.329	49%	0.491	S	S	.	.	H	α-helix	trans	-61.6	-42	178.7	-62	0	0	0	0	111.7	Q27 Q28 C34 F35	Q27-S31 VanDerWaalsContact O-CB 3.26Å; Q27-S31 WeakPolarHBondContact O-CB 3.46Å; Q27-S31 PolarHBondContact O-N 3.37Å; Q27-S31 PolarHBondContact O-OG 2.62Å; Q28-S31 PolarHBondContact O-N 3.27Å; S31-C34 PolarHBondContact O-N 3.03Å; S31-F35 WeakPolarHBondContact O-CB 3.26Å; S31-F35 PolarHBondContact O-N 2.9Å
32	M	82.3	Confident	79.6	Confident	19 Å²	19	94.2 Å²	94.2	9%	0.094	48%	0.484	C	S	.	.	H	α-helix	trans	-60.8	-50.9	175.6	-176.9	53.9	67.2	0	0	112	S12 L15 N16 Q28 L30 C34 F35 Q36	S12-M32 VanDerWaalsContact O-CE 3.28Å; S12-M32 WeakPolarHBondContact O-CE 3.39Å; S12-M32 WeakPolarHBondContact OG-CE 3.36Å; S12-M32 PolarHBondContact OG-SD 2.8Å; S12-M32 VanDerWaalsContact OG-SD 3.35Å; L15-M32 HydrophobicContact CD2-CE 4.21Å; N16-M32 HydrophobicContact CB-CE 4.47Å; N16-M32 VanDerWaalsContact ND2-CE 3.34Å; N16-M32 WeakPolarHBondContact ND2-CE 3.25Å; N16-M32 WeakPolarHBondContact OD1-CE 3.45Å; Q28-M32 WeakPolarHBondContact O-CB 3.44Å; Q28-M32 PolarHBondContact O-N 2.92Å; L30-M32 VanDerWaalsContact C-N 3.34Å; L30-M32 PolarHBondContact O-N 3.49Å; M32-C34 VanDerWaalsContact C-N 3.28Å; M32-C34 PolarHBondContact O-N 3.21Å; M32-F35 PolarHBondContact O-N 3.43Å; M32-Q36 WeakPolarHBondContact O-CG 3.36Å; M32-Q36 PolarHBondContact O-N 2.92Å; M32-Q36 HydrophobicContact SD-CG 4.27Å
33	K	81.2	Confident	80.5	Confident	123 Å²	123	91 Å²	91	54%	0.535	47%	0.467	S	S	.	.	H	α-helix	trans	-59	-42.2	178	-73.9	178.6	178.8	-178	0	111.3	V29 L30 Q36 I37	V29-K33 HydrophobicContact CG1-CD 4.27Å; V29-K33 WeakPolarHBondContact O-CG 3.21Å; V29-K33 PolarHBondContact O-N 3.3Å; L30-K33 PolarHBondContact O-N 3.46Å; K33-Q36 PolarHBondContact O-N 2.96Å; K33-I37 WeakPolarHBondContact O-CD1 3.47Å; K33-I37 VanDerWaalsContact O-CG1 3.25Å; K33-I37 WeakPolarHBondContact O-CG1 3.37Å; K33-I37 PolarHBondContact O-N 3.25Å
34	C	85.4	Confident	81.3	Confident	85 Å²	85	92.5 Å²	92.5	57%	0.574	46%	0.46	S	S	*	.	H	α-helix	trans	-61.8	-45.8	177	-170.2	0	0	0	0	111.6	L30 S31 M32 I37 A38	L30-C34 WeakPolarHBondContact O-CB 3.36Å; L30-C34 PolarHBondContact O-N 2.8Å; S31-C34 PolarHBondContact O-N 3.03Å; M32-C34 VanDerWaalsContact C-N 3.28Å; M32-C34 PolarHBondContact O-N 3.21Å; C34-I37 PolarHBondContact O-N 3.36Å; C34-A38 WeakPolarHBondContact O-CB 3.49Å; C34-A38 PolarHBondContact O-N 2.92Å
35	F	83.1	Confident	81.8	Confident	78 Å²	78	96.7 Å²	96.7	34%	0.342	47%	0.469	S	S	.	.	H	α-helix	trans	-63.1	-44	177.6	-173.3	-94.8	0	0	0	112.1	L15 S31 M32 I37 A38 Y39	L15-F35 HydrophobicContact CD2-CB 3.82Å; L15-F35 HydrophobicContact CD2-CD1 4.47Å; L15-F35 HydrophobicContact CD2-CD2 4.38Å; L15-F35 HydrophobicContact CD2-CG 3.98Å; S31-F35 WeakPolarHBondContact O-CB 3.26Å; S31-F35 PolarHBondContact O-N 2.9Å; M32-F35 PolarHBondContact O-N 3.43Å; F35-I37 VanDerWaalsContact C-N 3.3Å; F35-I37 PolarHBondContact O-N 3.35Å; F35-A38 PolarHBondContact O-N 2.96Å; F35-Y39 VanDerWaalsContact O-CB 3.26Å; F35-Y39 WeakPolarHBondContact O-CB 3.46Å; F35-Y39 PolarHBondContact O-N 3.35Å
36	Q	85.6	Confident	82.2	Confident	111 Å²	111	94.6 Å²	94.6	52%	0.519	46%	0.458	S	S	.	.	H	α-helix	trans	-57.3	-43.2	175.2	-72.9	177.3	-31.2	0	0	111.8	M32 K33 L40	M32-Q36 WeakPolarHBondContact O-CG 3.36Å; M32-Q36 PolarHBondContact O-N 2.92Å; M32-Q36 HydrophobicContact SD-CG 4.27Å; K33-Q36 PolarHBondContact O-N 2.96Å; Q36-L40 WeakPolarHBondContact O-CB 3.09Å; Q36-L40 PolarHBondContact O-N 3.3Å
37	I	88.4	Confident	82.5	Confident	92 Å²	92	92.1 Å²	92.1	47%	0.472	45%	0.445	S	S	.	.	H	α-helix	trans	-65.9	-46.2	176.8	-66.3	164.3	0	0	0	111	K33 C34 F35 Y39 L40 R41	K33-I37 WeakPolarHBondContact O-CD1 3.47Å; K33-I37 VanDerWaalsContact O-CG1 3.25Å; K33-I37 WeakPolarHBondContact O-CG1 3.37Å; K33-I37 PolarHBondContact O-N 3.25Å; C34-I37 PolarHBondContact O-N 3.36Å; F35-I37 VanDerWaalsContact C-N 3.3Å; F35-I37 PolarHBondContact O-N 3.35Å; I37-Y39 VanDerWaalsContact C-N 3.34Å; I37-Y39 PolarHBondContact O-N 3.06Å; I37-L40 PolarHBondContact O-N 3.46Å; I37-R41 WeakPolarHBondContact O-CG 3.28Å; I37-R41 PolarHBondContact O-N 3.2Å
38	A	85.1	Confident	82.9	Confident	53 Å²	53	94.3 Å²	94.3	44%	0.438	45%	0.453	S	S	.	.	H	α-helix	trans	-61.5	-42.2	178	0	0	0	0	0	111.8	C34 F35 R41 Y42	C34-A38 WeakPolarHBondContact O-CB 3.49Å; C34-A38 PolarHBondContact O-N 2.92Å; F35-A38 PolarHBondContact O-N 2.96Å; A38-R41 WeakPolarHBondContact O-CB 3.34Å; A38-R41 PolarHBondContact O-N 3.34Å; A38-Y42 PolarHBondContact O-N 3.32Å
39	Y	88.7	Confident	83.1	Confident	57 Å²	57	98.6 Å²	98.6	22%	0.224	47%	0.473	C	S	.	.	H	α-helix	trans	-66	-42.8	177.5	-175.4	-112.8	0	0	0	112.2	A8 F35 I37 R41 Y42 I43	A8-Y39 HydrophobicContact CB-CE1 4.02Å; F35-Y39 VanDerWaalsContact O-CB 3.26Å; F35-Y39 WeakPolarHBondContact O-CB 3.46Å; F35-Y39 PolarHBondContact O-N 3.35Å; I37-Y39 VanDerWaalsContact C-N 3.34Å; I37-Y39 PolarHBondContact O-N 3.06Å; Y39-R41 VanDerWaalsContact C-N 3.3Å; Y39-R41 PolarHBondContact O-N 2.92Å; Y39-Y42 WeakPolarHBondContact O-CB 3.31Å; Y39-Y42 PolarHBondContact O-N 2.84Å; Y39-Y42 VanDerWaalsContact O-N 3.12Å; Y39-I43 HydrophobicContact CD1-CD1 3.75Å; Y39-I43 HydrophobicContact CE1-CD1 3.26Å; Y39-I43 HydrophobicContact CE1-CG1 4.19Å; Y39-I43 HydrophobicContact CE2-CD1 4.34Å; Y39-I43 HydrophobicContact CE2-CG1 4.46Å; Y39-I43 HydrophobicContact CG-CD1 4.47Å; Y39-I43 PolarHBondContact O-N 2.91Å
40	L	85.9	Confident	82.9	Confident	93 Å²	93	99.3 Å²	99.3	49%	0.487	47%	0.473	S	S	.	.	H	α-helix	trans	-61.3	-40.1	174	-177.1	64.6	0	0	0	111.7	Q36 I37 I43 K44	Q36-L40 WeakPolarHBondContact O-CB 3.09Å; Q36-L40 PolarHBondContact O-N 3.3Å; I37-L40 PolarHBondContact O-N 3.46Å; L40-I43 PolarHBondContact O-N 3.49Å; L40-K44 WeakPolarHBondContact O-CB 3.41Å; L40-K44 WeakPolarHBondContact O-CG 3.26Å; L40-K44 PolarHBondContact O-N 3.34Å
41	R	86.6	Confident	82.2	Confident	180 Å²	180	98.6 Å²	98.6	68%	0.679	47%	0.47	S	S	*	.	H	α-helix	trans	-62.9	-41.7	173.5	-73.5	174.7	175.6	173.4	-0.3	111.6	I37 A38 Y39 K44 R45	I37-R41 WeakPolarHBondContact O-CG 3.28Å; I37-R41 PolarHBondContact O-N 3.2Å; A38-R41 WeakPolarHBondContact O-CB 3.34Å; A38-R41 PolarHBondContact O-N 3.34Å; Y39-R41 VanDerWaalsContact C-N 3.3Å; Y39-R41 PolarHBondContact O-N 2.92Å; R41-K44 PolarHBondContact O-N 3.35Å; R41-R45 WeakPolarHBondContact O-CB 3.07Å; R41-R45 PolarHBondContact O-N 3.35Å
42	Y	88.8	Confident	81.6	Confident	145 Å²	145	103.8 Å²	103.8	57%	0.569	49%	0.486	S	S	*	.	H	α-helix	trans	-61.1	-48.6	175.6	174.4	-98.6	0	0	0	111.8	A38 Y39 K44 R45 N46	A38-Y42 PolarHBondContact O-N 3.32Å; Y39-Y42 WeakPolarHBondContact O-CB 3.31Å; Y39-Y42 PolarHBondContact O-N 2.84Å; Y39-Y42 VanDerWaalsContact O-N 3.12Å; Y42-K44 PolarHBondContact O-N 2.95Å; Y42-R45 WeakPolarHBondContact O-CB 3.37Å; Y42-R45 PolarHBondContact O-N 3.49Å; Y42-N46 PolarHBondContact O-N 3.02Å
43	I	85.3	Confident	80.8	Confident	51 Å²	51	105 Å²	105	26%	0.262	50%	0.504	S	S	.	.	H	α-helix	trans	-59.9	-47	176.2	-69.4	169.3	0	0	0	110.9	Y39 L40 R45 N46 N47	Y39-I43 HydrophobicContact CD1-CD1 3.75Å; Y39-I43 HydrophobicContact CE1-CD1 3.26Å; Y39-I43 HydrophobicContact CE1-CG1 4.19Å; Y39-I43 HydrophobicContact CE2-CD1 4.34Å; Y39-I43 HydrophobicContact CE2-CG1 4.46Å; Y39-I43 HydrophobicContact CG-CD1 4.47Å; Y39-I43 PolarHBondContact O-N 2.91Å; L40-I43 PolarHBondContact O-N 3.49Å; I43-R45 VanDerWaalsContact C-N 3.28Å; I43-R45 PolarHBondContact O-N 3Å; I43-N46 PolarHBondContact O-N 3.35Å; I43-N47 WeakPolarHBondContact O-CB 3.5Å; I43-N47 PolarHBondContact O-N 3.31Å
44	K	83.1	Confident	79.9	Confident	138 Å²	138	105 Å²	105	60%	0.6	51%	0.509	S	S	*	.	H	α-helix	trans	-59.9	-40.2	177.5	-76.2	-178.2	-179.3	-176	0	111.8	L40 R41 Y42 K48	L40-K44 WeakPolarHBondContact O-CB 3.41Å; L40-K44 WeakPolarHBondContact O-CG 3.26Å; L40-K44 PolarHBondContact O-N 3.34Å; R41-K44 PolarHBondContact O-N 3.35Å; Y42-K44 PolarHBondContact O-N 2.95Å; K44-K48 WeakPolarHBondContact O-CB 3.23Å; K44-K48 PolarHBondContact O-N 2.92Å
45	R	84.6	Confident	78.8	Confident	173 Å²	173	110 Å²	110	65%	0.653	52%	0.521	S	S	*	.	H	α-helix	trans	-63.5	-48.5	174.5	-177.3	177.7	-73.3	166.8	-4.4	110.3	R41 Y42 I43 N47 K48 H49	R41-R45 WeakPolarHBondContact O-CB 3.07Å; R41-R45 PolarHBondContact O-N 3.35Å; Y42-R45 WeakPolarHBondContact O-CB 3.37Å; Y42-R45 PolarHBondContact O-N 3.49Å; I43-R45 VanDerWaalsContact C-N 3.28Å; I43-R45 PolarHBondContact O-N 3Å; R45-N47 PolarHBondContact O-N 2.75Å; R45-K48 WeakPolarHBondContact O-CB 3.39Å; R45-K48 PolarHBondContact O-N 2.97Å; R45-K48 VanDerWaalsContact O-N 3.15Å; R45-H49 PolarHBondContact O-CD2 3.42Å; R45-H49 PolarHBondContact O-N 3.5Å
46	N	80	Confident	77.7	Confident	72 Å²	72	115.6 Å²	115.6	39%	0.385	55%	0.545	S	S	.	.	H	α-helix	trans	-59.2	-47.3	177.8	-169.1	52.9	0	0	0	111.9	Y42 I43 K48 H49 I50	Y42-N46 PolarHBondContact O-N 3.02Å; I43-N46 PolarHBondContact O-N 3.35Å; N46-K48 VanDerWaalsContact C-N 3.29Å; N46-K48 PolarHBondContact O-N 2.77Å; N46-H49 PolarHBondContact O-N 3.29Å; N46-I50 WeakPolarHBondContact ND2-CD1 3.26Å; N46-I50 WeakPolarHBondContact O-CG1 3.19Å; N46-I50 PolarHBondContact O-N 3.43Å
47	N	79.8	Confident	76.2	Confident	79 Å²	79	120.8 Å²	120.8	42%	0.422	57%	0.572	S	S	.	*	H	α-helix	trans	-61.1	-37.1	175.9	-70.8	-14.5	0	0	0	112	I43 R45 N51	I43-N47 WeakPolarHBondContact O-CB 3.5Å; I43-N47 PolarHBondContact O-N 3.31Å; R45-N47 PolarHBondContact O-N 2.75Å; N47-N51 VanDerWaalsContact O-CB 3.23Å; N47-N51 WeakPolarHBondContact O-CB 3.37Å; N47-N51 PolarHBondContact O-N 3.41Å; N47-N51 PolarHBondContact O-ND2 3.28Å
48	K	81	Confident	75.6	Confident	153 Å²	153	122.3 Å²	122.3	67%	0.665	58%	0.577	S	S	*	*	H	α-helix	trans	-65.2	-39.8	172.2	-176.5	179.4	-179.9	178.4	0	112.2	K44 R45 N46 K52	K44-K48 WeakPolarHBondContact O-CB 3.23Å; K44-K48 PolarHBondContact O-N 2.92Å; R45-K48 WeakPolarHBondContact O-CB 3.39Å; R45-K48 PolarHBondContact O-N 2.97Å; R45-K48 VanDerWaalsContact O-N 3.15Å; N46-K48 VanDerWaalsContact C-N 3.29Å; N46-K48 PolarHBondContact O-N 2.77Å; K48-K52 VanDerWaalsContact O-CB 3.29Å; K48-K52 WeakPolarHBondContact O-CB 3.46Å; K48-K52 PolarHBondContact O-N 2.94Å
49	H	75.6	Confident	75.1	Confident	122 Å²	122	125.9 Å²	125.9	57%	0.565	58%	0.584	S	S	*	*	H	α-helix	trans	-68.5	-44	176.9	-83.7	-86.8	0	0	0	111.9	R45 N46 N51 K52 G53	R45-H49 PolarHBondContact O-CD2 3.42Å; R45-H49 PolarHBondContact O-N 3.5Å; N46-H49 PolarHBondContact O-N 3.29Å; H49-N51 VanDerWaalsContact C-N 3.34Å; H49-N51 PolarHBondContact O-N 2.82Å; H49-K52 PolarHBondContact O-N 3.38Å; H49-G53 PolarHBondContact O-N 3.07Å
50	I	72.8	Confident	74.4	Confident	96 Å²	96	129.7 Å²	129.7	49%	0.492	60%	0.604	S	S	.	*	H	α-helix	trans	-57.8	-47.9	172.2	-66.2	168.9	0	0	0	109.8	N46 K52 G53 L54	N46-I50 WeakPolarHBondContact ND2-CD1 3.26Å; N46-I50 WeakPolarHBondContact O-CG1 3.19Å; N46-I50 PolarHBondContact O-N 3.43Å; I50-K52 VanDerWaalsContact C-N 3.34Å; I50-K52 PolarHBondContact O-N 2.8Å; I50-G53 PolarHBondContact O-N 2.78Å; I50-L54 PolarHBondContact O-N 2.64Å
51	N	65.8	Low	73.7	Confident	104 Å²	104	131.9 Å²	131.9	56%	0.556	61%	0.611	S	S	*	*	H	α-helix	trans	-65.2	-33.4	177.3	-74.2	-23.1	0	0	0	113.3	N47 H49 K55	N47-N51 VanDerWaalsContact O-CB 3.23Å; N47-N51 WeakPolarHBondContact O-CB 3.37Å; N47-N51 PolarHBondContact O-N 3.41Å; N47-N51 PolarHBondContact O-ND2 3.28Å; H49-N51 VanDerWaalsContact C-N 3.34Å; H49-N51 PolarHBondContact O-N 2.82Å; N51-K55 WeakPolarHBondContact O-CB 3.36Å; N51-K55 PolarHBondContact O-N 3.3Å
52	K	65.6	Low	72.9	Confident	156 Å²	156	128.9 Å²	128.9	68%	0.678	61%	0.607	S	S	*	*	H	α-helix	trans	-71.4	-34.3	175.1	-166.9	178.3	-177	-175.4	0	111.7	K48 H49 I50	K48-K52 VanDerWaalsContact O-CB 3.29Å; K48-K52 WeakPolarHBondContact O-CB 3.46Å; K48-K52 PolarHBondContact O-N 2.94Å; H49-K52 PolarHBondContact O-N 3.38Å; I50-K52 VanDerWaalsContact C-N 3.34Å; I50-K52 PolarHBondContact O-N 2.8Å
53	G	64.9	Low	71.8	Confident	45 Å²	45	127.8 Å²	127.8	46%	0.464	61%	0.61	S	S	.	*	H	α-helix	trans	-66.4	-44.6	171.9	0	0	0	0	0	111.8	H49 I50 K55 K56	H49-G53 PolarHBondContact O-N 3.07Å; I50-G53 PolarHBondContact O-N 2.78Å; G53-K55 VanDerWaalsContact C-N 3.34Å; G53-K55 PolarHBondContact O-N 2.94Å; G53-K56 PolarHBondContact O-N 3.24Å; G53-K56 VanDerWaalsContact O-N 3.13Å
54	L	62.4	Low	70.9	Confident	123 Å²	123	133.3 Å²	133.3	64%	0.644	64%	0.635	S	S	*	*	H	α-helix	trans	-62.3	-38.7	175.8	-159.6	89.1	0	0	0	112.1	I50 K56 M57	I50-L54 PolarHBondContact O-N 2.64Å; L54-K56 PolarHBondContact O-N 3.3Å; L54-M57 PolarHBondContact O-N 3.5Å; L54-M57 VanDerWaalsContact O-OXT 3.06Å
55	K	62.6	Low	69.9	Low	190 Å²	190	132.9 Å²	132.9	83%	0.826	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.2	-10.2	177.4	-158.7	176.8	-179.5	179.7	0	113.9	N51 G53	N51-K55 WeakPolarHBondContact O-CB 3.36Å; N51-K55 PolarHBondContact O-N 3.3Å; G53-K55 VanDerWaalsContact C-N 3.34Å; G53-K55 PolarHBondContact O-N 2.94Å
56	K	59.1	Low	68.7	Low	194 Å²	194	129.6 Å²	129.6	84%	0.843	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.2	-4.7	177	-154	177.7	178	-173.2	0	112.4	G53 L54	G53-K56 PolarHBondContact O-N 3.24Å; G53-K56 VanDerWaalsContact O-N 3.13Å; L54-K56 PolarHBondContact O-N 3.3Å
57	M	54.8	Low	67.7	Low	221 Å²	221	134.8 Å²	134.8	100%	1.089	66%	0.659	S	S	*	*			trans	-92.2	0	156.9	-76.4	-179.4	150.7	0	0	108.7	L54	L54-M57 PolarHBondContact O-N 3.5Å; L54-M57 VanDerWaalsContact O-OXT 3.06Å

Retrieved 57 of 57 residues in 71.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).