G4VRD1_SCHMA Loading...

Zinc finger, CCHC-type

AlphaFold DB , UniProt , Accession G4VRD1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 137 aa.

						>G4VRD1_SCHMA|G4VRD1
MPFHIGDKSGHFDANQNRFNLQDPGFGPSEGVYNNRMDPRYGNMNPNYYGGVPGTFGGNGMYGQNIYNQQPGSQAWNAGRRHLNGSDSDDSDIDKRNFRGSGPGWNQGRHGSHSNRRGHSSDRGSSSDEGRRNRHWR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.6	Very low	49.7	Very low	234 Å²	234	147.1 Å²	147.1	100%	1.153	80%	0.803	S	S	*	*				0	112.8	0	58.4	-155.9	179.9	0	0	108.5
2	P	50.5	Low	49.4	Very low	107 Å²	107	148.1 Å²	148.1	70%	0.695	79%	0.794	S	S	*	*			trans	-77.7	143.1	172.9	32.4	-31.9	0	0	0	110
3	F	54.1	Low	49.1	Very low	182 Å²	182	143.2 Å²	143.2	80%	0.798	77%	0.767	S	S	*	*			trans	-75.1	148.5	176.5	52.5	-89	0	0	0	110.7
4	H	55	Low	48.9	Very low	138 Å²	138	137.1 Å²	137.1	64%	0.639	75%	0.747	S	S	*	*			trans	-113.1	148.7	176.6	-69.2	100.8	0	0	0	111.2	G6 D7	H4-G6 PolarHBondContact O-N 2.98Å; H4-D7 PolarHBondContact N-OD2 2.93Å; H4-D7 PolarHBondContact O-N 2.78Å
5	I	46.4	Very low	48.9	Very low	187 Å²	187	138.1 Å²	138.1	96%	0.959	75%	0.751	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.2	98.3	176	-59.2	173	0	0	0	108.1
6	G	52.4	Low	48.7	Very low	58 Å²	58	139.1 Å²	139.1	60%	0.598	75%	0.75	S	S	*	*	T	Hydrogen-bonded Turn	trans	146	-11.3	-171.2	0	0	0	0	0	114.9	H4 K8	H4-G6 PolarHBondContact O-N 2.98Å; G6-K8 WeakPolarHBondContact O-CG 3.5Å; G6-K8 PolarHBondContact O-N 3.05Å
7	D	50.4	Low	48.3	Very low	111 Å²	111	135.8 Å²	135.8	59%	0.594	73%	0.731	S	S	*	*			trans	-67.1	91.4	177.1	-68.3	-32.8	0	0	0	111.6	H4 S9	H4-D7 PolarHBondContact N-OD2 2.93Å; H4-D7 PolarHBondContact O-N 2.78Å; D7-S9 PolarHBondContact O-N 3.04Å; D7-S9 VanDerWaalsContact O-N 3.14Å
8	K	51.7	Low	47.7	Very low	205 Å²	205	135.7 Å²	135.7	89%	0.891	72%	0.719	S	S	*	*			trans	-81.4	84	-176.4	-70.7	170.9	-173.2	176.1	0	112.1	G6	G6-K8 WeakPolarHBondContact O-CG 3.5Å; G6-K8 PolarHBondContact O-N 3.05Å
9	S	47.4	Very low	47.4	Very low	124 Å²	124	133.1 Å²	133.1	87%	0.867	70%	0.701	S	S	*	*			trans	-125.4	46.1	167.7	54.3	0	0	0	0	112.5	D7	D7-S9 PolarHBondContact O-N 3.04Å; D7-S9 VanDerWaalsContact O-N 3.14Å
10	G	44.4	Very low	46.9	Very low	66 Å²	66	132.1 Å²	132.1	68%	0.68	70%	0.696	S	S	*	*	S	Bend	trans	-151.5	115.7	173.5	0	0	0	0	0	111	F12	G10-F12 PolarHBondContact O-N 3.14Å
11	H	44.2	Very low	46.8	Very low	206 Å²	206	130.9 Å²	130.9	95%	0.954	69%	0.69	S	S	*	*			trans	-67.8	101.3	176	-75.8	95.5	0	0	0	110.1
12	F	46.6	Very low	46.4	Very low	159 Å²	159	126.5 Å²	126.5	70%	0.697	67%	0.666	S	S	*	*			trans	-100.3	94.8	163.4	-174	-98.8	0	0	0	109.1	G10 A14	G10-F12 PolarHBondContact O-N 3.14Å; F12-A14 HydrophobicContact CD1-CB 4.11Å; F12-A14 HydrophobicContact CE1-CB 3.9Å; F12-A14 PolarHBondContact O-N 2.9Å; F12-A14 VanDerWaalsContact O-N 3.09Å
13	D	45.5	Very low	45.7	Very low	84 Å²	84	128.1 Å²	128.1	45%	0.449	67%	0.669	S	S	.	*			trans	-76	95.9	172	-172.3	-0.6	0	0	0	109.8	N15 Q16	D13-N15 PolarHBondContact O-N 3.2Å; D13-N15 WeakPolarHBondContact OD1-CB 3.02Å; D13-N15 PolarHBondContact OD1-N 3Å; D13-N15 VanDerWaalsContact OD1-N 3.15Å; D13-N15 PolarHBondContact OD1-ND2 3.2Å; D13-N15 VanDerWaalsContact OD1-ND2 3.11Å; D13-Q16 PolarHBondContact O-N 2.87Å
14	A	46.2	Very low	44.9	Very low	59 Å²	59	125 Å²	125	49%	0.488	67%	0.667	S	S	.	*	T	Hydrogen-bonded Turn	trans	-63.5	-4.8	-178.4	0	0	0	0	0	114.1	F12	F12-A14 HydrophobicContact CD1-CB 4.11Å; F12-A14 HydrophobicContact CE1-CB 3.9Å; F12-A14 PolarHBondContact O-N 2.9Å; F12-A14 VanDerWaalsContact O-N 3.09Å
15	N	49.2	Very low	43.8	Very low	151 Å²	151	121.9 Å²	121.9	81%	0.807	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91	-10	-178.3	-61.1	-62.4	0	0	0	115	D13	D13-N15 PolarHBondContact O-N 3.2Å; D13-N15 WeakPolarHBondContact OD1-CB 3.02Å; D13-N15 PolarHBondContact OD1-N 3Å; D13-N15 VanDerWaalsContact OD1-N 3.15Å; D13-N15 PolarHBondContact OD1-ND2 3.2Å; D13-N15 VanDerWaalsContact OD1-ND2 3.11Å
16	Q	45.2	Very low	43.1	Very low	155 Å²	155	123.2 Å²	123.2	72%	0.724	67%	0.672	S	S	*	*	S	Bend	trans	-94.6	-1.6	-175.4	-64.4	-166.3	-31	0	0	115.5	D13	D13-Q16 PolarHBondContact O-N 2.87Å
17	N	42.3	Very low	42.1	Very low	82 Å²	82	123.3 Å²	123.3	44%	0.439	67%	0.673	S	S	.	*			trans	-109	45.7	-160.6	-157.1	-13	0	0	0	115.5	R36	N17-R36 VanDerWaalsContact C-CZ 3.45Å; N17-R36 WeakPolarHBondContact O-CG 3.35Å; N17-R36 PolarHBondContact O-NE 3.15Å; N17-R36 VanDerWaalsContact O-NE 3.16Å; N17-R36 VanDerWaalsContact OD1-CZ 3.27Å; N17-R36 PolarHBondContact OD1-NE 2.71Å; N17-R36 PolarHBondContact OD1-NH2 3.11Å
18	R	38.2	Very low	41.5	Very low	134 Å²	134	125.1 Å²	125.1	51%	0.506	69%	0.691	S	S	.	*			trans	-154.5	140.2	172	-48.7	179.7	-155.5	-122.2	-1.2	108.5	R36 M37 P39	R18-R36 HydrophobicContact CB-CB 4.18Å; R18-R36 HydrophobicContact CG-CB 4.29Å; R18-M37 PolarHBondContact NH1-O 2.84Å; R18-P39 VanDerWaalsContact CD-CD 3.44Å
19	F	40.5	Very low	40.6	Very low	86 Å²	86	120.3 Å²	120.3	38%	0.377	68%	0.683	S	S	.	*			cis	-118.6	-176.7	-0.8	-93.6	-107.8	0	0	0	111	R36 D38	F19-R36 WeakPolarHBondContact CD1-O 3.39Å; F19-R36 WeakPolarHBondContact CE1-O 3.35Å; F19-R36 WeakPolarHBondContact CZ-O 2.98Å; F19-R36 PolarHBondContact O-NH1 3.09Å; F19-D38 HydrophobicContact CE2-CB 3.62Å; F19-D38 HydrophobicContact CZ-CB 3.82Å
20	N	39	Very low	40	Very low	114 Å²	114	123.5 Å²	123.5	61%	0.61	68%	0.684	S	S	*	*			trans	-169.7	56.1	145.2	-92.4	-6.4	0	0	0	112	Q22 N35	N20-Q22 VanDerWaalsContact C-N 3.27Å; N20-Q22 PolarHBondContact O-N 3.49Å; N20-N35 VanDerWaalsContact C-CG 3.41Å; N20-N35 WeakPolarHBondContact CA-OD1 3.33Å; N20-N35 PolarHBondContact N-OD1 3.16Å; N20-N35 PolarHBondContact O-ND2 3.06Å
21	L	44.1	Very low	39.5	Very low	107 Å²	107	123.5 Å²	123.5	56%	0.56	69%	0.685	S	S	*	*			trans	-44.1	35.4	167.2	-125.4	68.3	0	0	0	121.2	D23 N35	L21-D23 VanDerWaalsContact C-N 3.29Å; L21-D23 PolarHBondContact O-N 2.84Å; L21-N35 HydrophobicContact CB-CB 3.63Å; L21-N35 VanDerWaalsContact CB-ND2 3.33Å; L21-N35 WeakPolarHBondContact CB-ND2 3.37Å; L21-N35 HydrophobicContact CD1-CB 4.02Å; L21-N35 WeakPolarHBondContact CD1-ND2 3.47Å; L21-N35 HydrophobicContact CD2-CB 3.97Å; L21-N35 HydrophobicContact CG-CB 4.04Å; L21-N35 VanDerWaalsContact N-CG 3.27Å; L21-N35 PolarHBondContact N-ND2 3.4Å; L21-N35 PolarHBondContact N-OD1 2.98Å
22	Q	41	Very low	38.8	Very low	142 Å²	142	119.3 Å²	119.3	66%	0.664	67%	0.673	S	S	*	*			trans	-78.6	78.4	-174.1	-79	172.4	-14	0	0	114.1	N20	N20-Q22 VanDerWaalsContact C-N 3.27Å; N20-Q22 PolarHBondContact O-N 3.49Å
23	D	35.7	Very low	38.3	Very low	140 Å²	140	119.1 Å²	119.1	75%	0.749	67%	0.669	S	S	*	*			trans	67.3	158.6	135.6	-94.7	-15.7	0	0	0	120.7	L21 G25	L21-D23 VanDerWaalsContact C-N 3.29Å; L21-D23 PolarHBondContact O-N 2.84Å; D23-G25 PolarHBondContact O-N 2.91Å
24	P	38.3	Very low	37.8	Very low	117 Å²	117	121.4 Å²	121.4	76%	0.76	68%	0.681	S	S	*	*			trans	-113.6	86.5	-141.2	25.2	-3.5	0	0	0	110.8
25	G	30.4	Very low	37.5	Very low	73 Å²	73	120.6 Å²	120.6	75%	0.753	67%	0.668	S	S	*	*			trans	-90.7	120.3	-173.7	0	0	0	0	0	114.8	D23	D23-G25 PolarHBondContact O-N 2.91Å
26	F	32	Very low	36.9	Very low	214 Å²	214	117.6 Å²	117.6	94%	0.939	65%	0.646	S	S	*	*			trans	-30	141.7	153.8	-79.4	-113.8	0	0	0	115.7
27	G	32.8	Very low	36.8	Very low	61 Å²	61	117.9 Å²	117.9	63%	0.629	65%	0.649	S	S	*	*	S	Bend	trans	84	167.2	153.3	0	0	0	0	0	115.8	S29	G27-S29 PolarHBondContact O-N 2.85Å
28	P	35.8	Very low	36.6	Very low	148 Å²	148	115.6 Å²	115.6	96%	0.961	64%	0.637	S	S	*	*			trans	-86.7	77.3	-156.1	34.9	-36.2	0	0	0	111.8
29	S	33.9	Very low	37	Very low	105 Å²	105	113.4 Å²	113.4	73%	0.734	64%	0.64	S	S	*	*			trans	-113.4	134.4	163.4	-164	0	0	0	0	108.7	G27 G31	G27-S29 PolarHBondContact O-N 2.85Å; S29-G31 VanDerWaalsContact C-N 3.3Å; S29-G31 PolarHBondContact O-N 2.93Å
30	E	34.5	Very low	37.2	Very low	190 Å²	190	119.3 Å²	119.3	89%	0.888	66%	0.66	S	S	*	*			trans	-67.9	85	-172.4	-63.8	171	152	0	0	109.8	V32	E30-V32 PolarHBondContact O-N 3.27Å
31	G	33.3	Very low	37.3	Very low	67 Å²	67	121.7 Å²	121.7	69%	0.691	66%	0.661	S	S	*	*			trans	-82.7	82.4	-152.4	0	0	0	0	0	116.1	S29 Y33	S29-G31 VanDerWaalsContact C-N 3.3Å; S29-G31 PolarHBondContact O-N 2.93Å; G31-Y33 PolarHBondContact O-N 2.66Å
32	V	31	Very low	37	Very low	117 Å²	117	119.6 Å²	119.6	71%	0.709	67%	0.666	S	S	*	*			trans	-71.8	83.9	177.9	-171.6	0	0	0	0	112.7	E30	E30-V32 PolarHBondContact O-N 3.27Å
33	Y	36	Very low	36.9	Very low	155 Å²	155	120.4 Å²	120.4	61%	0.608	68%	0.675	S	S	*	*			trans	-130.1	89.2	174.3	-81.4	-81.6	0	0	0	115.5	G31 N35	G31-Y33 PolarHBondContact O-N 2.66Å; Y33-N35 PolarHBondContact O-N 2.79Å
34	N	33.4	Very low	37.2	Very low	132 Å²	132	120.2 Å²	120.2	71%	0.706	67%	0.671	S	S	*	*			trans	-62	101.5	179.2	-75.3	-69.7	0	0	0	114.9
35	N	41.2	Very low	37.3	Very low	42 Å²	42	118.4 Å²	118.4	23%	0.225	66%	0.655	C	S	.	*			trans	-141.8	98.4	175.1	-78.1	-75.3	0	0	0	114.5	N20 L21 Y33	N20-N35 VanDerWaalsContact C-CG 3.41Å; N20-N35 WeakPolarHBondContact CA-OD1 3.33Å; N20-N35 PolarHBondContact N-OD1 3.16Å; N20-N35 PolarHBondContact O-ND2 3.06Å; L21-N35 HydrophobicContact CB-CB 3.63Å; L21-N35 VanDerWaalsContact CB-ND2 3.33Å; L21-N35 WeakPolarHBondContact CB-ND2 3.37Å; L21-N35 HydrophobicContact CD1-CB 4.02Å; L21-N35 WeakPolarHBondContact CD1-ND2 3.47Å; L21-N35 HydrophobicContact CD2-CB 3.97Å; L21-N35 HydrophobicContact CG-CB 4.04Å; L21-N35 VanDerWaalsContact N-CG 3.27Å; L21-N35 PolarHBondContact N-ND2 3.4Å; L21-N35 PolarHBondContact N-OD1 2.98Å; Y33-N35 PolarHBondContact O-N 2.79Å
36	R	35.3	Very low	38.2	Very low	89 Å²	89	120.9 Å²	120.9	34%	0.336	66%	0.658	S	S	.	*				54.4	92.8	75.7	-58.2	164.1	148.3	-157.5	6.6	109.8	N17 R18 F19	N17-R36 VanDerWaalsContact C-CZ 3.45Å; N17-R36 WeakPolarHBondContact O-CG 3.35Å; N17-R36 PolarHBondContact O-NE 3.15Å; N17-R36 VanDerWaalsContact O-NE 3.16Å; N17-R36 VanDerWaalsContact OD1-CZ 3.27Å; N17-R36 PolarHBondContact OD1-NE 2.71Å; N17-R36 PolarHBondContact OD1-NH2 3.11Å; R18-R36 HydrophobicContact CB-CB 4.18Å; R18-R36 HydrophobicContact CG-CB 4.29Å; F19-R36 WeakPolarHBondContact CD1-O 3.39Å; F19-R36 WeakPolarHBondContact CE1-O 3.35Å; F19-R36 WeakPolarHBondContact CZ-O 2.98Å; F19-R36 PolarHBondContact O-NH1 3.09Å
37	M	43.8	Very low	39	Very low	160 Å²	160	117.2 Å²	117.2	79%	0.788	65%	0.648	S	S	*	*			trans	-106.9	145.3	167.4	-87.5	-78.3	-175.4	0	0	109.6	R18	R18-M37 PolarHBondContact NH1-O 2.84Å
38	D	39.1	Very low	39.4	Very low	34 Å²	34	123.7 Å²	123.7	18%	0.182	65%	0.654	C	S	.	*			trans	-79.8	131.7	-164.4	-156.4	-53.6	0	0	0	113	F19 R40 Y41	F19-D38 HydrophobicContact CE2-CB 3.62Å; F19-D38 HydrophobicContact CZ-CB 3.82Å; D38-R40 PolarHBondContact O-N 3.09Å; D38-R40 WeakPolarHBondContact OD1-CB 3.37Å; D38-R40 WeakPolarHBondContact OD1-CD 3.18Å; D38-R40 WeakPolarHBondContact OD1-CG 3.43Å; D38-R40 PolarHBondContact OD1-N 2.81Å; D38-R40 IonicContact OD1-NE 2.61Å; D38-Y41 HydrophobicContact CB-CD2 4.04Å; D38-Y41 PolarHBondContact O-N 2.79Å; D38-Y41 VanDerWaalsContact O-N 3.1Å
39	P	45.3	Very low	39.3	Very low	88 Å²	88	127.2 Å²	127.2	57%	0.571	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.1	-16.6	174.1	28.9	-36.3	0	0	0	113.5	R18 Y41	R18-P39 VanDerWaalsContact CD-CD 3.44Å; P39-Y41 VanDerWaalsContact C-N 3.29Å
40	R	45.8	Very low	39.4	Very low	210 Å²	210	125.6 Å²	125.6	79%	0.792	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.1	-22.4	173.8	-58.6	165.4	-160.6	-167.7	6	112.5	D38	D38-R40 PolarHBondContact O-N 3.09Å; D38-R40 WeakPolarHBondContact OD1-CB 3.37Å; D38-R40 WeakPolarHBondContact OD1-CD 3.18Å; D38-R40 WeakPolarHBondContact OD1-CG 3.43Å; D38-R40 PolarHBondContact OD1-N 2.81Å; D38-R40 IonicContact OD1-NE 2.61Å
41	Y	41	Very low	39.2	Very low	164 Å²	164	120 Å²	120	64%	0.643	64%	0.644	S	S	*	*	S	Bend	trans	-110	63.4	176.3	-64.7	-62.8	0	0	0	110.4	D38 P39 N43 M44	D38-Y41 HydrophobicContact CB-CD2 4.04Å; D38-Y41 PolarHBondContact O-N 2.79Å; D38-Y41 VanDerWaalsContact O-N 3.1Å; P39-Y41 VanDerWaalsContact C-N 3.29Å; Y41-N43 PolarHBondContact O-N 2.93Å; Y41-N43 VanDerWaalsContact O-N 3.14Å; Y41-M44 HydrophobicContact CD1-CE 3.36Å; Y41-M44 HydrophobicContact CE1-CE 4.06Å; Y41-M44 HydrophobicContact CG-CE 4Å
42	G	37.1	Very low	39.5	Very low	63 Å²	63	123.3 Å²	123.3	65%	0.649	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.7	117.7	167.3	0	0	0	0	0	110.8
43	N	39.8	Very low	39.9	Very low	160 Å²	160	123.4 Å²	123.4	86%	0.856	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	67.6	42.6	157.6	-150.9	12.8	0	0	0	116.9	Y41	Y41-N43 PolarHBondContact O-N 2.93Å; Y41-N43 VanDerWaalsContact O-N 3.14Å
44	M	40.4	Very low	39.8	Very low	135 Å²	135	119.4 Å²	119.4	67%	0.665	66%	0.659	S	S	*	*			trans	-91.7	96.2	160.5	-79.2	-170.6	-73.2	0	0	111.1	Y41	Y41-M44 HydrophobicContact CD1-CE 3.36Å; Y41-M44 HydrophobicContact CE1-CE 4.06Å; Y41-M44 HydrophobicContact CG-CE 4Å
45	N	41.1	Very low	40	Very low	80 Å²	80	118.6 Å²	118.6	43%	0.428	66%	0.659	S	S	.	*			trans	-53.7	129	171.2	178.7	-2.7	0	0	0	110.9	N47 Y48	N45-N47 PolarHBondContact O-N 3.44Å; N45-N47 WeakPolarHBondContact OD1-CB 3.22Å; N45-N47 PolarHBondContact OD1-N 3.23Å; N45-N47 VanDerWaalsContact OD1-N 3.09Å; N45-N47 PolarHBondContact OD1-ND2 2.81Å; N45-Y48 WeakPolarHBondContact O-CB 3.12Å; N45-Y48 PolarHBondContact O-N 3.14Å; N45-Y48 VanDerWaalsContact O-N 3.12Å
46	P	48.7	Very low	39.9	Very low	125 Å²	125	126.8 Å²	126.8	81%	0.812	69%	0.693	S	S	*	*	G	3₁₀ helix	trans	-62.1	-10	178.7	24.6	-34.4	0	0	0	114.5	Y48	P46-Y48 PolarHBondContact O-N 3.1Å
47	N	49	Very low	39.7	Very low	136 Å²	136	126.3 Å²	126.3	73%	0.727	72%	0.715	S	S	*	*	G	3₁₀ helix	trans	-72.1	4.9	170.6	-65.7	-71.9	0	0	0	114.6	N45	N45-N47 PolarHBondContact O-N 3.44Å; N45-N47 WeakPolarHBondContact OD1-CB 3.22Å; N45-N47 PolarHBondContact OD1-N 3.23Å; N45-N47 VanDerWaalsContact OD1-N 3.09Å; N45-N47 PolarHBondContact OD1-ND2 2.81Å
48	Y	41	Very low	39.2	Very low	197 Å²	197	121.9 Å²	121.9	77%	0.773	71%	0.711	S	S	*	*	G	3₁₀ helix	trans	-91.1	-5.3	-174.4	-129	-88.5	0	0	0	116.1	N45 P46	N45-Y48 WeakPolarHBondContact O-CB 3.12Å; N45-Y48 PolarHBondContact O-N 3.14Å; N45-Y48 VanDerWaalsContact O-N 3.12Å; P46-Y48 PolarHBondContact O-N 3.1Å
49	Y	35.3	Very low	39	Very low	223 Å²	223	127.8 Å²	127.8	88%	0.875	74%	0.743	S	S	*	*	S	Bend	trans	-98.4	120.6	171.8	-87.4	-88	0	0	0	111
50	G	34.9	Very low	38.4	Very low	70 Å²	70	126.5 Å²	126.5	72%	0.722	75%	0.745	S	S	*	*	P	Polyproline II helix	trans	-56.7	145.8	-173.1	0	0	0	0	0	112.9
51	G	31.8	Very low	38	Very low	74 Å²	74	124.3 Å²	124.3	76%	0.763	75%	0.746	S	S	*	*	P	Polyproline II helix	trans	-59.1	139.4	-175.5	0	0	0	0	0	112.9	P53	G51-P53 WeakPolarHBondContact O-CD 3.48Å
52	V	38	Very low	37.8	Very low	136 Å²	136	125.9 Å²	125.9	82%	0.824	75%	0.752	S	S	*	*			trans	-96.8	105	158	179.2	0	0	0	0	106.4	G54	V52-G54 PolarHBondContact O-N 2.82Å
53	P	39	Very low	37.9	Very low	119 Å²	119	126.7 Å²	126.7	77%	0.773	76%	0.76	S	S	*	*			trans	-77.2	126	-174.8	-11.8	28.6	0	0	0	111.4	G51	G51-P53 WeakPolarHBondContact O-CD 3.48Å
54	G	35.2	Very low	37.9	Very low	70 Å²	70	127.1 Å²	127.1	72%	0.722	76%	0.757	S	S	*	*			trans	52.4	87.6	147.7	0	0	0	0	0	118.5	V52	V52-G54 PolarHBondContact O-N 2.82Å
55	T	37.8	Very low	38	Very low	116 Å²	116	125.6 Å²	125.6	71%	0.712	75%	0.752	S	S	*	*	S	Bend	trans	-121.9	115.8	153.9	36.3	0	0	0	0	109.8
56	F	38.9	Very low	38.2	Very low	214 Å²	214	128.9 Å²	128.9	94%	0.939	77%	0.768	S	S	*	*	S	Bend	trans	56.1	77.1	173.6	-46.2	-80	0	0	0	117.1
57	G	31.7	Very low	37.8	Very low	78 Å²	78	132.7 Å²	132.7	80%	0.804	77%	0.767	S	S	*	*	S	Bend	cis	162.8	138.2	1	0	0	0	0	0	108.7
58	G	32.4	Very low	37.5	Very low	68 Å²	68	131.3 Å²	131.3	70%	0.701	76%	0.76	S	S	*	*	S	Bend	cis	-161.3	53.8	1.3	0	0	0	0	0	112.6
59	N	34.6	Very low	37.6	Very low	158 Å²	158	130.2 Å²	130.2	85%	0.845	76%	0.762	S	S	*	*			trans	-162.3	91.5	153	-108.5	-43.1	0	0	0	110.1	M61	N59-M61 VanDerWaalsContact C-N 3.28Å; N59-M61 PolarHBondContact O-N 3.21Å
60	G	32.3	Very low	37.9	Very low	61 Å²	61	126.6 Å²	126.6	63%	0.629	75%	0.753	S	S	*	*			trans	-73.1	80.1	175.3	0	0	0	0	0	111.2	Y62	G60-Y62 WeakPolarHBondContact O-CD2 3.42Å; G60-Y62 WeakPolarHBondContact O-CE2 3.49Å
61	M	38.2	Very low	38.2	Very low	164 Å²	164	128.5 Å²	128.5	81%	0.808	75%	0.753	S	S	*	*			trans	-116.4	78.1	159.5	-66.7	-162.4	79.7	0	0	108.4	N59 G63	N59-M61 VanDerWaalsContact C-N 3.28Å; N59-M61 PolarHBondContact O-N 3.21Å; M61-G63 PolarHBondContact O-N 2.73Å
62	Y	36.7	Very low	38.5	Very low	197 Å²	197	127.4 Å²	127.4	77%	0.773	74%	0.741	S	S	*	*			trans	3	116.7	148.1	-48	-85.8	0	0	0	112.2	G60 Q64	G60-Y62 WeakPolarHBondContact O-CD2 3.42Å; G60-Y62 WeakPolarHBondContact O-CE2 3.49Å; Y62-Q64 PolarHBondContact O-N 3.03Å
63	G	39.5	Very low	38.7	Very low	79 Å²	79	126.1 Å²	126.1	81%	0.814	74%	0.738	S	S	*	*				70.6	0.6	72.5	0	0	0	0	0	112.3	M61 N65	M61-G63 PolarHBondContact O-N 2.73Å; G63-N65 PolarHBondContact O-N 3.19Å
64	Q	40.5	Very low	39	Very low	169 Å²	169	128.3 Å²	128.3	79%	0.79	74%	0.738	S	S	*	*			trans	-73	81.2	173.6	-67.3	-168	17.2	0	0	109.3	Y62 I66	Y62-Q64 PolarHBondContact O-N 3.03Å; Q64-I66 PolarHBondContact O-N 3.27Å
65	N	41.7	Very low	39.5	Very low	104 Å²	104	127.7 Å²	127.7	56%	0.556	73%	0.727	S	S	*	*			trans	-28	121.2	154.6	-110.8	-35.3	0	0	0	110.1	G63 Y67 N68	G63-N65 PolarHBondContact O-N 3.19Å; N65-Y67 PolarHBondContact O-N 3.28Å; N65-Y67 VanDerWaalsContact O-N 3.09Å; N65-N68 HydrophobicContact CB-CB 3.58Å; N65-N68 WeakPolarHBondContact O-CB 3.43Å; N65-N68 PolarHBondContact O-N 3.47Å
66	I	43.9	Very low	39.7	Very low	148 Å²	148	131.7 Å²	131.7	76%	0.759	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.2	-19.2	169.4	-62.4	169.3	0	0	0	110.1	Q64	Q64-I66 PolarHBondContact O-N 3.27Å
67	Y	40.6	Very low	40	Very low	205 Å²	205	126.3 Å²	126.3	80%	0.804	71%	0.71	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86	0.7	171.3	-59.8	-76.6	0	0	0	115.5	N65	N65-Y67 PolarHBondContact O-N 3.28Å; N65-Y67 VanDerWaalsContact O-N 3.09Å
68	N	43.9	Very low	40.5	Very low	107 Å²	107	125.6 Å²	125.6	57%	0.572	70%	0.696	S	S	*	*			trans	-104.3	22.8	179.4	-151.8	69.7	0	0	0	113.1	N65 Q70	N65-N68 HydrophobicContact CB-CB 3.58Å; N65-N68 WeakPolarHBondContact O-CB 3.43Å; N65-N68 PolarHBondContact O-N 3.47Å; N68-Q70 PolarHBondContact O-N 3.48Å
69	Q	41.7	Very low	40.8	Very low	174 Å²	174	125.5 Å²	125.5	81%	0.813	70%	0.695	S	S	*	*			trans	-70.7	45.5	153.3	-65.8	-171.7	85.2	0	0	110.6
70	Q	43.2	Very low	41.3	Very low	147 Å²	147	126 Å²	126	69%	0.687	69%	0.685	S	S	*	*			trans	-64.9	132.1	174.7	-67.6	-145.3	-24	0	0	108.1	N68 G72	N68-Q70 PolarHBondContact O-N 3.48Å; Q70-G72 PolarHBondContact O-N 2.92Å
71	P	40.3	Very low	42.1	Very low	111 Å²	111	133.1 Å²	133.1	72%	0.721	69%	0.693	S	S	*	*			trans	-70.1	78.5	178.4	27.8	-34	0	0	0	110.3	S73 A75	P71-S73 PolarHBondContact O-N 3.22Å; P71-A75 HydrophobicContact CB-CB 4.09Å
72	G	38	Very low	42.2	Very low	51 Å²	51	133.7 Å²	133.7	53%	0.526	69%	0.693	S	S	.	*			trans	-68	100.6	-177.2	0	0	0	0	0	111.5	Q70 Q74	Q70-G72 PolarHBondContact O-N 2.92Å; G72-Q74 PolarHBondContact O-N 3.12Å
73	S	43.6	Very low	42.4	Very low	108 Å²	108	131.3 Å²	131.3	76%	0.755	69%	0.693	S	S	*	*	S	Bend	trans	52	-19	163.2	64.1	0	0	0	0	120.4	P71	P71-S73 PolarHBondContact O-N 3.22Å
74	Q	43.4	Very low	42.4	Very low	165 Å²	165	135 Å²	135	77%	0.771	69%	0.694	S	S	*	*	S	Bend	trans	-76	-25.3	173.6	-68	-179.9	-86.8	0	0	112.3	G72 W76 N77	G72-Q74 PolarHBondContact O-N 3.12Å; Q74-W76 VanDerWaalsContact C-N 3.25Å; Q74-W76 PolarHBondContact O-N 3.13Å; Q74-N77 PolarHBondContact O-N 3.09Å; Q74-N77 VanDerWaalsContact O-N 3.13Å
75	A	45.7	Very low	42	Very low	58 Å²	58	130.8 Å²	130.8	48%	0.479	70%	0.696	S	S	.	*	H	α-helix	trans	-60.3	-31.5	177.7	0	0	0	0	0	113.3	P71 N77 A78 G79	P71-A75 HydrophobicContact CB-CB 4.09Å; A75-N77 PolarHBondContact O-N 2.98Å; A75-A78 PolarHBondContact O-N 2.76Å; A75-G79 PolarHBondContact O-N 2.7Å
76	W	43.2	Very low	41.8	Very low	199 Å²	199	131.2 Å²	131.2	75%	0.754	71%	0.707	S	S	*	*	H	α-helix	trans	-66.8	-21.9	178.1	-173.4	-92.2	0	0	0	113.7	Q74	Q74-W76 VanDerWaalsContact C-N 3.25Å; Q74-W76 PolarHBondContact O-N 3.13Å
77	N	44.3	Very low	41.4	Very low	102 Å²	102	132.3 Å²	132.3	55%	0.545	71%	0.714	S	S	.	*	H	α-helix	trans	-96.2	-8.7	175.4	-83.5	-34.4	0	0	0	113.9	Q74 A75	Q74-N77 PolarHBondContact O-N 3.09Å; Q74-N77 VanDerWaalsContact O-N 3.13Å; A75-N77 PolarHBondContact O-N 2.98Å
78	A	42	Very low	41.5	Very low	63 Å²	63	127.5 Å²	127.5	52%	0.521	71%	0.711	S	S	.	*	H	α-helix	trans	-77.6	-40.3	170	0	0	0	0	0	111.5	A75 R80 R81	A75-A78 PolarHBondContact O-N 2.76Å; A78-R80 PolarHBondContact O-N 3.47Å; A78-R80 VanDerWaalsContact O-N 3.09Å; A78-R81 PolarHBondContact O-N 3.09Å
79	G	40	Very low	41.4	Very low	65 Å²	65	130 Å²	130	67%	0.67	72%	0.724	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.1	-4	-175.6	0	0	0	0	0	117	A75	A75-G79 PolarHBondContact O-N 2.7Å
80	R	43.6	Very low	41.6	Very low	169 Å²	169	128.7 Å²	128.7	64%	0.638	72%	0.723	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.4	3.5	-179.7	-103.4	-170.6	-68.3	-179.6	1.9	115.3	A78	A78-R80 PolarHBondContact O-N 3.47Å; A78-R80 VanDerWaalsContact O-N 3.09Å
81	R	49.1	Very low	41.6	Very low	210 Å²	210	127 Å²	127	79%	0.792	73%	0.728	S	S	*	*	S	Bend	trans	-99.6	-11.3	-177.5	-64.7	-172.7	-178.8	-167.4	-1.8	114.9	A78	A78-R81 PolarHBondContact O-N 3.09Å
82	H	41.4	Very low	42.1	Very low	176 Å²	176	126 Å²	126	82%	0.815	72%	0.716	S	S	*	*			trans	-111.6	46	-171.3	-65.3	-172.1	0	0	0	113.1
83	L	41.8	Very low	42.5	Very low	147 Å²	147	129.9 Å²	129.9	77%	0.77	72%	0.723	S	S	*	*	S	Bend	trans	-104	-4	176.2	-87.6	166.2	0	0	0	114.5
84	N	39.6	Very low	42.7	Very low	158 Å²	158	132.7 Å²	132.7	85%	0.845	73%	0.73	S	S	*	*	S	Bend	trans	-114.8	102.6	172	-68.1	-18.4	0	0	0	107.7	S86	N84-S86 PolarHBondContact O-N 3.3Å
85	G	31.9	Very low	42.8	Very low	80 Å²	80	132.5 Å²	132.5	83%	0.825	73%	0.726	S	S	*	*			trans	-71.3	125.7	-178.6	0	0	0	0	0	111.9
86	S	37.4	Very low	42.9	Very low	112 Å²	112	138 Å²	138	78%	0.783	74%	0.735	S	S	*	*			trans	-136.1	105.4	156.5	-71.7	0	0	0	0	106.6	N84 S88	N84-S86 PolarHBondContact O-N 3.3Å; S86-S88 PolarHBondContact O-N 3.49Å
87	D	35.1	Very low	42.9	Very low	171 Å²	171	136 Å²	136	91%	0.914	74%	0.739	S	S	*	*			trans	-62.5	120.3	172.3	-63.7	-58.7	0	0	0	109.1
88	S	42.2	Very low	43	Very low	104 Å²	104	141.2 Å²	141.2	73%	0.727	76%	0.757	S	S	*	*			trans	-157.3	124.8	170.6	-71.7	0	0	0	0	109.5	S86 D90	S86-S88 PolarHBondContact O-N 3.49Å; S88-D90 PolarHBondContact O-N 3.38Å
89	D	43	Very low	42.9	Very low	161 Å²	161	150 Å²	150	86%	0.861	78%	0.776	S	S	*	*			trans	-64.5	112.7	-177.2	-62.4	-73.4	0	0	0	112.3
90	D	45.2	Very low	42.9	Very low	145 Å²	145	150.4 Å²	150.4	78%	0.775	78%	0.781	S	S	*	*			trans	-107.3	69.5	167.4	-96.9	-31.7	0	0	0	110.8	S88 D92	S88-D90 PolarHBondContact O-N 3.38Å; D90-D92 PolarHBondContact O-N 2.61Å
91	S	42.7	Very low	42.7	Very low	113 Å²	113	148.2 Å²	148.2	79%	0.79	79%	0.792	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.2	58.3	173	61.8	0	0	0	0	112.4
92	D	50.9	Low	42	Very low	90 Å²	90	141.2 Å²	141.2	48%	0.481	79%	0.785	S	S	.	*	T	Hydrogen-bonded Turn	trans	-153.7	23.5	179.2	-123.6	-10.1	0	0	0	117.1	D90 K95	D90-D92 PolarHBondContact O-N 2.61Å; D92-K95 VanDerWaalsContact CG-NZ 3.31Å; D92-K95 VanDerWaalsContact OD1-CD 3.24Å; D92-K95 WeakPolarHBondContact OD1-CD 2.99Å; D92-K95 WeakPolarHBondContact OD1-CE 3.24Å; D92-K95 IonicContact OD1-NZ 3.17Å; D92-K95 PolarHBondContact OD1-NZ 2.86Å; D92-K95 IonicContact OD2-NZ 3.76Å; D92-K95 PolarHBondContact OD2-NZ 3.17Å
93	I	47.2	Very low	42	Very low	132 Å²	132	138.8 Å²	138.8	68%	0.677	79%	0.785	S	S	*	*	G	3₁₀ helix	trans	-75.6	-22.9	-175.7	-78.2	175.4	0	0	0	114.3	K95	I93-K95 PolarHBondContact O-N 3.26Å
94	D	47.7	Very low	41.8	Very low	166 Å²	166	135.3 Å²	135.3	89%	0.888	78%	0.784	S	S	*	*	G	3₁₀ helix	trans	-88.2	5.3	-167.2	-130.9	-2.3	0	0	0	115.8
95	K	45.2	Very low	41.6	Very low	161 Å²	161	138.6 Å²	138.6	70%	0.7	79%	0.785	S	S	*	*	G	3₁₀ helix	trans	-90.7	9.7	-175.6	-71.4	178	-176.1	155.5	0	115.2	D92 I93	D92-K95 VanDerWaalsContact CG-NZ 3.31Å; D92-K95 VanDerWaalsContact OD1-CD 3.24Å; D92-K95 WeakPolarHBondContact OD1-CD 2.99Å; D92-K95 WeakPolarHBondContact OD1-CE 3.24Å; D92-K95 IonicContact OD1-NZ 3.17Å; D92-K95 PolarHBondContact OD1-NZ 2.86Å; D92-K95 IonicContact OD2-NZ 3.76Å; D92-K95 PolarHBondContact OD2-NZ 3.17Å; I93-K95 PolarHBondContact O-N 3.26Å
96	R	47.6	Very low	41.9	Very low	175 Å²	175	141.8 Å²	141.8	66%	0.66	78%	0.783	S	S	*	*	S	Bend	trans	-122.9	127.8	-169.3	-73	179	-76.3	-168.8	-6.6	113.4
97	N	43.5	Very low	42.1	Very low	156 Å²	156	145.3 Å²	145.3	83%	0.834	79%	0.787	S	S	*	*			trans	96.7	22.5	158.4	-46.3	-33.8	0	0	0	119.5
98	F	45.9	Very low	42.3	Very low	212 Å²	212	141.4 Å²	141.4	93%	0.93	79%	0.787	S	S	*	*			trans	-91.8	103	154.6	-87.7	-83.7	0	0	0	112.3
99	R	40.8	Very low	42.3	Very low	246 Å²	246	146.2 Å²	146.2	93%	0.928	79%	0.789	S	S	*	*	S	Bend	trans	75	112.7	145.9	-156.7	-176.1	-153.5	-155.6	6.1	117.9
100	G	38.7	Very low	42.4	Very low	75 Å²	75	146.2 Å²	146.2	77%	0.773	78%	0.784	S	S	*	*			trans	122.7	107.7	150.3	0	0	0	0	0	114.2
101	S	40.5	Very low	42.1	Very low	123 Å²	123	142.8 Å²	142.8	86%	0.86	78%	0.782	S	S	*	*			trans	-44.4	157.8	164.2	-49	0	0	0	0	113.8
102	G	34.8	Very low	42.3	Very low	63 Å²	63	143.2 Å²	143.2	65%	0.649	79%	0.785	S	S	*	*	S	Bend	trans	-56.6	-176.9	172.3	0	0	0	0	0	115.2	G104	G102-G104 PolarHBondContact O-N 3.23Å
103	P	39.6	Very low	41.8	Very low	125 Å²	125	148 Å²	148	81%	0.812	80%	0.804	S	S	*	*			trans	-65.6	82.8	-136.3	25.9	-37.2	0	0	0	115.4	W105	P103-W105 PolarHBondContact O-N 2.82Å
104	G	39	Very low	41.6	Very low	73 Å²	73	146.6 Å²	146.6	75%	0.753	81%	0.806	S	S	*	*			trans	-78.3	95	170.4	0	0	0	0	0	111.8	G102	G102-G104 PolarHBondContact O-N 3.23Å
105	W	35.4	Very low	41.3	Very low	227 Å²	227	145.4 Å²	145.4	86%	0.86	80%	0.8	S	S	*	*			trans	-67.2	145.6	168.2	-74.6	29.4	0	0	0	110.9	P103	P103-W105 PolarHBondContact O-N 2.82Å
106	N	38.1	Very low	41.5	Very low	148 Å²	148	149.5 Å²	149.5	79%	0.791	81%	0.811	S	S	*	*			trans	77.7	151.6	170	-67.3	-64.8	0	0	0	119.7
107	Q	40.7	Very low	41.5	Very low	186 Å²	186	153.5 Å²	153.5	87%	0.869	83%	0.826	S	S	*	*			trans	83.8	55	164.9	-52.1	-170	0.9	0	0	119
108	G	39.9	Very low	41.5	Very low	88 Å²	88	148.5 Å²	148.5	91%	0.907	81%	0.812	S	S	*	*			trans	-106.2	60.7	154.5	0	0	0	0	0	112.1
109	R	43	Very low	41.6	Very low	206 Å²	206	146.9 Å²	146.9	78%	0.777	81%	0.807	S	S	*	*			trans	-85.6	124.7	-174.7	-105.4	-177.2	-175.3	-109.2	8.7	111.9
110	H	44.5	Very low	41.9	Very low	161 Å²	161	140.7 Å²	140.7	75%	0.745	80%	0.802	S	S	*	*			trans	73.6	137.7	162.6	-51	-70.7	0	0	0	119.6
111	G	39	Very low	42.4	Very low	72 Å²	72	142 Å²	142	74%	0.742	80%	0.798	S	S	*	*			trans	92.3	128.9	165.9	0	0	0	0	0	115.1
112	S	47.2	Very low	42.7	Very low	122 Å²	122	143 Å²	143	85%	0.853	79%	0.794	S	S	*	*			cis	-152.5	153	-3.8	-75.3	0	0	0	0	110.4
113	H	38.6	Very low	43.2	Very low	190 Å²	190	152.2 Å²	152.2	88%	0.88	81%	0.81	S	S	*	*			trans	-70.8	133.4	179.7	-56.1	-100.1	0	0	0	112.1
114	S	44.2	Very low	43.3	Very low	103 Å²	103	150 Å²	150	72%	0.72	81%	0.809	S	S	*	*			trans	-179	142.6	133	43.5	0	0	0	0	114.1
115	N	41.6	Very low	43.4	Very low	142 Å²	142	152.4 Å²	152.4	76%	0.759	81%	0.814	S	S	*	*			trans	51.1	95.6	145	-58.3	-5.1	0	0	0	120.3
116	R	48.2	Very low	44	Very low	247 Å²	247	146.3 Å²	146.3	93%	0.932	81%	0.806	S	S	*	*				-177.4	106.5	98	-95.1	167.7	-120.9	-163.2	-2	111.6
117	R	47.4	Very low	44.2	Very low	258 Å²	258	144.4 Å²	144.4	97%	0.974	80%	0.804	S	S	*	*			trans	-92.1	125.2	157.7	-68.8	177.7	-180	167.2	0.5	107
118	G	43.8	Very low	44.5	Very low	52 Å²	52	143.1 Å²	143.1	54%	0.536	80%	0.804	S	S	.	*			trans	170.1	129.8	172.2	0	0	0	0	0	115.3
119	H	49.5	Very low	44.7	Very low	177 Å²	177	148.8 Å²	148.8	82%	0.819	81%	0.807	S	S	*	*			trans	74.6	102.8	155.2	-35.5	-61.1	0	0	0	115.2
120	S	46.3	Very low	44.8	Very low	117 Å²	117	141.8 Å²	141.8	82%	0.818	80%	0.798	S	S	*	*				83.7	131.6	97.5	64.6	0	0	0	0	112.4
121	S	48.3	Very low	45.1	Very low	101 Å²	101	144.8 Å²	144.8	71%	0.706	80%	0.803	S	S	*	*			cis	-124.3	177.6	6.9	51.4	0	0	0	0	109
122	D	48.4	Very low	45.8	Very low	145 Å²	145	152.9 Å²	152.9	78%	0.775	81%	0.811	S	S	*	*			cis	-148.4	133.5	40	-61	-52.3	0	0	0	111.1
123	R	44.9	Very low	46	Very low	257 Å²	257	154.3 Å²	154.3	97%	0.97	81%	0.809	S	S	*	*			trans	-144.1	117.7	167.4	-78	-173.1	177.1	-177.4	-0.9	109
124	G	40.7	Very low	46.6	Very low	77 Å²	77	157.4 Å²	157.4	79%	0.794	81%	0.813	S	S	*	*			trans	135.2	72.1	167	0	0	0	0	0	116.4
125	S	42.7	Very low	47.2	Very low	124 Å²	124	160.2 Å²	160.2	87%	0.867	82%	0.815	S	S	*	*			trans	-159.2	134.4	155.3	-81.6	0	0	0	0	106.4
126	S	46.8	Very low	47.5	Very low	99 Å²	99	164 Å²	164	69%	0.692	82%	0.818	S	S	*	*			cis	179.7	122.6	-12.4	151.9	0	0	0	0	103.3
127	S	43.6	Very low	47.5	Very low	108 Å²	108	167.7 Å²	167.7	76%	0.755	83%	0.832	S	S	*	*			trans	56.6	88.7	149.2	-41.2	0	0	0	0	119.5
128	D	46.6	Very low	47.5	Very low	160 Å²	160	163.2 Å²	163.2	86%	0.856	83%	0.825	S	S	*	*				-170	71.4	128.6	-119.1	-34.8	0	0	0	114.2	G130	D128-G130 VanDerWaalsContact C-N 3.26Å; D128-G130 PolarHBondContact O-N 3.33Å
129	E	42.7	Very low	47.7	Very low	207 Å²	207	169 Å²	169	97%	0.967	84%	0.84	S	S	*	*			trans	-92.7	61	162.6	-80.6	-167.5	134.6	0	0	111.1	R131	E129-R131 PolarHBondContact O-N 3.06Å
130	G	45.8	Very low	47.6	Very low	58 Å²	58	168.6 Å²	168.6	60%	0.598	84%	0.842	S	S	*	*			trans	-76.4	78.9	179.8	0	0	0	0	0	114.6	D128	D128-G130 VanDerWaalsContact C-N 3.26Å; D128-G130 PolarHBondContact O-N 3.33Å
131	R	51.3	Low	47.6	Very low	225 Å²	225	171.6 Å²	171.6	85%	0.849	84%	0.843	S	S	*	*			trans	57.2	100.1	148.4	-56	179.1	-178.1	-169.7	0.7	118.6	E129 N133	E129-R131 PolarHBondContact O-N 3.06Å; R131-N133 PolarHBondContact O-N 3.47Å
132	R	54	Low	47.6	Very low	241 Å²	241	176 Å²	176	91%	0.909	85%	0.852	S	S	*	*				33.5	91.3	119.6	-53.4	174.7	-163.6	168.4	3.6	117.1
133	N	50.8	Low	47.6	Very low	153 Å²	153	178.1 Å²	178.1	82%	0.818	86%	0.857	S	S	*	*			trans	-169.3	107	136.1	-111.7	-11	0	0	0	112.5	R131	R131-N133 PolarHBondContact O-N 3.47Å
134	R	50.3	Low	47.7	Very low	254 Å²	254	172.4 Å²	172.4	96%	0.958	85%	0.848	S	S	*	*			trans	-158.7	89.5	153.2	-113.1	-176	-69.2	177	-0.1	107.8
135	H	58.4	Low	48.3	Very low	163 Å²	163	179.8 Å²	179.8	76%	0.755	85%	0.853	S	S	*	*			trans	-131.1	113.4	177.9	-140.2	57	0	0	0	107.4
136	W	47.1	Very low	48.8	Very low	220 Å²	220	184.4 Å²	184.4	83%	0.833	85%	0.851	S	S	*	*			trans	37.6	105.1	163.3	-54.3	91.6	0	0	0	119.8
137	R	47.9	Very low	48.9	Very low	325 Å²	325	192.2 Å²	192.2	100%	1.226	87%	0.866	S	S	*	*				-142.5	0	124.4	-86.4	-165	172.4	-112.6	-3	109

Retrieved 137 of 137 residues in 18.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).