G4VS32_SCHMA Loading...

U6 snRNA-associated Sm-like protein LSm5

Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA. Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB , UniProt , Accession G4VS32, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene LSM5, Length 87 aa.

						>G4VS32_SCHMA|G4VS32|LSM5
MSLTGPQLLPLELVDKCIGSKIHIIMKNDKEMVGTLLGFDSYVNMVLADVTEFEFTAQGKRITKLPHILLNGSNIVMMVPGGEGPEI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.6	Very low	74.9	Confident	243 Å²	243	123.5 Å²	123.5	100%	1.197	71%	0.706	S	S	*	*				0	107.3	0	-69.9	-178.4	-128.2	0	0	107.1	L3	M1-L3 PolarHBondContact O-N 2.87Å
2	S	56.7	Low	76.6	Confident	100 Å²	100	120.3 Å²	120.3	70%	0.699	68%	0.68	S	S	*	*			trans	-70.6	125.3	170.8	54.1	0	0	0	0	107.5	T4	S2-T4 VanDerWaalsContact C-N 3.34Å; S2-T4 PolarHBondContact O-N 3.45Å
3	L	64.9	Low	78	Confident	176 Å²	176	115.8 Å²	115.8	92%	0.921	65%	0.653	S	S	*	*			trans	-62.4	100.3	168.2	-68.9	165.9	0	0	0	106.8	M1 G5	M1-L3 PolarHBondContact O-N 2.87Å; L3-G5 PolarHBondContact O-N 3.06Å
4	T	65.3	Low	79.4	Confident	132 Å²	132	108.3 Å²	108.3	81%	0.81	61%	0.611	S	S	*	*			trans	-76.7	29.9	179.9	55	0	0	0	0	112.2	S2	S2-T4 VanDerWaalsContact C-N 3.34Å; S2-T4 PolarHBondContact O-N 3.45Å
5	G	70.1	Confident	80.6	Confident	46 Å²	46	107.3 Å²	107.3	47%	0.474	60%	0.603	S	S	.	*	S	Bend	trans	-77	153.2	172.3	0	0	0	0	0	110.1	L3 Q7	L3-G5 PolarHBondContact O-N 3.06Å; G5-Q7 PolarHBondContact O-N 3.29Å
6	P	74.9	Confident	81.6	Confident	136 Å²	136	109.4 Å²	109.4	88%	0.883	60%	0.604	S	S	*	*			trans	-54.9	115.9	169.3	21.6	-29.6	0	0	0	108.9	L8	P6-L8 PolarHBondContact O-N 3.36Å
7	Q	79.8	Confident	82.6	Confident	172 Å²	172	103.4 Å²	103.4	80%	0.804	57%	0.572	S	S	*	*			trans	-75.9	114.7	174.8	-173.9	170.2	31.3	0	0	107.4	G5	G5-Q7 PolarHBondContact O-N 3.29Å
8	L	88.2	Confident	83.5	Confident	78 Å²	78	101.8 Å²	101.8	41%	0.408	56%	0.561	S	S	.	*			trans	-101.2	119.4	174.4	-173.6	65.2	0	0	0	108.5	P6 E12 L13 K16	P6-L8 PolarHBondContact O-N 3.36Å; L8-E12 HydrophobicContact CD1-CB 3.79Å; L8-L13 HydrophobicContact CD2-CB 3.82Å; L8-L13 HydrophobicContact CD2-CD1 3.79Å; L8-L13 HydrophobicContact CD2-CG 4.28Å; L8-L13 HydrophobicContact CG-CB 4.18Å; L8-K16 HydrophobicContact CD1-CD 4.24Å
9	L	92.9	Very high	84.3	Confident	89 Å²	89	99.6 Å²	99.6	47%	0.466	56%	0.564	S	S	.	*			trans	-75.1	149.6	176.1	-60.1	175.1	0	0	0	110.1	L11 E12 L13	L9-L11 VanDerWaalsContact C-N 3.34Å; L9-L11 PolarHBondContact O-N 3.01Å; L9-E12 HydrophobicContact CB-CB 4.3Å; L9-E12 HydrophobicContact CB-CG 3.9Å; L9-E12 WeakPolarHBondContact CB-OE2 3.31Å; L9-E12 HydrophobicContact CD1-CG 4.48Å; L9-E12 PolarHBondContact N-OE2 3.22Å; L9-E12 WeakPolarHBondContact O-CB 3.31Å; L9-E12 PolarHBondContact O-N 2.84Å; L9-L13 PolarHBondContact O-N 2.84Å
10	P	92.5	Very high	85	Confident	102 Å²	102	97.6 Å²	97.6	66%	0.662	56%	0.556	S	S	*	*	H	α-helix	trans	-54.9	-45.3	-179.1	-28.7	35.8	0	0	0	113.7	E12 L13 V14	P10-E12 VanDerWaalsContact C-N 3.32Å; P10-E12 PolarHBondContact O-N 3.14Å; P10-L13 WeakPolarHBondContact O-CB 3.41Å; P10-L13 PolarHBondContact O-N 2.79Å; P10-V14 WeakPolarHBondContact O-CG2 3.47Å; P10-V14 PolarHBondContact O-N 2.89Å; P10-V14 VanDerWaalsContact O-N 3.11Å
11	L	95.2	Very high	85.6	Confident	84 Å²	84	99.4 Å²	99.4	44%	0.44	56%	0.558	S	S	.	*	H	α-helix	trans	-69	-30.4	178.8	-60.2	-176.3	0	0	0	112.5	L9 L13 V14 D15 F39 V43	L9-L11 VanDerWaalsContact C-N 3.34Å; L9-L11 PolarHBondContact O-N 3.01Å; L11-L13 VanDerWaalsContact C-N 3.31Å; L11-V14 PolarHBondContact O-N 2.98Å; L11-D15 VanDerWaalsContact O-CB 3.31Å; L11-D15 WeakPolarHBondContact O-CB 3.4Å; L11-D15 PolarHBondContact O-N 3.28Å; L11-F39 HydrophobicContact CB-CE2 4.48Å; L11-F39 HydrophobicContact CD2-CE2 4.03Å; L11-V43 HydrophobicContact CD2-CG2 4.03Å
12	E	94.9	Very high	88.2	Confident	85 Å²	85	87.8 Å²	87.8	40%	0.397	50%	0.501	S	S	.	.	H	α-helix	trans	-67.3	-34.2	173.3	-66.9	173.7	155.2	0	0	111.5	L8 L9 P10 K16	L8-E12 HydrophobicContact CD1-CB 3.79Å; L9-E12 HydrophobicContact CB-CB 4.3Å; L9-E12 HydrophobicContact CB-CG 3.9Å; L9-E12 WeakPolarHBondContact CB-OE2 3.31Å; L9-E12 HydrophobicContact CD1-CG 4.48Å; L9-E12 PolarHBondContact N-OE2 3.22Å; L9-E12 WeakPolarHBondContact O-CB 3.31Å; L9-E12 PolarHBondContact O-N 2.84Å; P10-E12 VanDerWaalsContact C-N 3.32Å; P10-E12 PolarHBondContact O-N 3.14Å; E12-K16 WeakPolarHBondContact O-CB 3.45Å; E12-K16 VanDerWaalsContact O-CG 3.26Å; E12-K16 WeakPolarHBondContact O-CG 3.5Å; E12-K16 PolarHBondContact O-N 3.12Å
13	L	95.1	Very high	90.2	Very high	62 Å²	62	83.8 Å²	83.8	33%	0.325	47%	0.471	S	S	.	.	H	α-helix	trans	-66.2	-45.7	173.3	177.8	61.5	0	0	0	111.1	L8 L9 P10 L11 D15 K16 C17 M78 P80	L8-L13 HydrophobicContact CD2-CB 3.82Å; L8-L13 HydrophobicContact CD2-CD1 3.79Å; L8-L13 HydrophobicContact CD2-CG 4.28Å; L8-L13 HydrophobicContact CG-CB 4.18Å; L9-L13 PolarHBondContact O-N 2.84Å; P10-L13 WeakPolarHBondContact O-CB 3.41Å; P10-L13 PolarHBondContact O-N 2.79Å; L11-L13 VanDerWaalsContact C-N 3.31Å; L13-D15 VanDerWaalsContact C-N 3.34Å; L13-D15 PolarHBondContact O-N 3.4Å; L13-K16 PolarHBondContact O-N 2.91Å; L13-C17 PolarHBondContact O-N 2.9Å; L13-C17 PolarHBondContact O-SG 3.47Å; L13-M78 HydrophobicContact CD2-CE 4.48Å; L13-M78 HydrophobicContact CG-CE 4.25Å; L13-P80 HydrophobicContact CD1-CG 4Å; L13-P80 HydrophobicContact CD2-CG 4.38Å; L13-P80 HydrophobicContact CG-CG 4.37Å
14	V	97.3	Very high	91.8	Very high	11 Å²	11	75.4 Å²	75.4	7%	0.067	43%	0.427	C	S	.	.	H	α-helix	trans	-62.7	-42.7	178.1	-177.9	0	0	0	0	110.8	P10 L11 K16 C17 L36 F39 M45 M78	P10-V14 WeakPolarHBondContact O-CG2 3.47Å; P10-V14 PolarHBondContact O-N 2.89Å; P10-V14 VanDerWaalsContact O-N 3.11Å; L11-V14 PolarHBondContact O-N 2.98Å; V14-K16 PolarHBondContact O-N 2.97Å; V14-C17 WeakPolarHBondContact O-CB 3.11Å; V14-C17 PolarHBondContact O-N 3.01Å; V14-L36 HydrophobicContact CG1-CD2 3.96Å; V14-L36 WeakPolarHBondContact O-CD2 3.26Å; V14-F39 HydrophobicContact CB-CD2 4.44Å; V14-F39 HydrophobicContact CB-CE1 4.31Å; V14-F39 HydrophobicContact CB-CE2 4.26Å; V14-F39 HydrophobicContact CB-CZ 4.18Å; V14-F39 HydrophobicContact CG1-CB 4.22Å; V14-F39 HydrophobicContact CG1-CD1 3.6Å; V14-F39 HydrophobicContact CG1-CD2 3.77Å; V14-F39 HydrophobicContact CG1-CE1 3.87Å; V14-F39 HydrophobicContact CG1-CE2 4.04Å; V14-F39 HydrophobicContact CG1-CG 3.56Å; V14-F39 HydrophobicContact CG1-CZ 4.08Å; V14-M45 HydrophobicContact CG1-CE 3.94Å; V14-M78 HydrophobicContact CB-CE 4.45Å; V14-M78 HydrophobicContact CG2-CE 3.8Å; V14-M78 HydrophobicContact CG2-SD 4.29Å
15	D	97.8	Very high	93.3	Very high	93 Å²	93	70.8 Å²	70.8	50%	0.497	40%	0.397	S	S	.	.	H	α-helix	trans	-59.8	-43.8	176.4	-170.8	74.6	0	0	0	112.4	L11 L13 C17 I18 F39	L11-D15 VanDerWaalsContact O-CB 3.31Å; L11-D15 WeakPolarHBondContact O-CB 3.4Å; L11-D15 PolarHBondContact O-N 3.28Å; L13-D15 VanDerWaalsContact C-N 3.34Å; L13-D15 PolarHBondContact O-N 3.4Å; D15-C17 PolarHBondContact O-N 3.35Å; D15-C17 VanDerWaalsContact O-N 3.12Å; D15-I18 WeakPolarHBondContact O-CB 3.38Å; D15-I18 WeakPolarHBondContact O-CG1 3.21Å; D15-I18 PolarHBondContact O-N 3.11Å; D15-F39 HydrophobicContact CB-CE1 4Å; D15-F39 HydrophobicContact CB-CZ 4.1Å
16	K	97.1	Very high	94.6	Very high	142 Å²	142	69.3 Å²	69.3	62%	0.617	38%	0.378	S	S	*	.	H	α-helix	trans	-62.4	-19	173.9	-76.4	174.8	-180	177.9	0	114.1	L8 E12 L13 V14	L8-K16 HydrophobicContact CD1-CD 4.24Å; E12-K16 WeakPolarHBondContact O-CB 3.45Å; E12-K16 VanDerWaalsContact O-CG 3.26Å; E12-K16 WeakPolarHBondContact O-CG 3.5Å; E12-K16 PolarHBondContact O-N 3.12Å; L13-K16 PolarHBondContact O-N 2.91Å; V14-K16 PolarHBondContact O-N 2.97Å
17	C	98	Very high	95.6	Very high	7 Å²	7	69.4 Å²	69.4	5%	0.047	37%	0.365	C	S	.	.	T	Hydrogen-bonded Turn	trans	-86.9	-4.9	176.9	-67.2	0	0	0	0	113.5	L13 V14 D15 G19 S20 I22 L36	L13-C17 PolarHBondContact O-N 2.9Å; L13-C17 PolarHBondContact O-SG 3.47Å; V14-C17 WeakPolarHBondContact O-CB 3.11Å; V14-C17 PolarHBondContact O-N 3.01Å; D15-C17 PolarHBondContact O-N 3.35Å; D15-C17 VanDerWaalsContact O-N 3.12Å; C17-G19 PolarHBondContact O-N 3.2Å; C17-S20 WeakPolarHBondContact O-CA 3.44Å; C17-S20 VanDerWaalsContact O-CB 3.3Å; C17-S20 WeakPolarHBondContact O-CB 3.43Å; C17-S20 PolarHBondContact O-N 3.03Å; C17-I22 HydrophobicContact CB-CG2 3.71Å; C17-L36 HydrophobicContact CB-CD2 3.94Å
18	I	98.5	Very high	96.1	Very high	74 Å²	74	65.2 Å²	65.2	38%	0.379	35%	0.348	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.4	133.4	176	-65.3	171.8	0	0	0	109.9	D15 S20 L36 F39	D15-I18 WeakPolarHBondContact O-CB 3.38Å; D15-I18 WeakPolarHBondContact O-CG1 3.21Å; D15-I18 PolarHBondContact O-N 3.11Å; I18-S20 PolarHBondContact O-N 3.05Å; I18-L36 HydrophobicContact CG1-CD2 4.22Å; I18-L36 HydrophobicContact CG1-CG 4.4Å; I18-F39 HydrophobicContact CD1-CD1 4.27Å; I18-F39 HydrophobicContact CD1-CE1 4.07Å; I18-F39 HydrophobicContact CG1-CD1 4.49Å
19	G	98.4	Very high	96.4	Very high	60 Å²	60	67 Å²	67	62%	0.619	36%	0.357	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.2	-2.2	-174.3	0	0	0	0	0	114.5	C17 L36	C17-G19 PolarHBondContact O-N 3.2Å; G19-L36 PolarHBondContact N-O 3.5Å
20	S	98.3	Very high	96.5	Very high	59 Å²	59	64.6 Å²	64.6	41%	0.413	34%	0.343	S	S	.	.	S	Bend	trans	-106.8	155.5	-179.5	-59	0	0	0	0	111.9	C17 I18 T35 L36	C17-S20 WeakPolarHBondContact O-CA 3.44Å; C17-S20 VanDerWaalsContact O-CB 3.3Å; C17-S20 WeakPolarHBondContact O-CB 3.43Å; C17-S20 PolarHBondContact O-N 3.03Å; I18-S20 PolarHBondContact O-N 3.05Å; S20-T35 WeakPolarHBondContact O-CA 3.42Å; S20-L36 PolarHBondContact O-N 3.27Å
21	K	98.3	Very high	96.8	Very high	136 Å²	136	61.5 Å²	61.5	59%	0.591	32%	0.32	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.4	136.6	168.3	-77.7	-171.4	176.8	-176.5	0	110.5	G34 G81	K21-G34 CarbonylContact C-O 3.58Å; K21-G34 WeakPolarHBondContact CA-O 3.5Å; K21-G81 VanDerWaalsContact O-CA 3.31Å; K21-G81 WeakPolarHBondContact O-CA 3.35Å; K21-G81 PolarHBondContact O-N 3.14Å
22	I	98.4	Very high	96.9	Very high	0 Å²	0	58.2 Å²	58.2	0%	0	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	148.8	173.3	59.9	171.3	0	0	0	109.9	C17 I24 V33 G34 L36 M45 L47 M78	C17-I22 HydrophobicContact CB-CG2 3.71Å; I22-I24 HydrophobicContact CD1-CD1 3.65Å; I22-I24 HydrophobicContact CD1-CG1 3.82Å; I22-I24 HydrophobicContact CG1-CD1 4.25Å; I22-I24 HydrophobicContact CG1-CG1 4.11Å; I22-V33 WeakPolarHBondContact O-CA 3.26Å; I22-G34 PolarHBondContact N-O 2.91Å; I22-G34 PolarHBondContact O-N 3.31Å; I22-G34 VanDerWaalsContact O-N 3.12Å; I22-L36 HydrophobicContact CD1-CB 3.85Å; I22-L36 HydrophobicContact CD1-CD1 4.32Å; I22-L36 HydrophobicContact CD1-CD2 4.3Å; I22-L36 HydrophobicContact CD1-CG 4.38Å; I22-L36 HydrophobicContact CG1-CB 4.25Å; I22-M45 HydrophobicContact CD1-SD 3.78Å; I22-L47 HydrophobicContact CD1-CD2 3.97Å; I22-L47 HydrophobicContact CG1-CD2 4.38Å; I22-M78 HydrophobicContact CB-CG 4.24Å; I22-M78 HydrophobicContact CD1-CG 4.16Å; I22-M78 HydrophobicContact CD1-SD 3.89Å; I22-M78 HydrophobicContact CG2-SD 4.3Å
23	H	98.5	Very high	97.1	Very high	16 Å²	16	54.8 Å²	54.8	7%	0.074	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	128.7	167.3	173	-152.1	0	0	0	108.8	E31 M32 V33 M78 V79	H23-E31 IonicContact CE1-OE2 3.19Å; H23-E31 PolarHBondContact CE1-OE2 3.11Å; H23-E31 WeakPolarHBondContact NE2-CB 3.32Å; H23-E31 IonicContact NE2-OE2 2.98Å; H23-E31 PolarHBondContact NE2-OE2 3.09Å; H23-M32 CarbonylContact C-O 3.59Å; H23-M32 WeakPolarHBondContact CA-O 3.45Å; H23-V33 HydrophobicContact CB-CG2 4.08Å; H23-M78 CarbonylContact O-C 3.56Å; H23-M78 WeakPolarHBondContact O-CA 3.47Å; H23-V79 HydrophobicContact CB-CB 4.21Å; H23-V79 PolarHBondContact N-O 2.67Å; H23-V79 PolarHBondContact O-N 3.39Å
24	I	98.2	Very high	97.2	Very high	0 Å²	0	51.9 Å²	51.9	0%	0	27%	0.273	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	130.2	-178.7	-52.7	177.3	0	0	0	109.1	I22 M26 E31 M32 M45 L47 L70 I75 M77	I22-I24 HydrophobicContact CD1-CD1 3.65Å; I22-I24 HydrophobicContact CD1-CG1 3.82Å; I22-I24 HydrophobicContact CG1-CD1 4.25Å; I22-I24 HydrophobicContact CG1-CG1 4.11Å; I24-M26 HydrophobicContact CG2-SD 3.76Å; I24-E31 CarbonylContact O-C 3.54Å; I24-E31 VanDerWaalsContact O-CA 3.26Å; I24-E31 WeakPolarHBondContact O-CA 3.4Å; I24-M32 PolarHBondContact N-O 3.26Å; I24-M32 PolarHBondContact O-N 3.34Å; I24-M45 HydrophobicContact CD1-SD 3.67Å; I24-L47 HydrophobicContact CD1-CD1 3.62Å; I24-L47 HydrophobicContact CD1-CD2 4.31Å; I24-L70 HydrophobicContact CB-CD2 4.48Å; I24-L70 HydrophobicContact CD1-CD2 3.42Å; I24-L70 VanDerWaalsContact CD1-CD2 3.42Å; I24-L70 HydrophobicContact CG2-CD2 3.97Å; I24-I75 HydrophobicContact CG2-CB 4.35Å; I24-I75 HydrophobicContact CG2-CD1 4.14Å; I24-I75 HydrophobicContact CG2-CG1 3.87Å; I24-I75 HydrophobicContact CG2-CG2 3.81Å; I24-M77 WeakPolarHBondContact CA-O 3.46Å
25	I	97.5	Very high	97.3	Very high	34 Å²	34	52.7 Å²	52.7	17%	0.174	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108	127.7	176.7	-61.7	143.7	0	0	0	108.1	E31 V76 M77 V79	I25-E31 HydrophobicContact CB-CG 4.35Å; I25-E31 HydrophobicContact CG1-CG 3.88Å; I25-E31 HydrophobicContact CG2-CG 4.32Å; I25-V76 WeakPolarHBondContact O-CB 3.4Å; I25-V76 PolarHBondContact O-N 2.91Å; I25-M77 HydrophobicContact CB-CB 4.43Å; I25-M77 HydrophobicContact CD1-CB 4.2Å; I25-M77 HydrophobicContact CD1-CE 3.21Å; I25-M77 HydrophobicContact CD1-CG 4.45Å; I25-M77 PolarHBondContact N-O 3.38Å; I25-M77 PolarHBondContact O-N 2.84Å; I25-V79 HydrophobicContact CD1-CG2 4.37Å
26	M	96.8	Very high	97.3	Very high	15 Å²	15	48.2 Å²	48.2	7%	0.074	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.2	162.3	-174.4	-53.2	-66.3	-70.9	0	0	111.1	I24 N28 K30 L70 N74 I75	I24-M26 HydrophobicContact CG2-SD 3.76Å; M26-N28 VanDerWaalsContact CB-OD1 3.26Å; M26-N28 WeakPolarHBondContact CB-OD1 3.38Å; M26-N28 PolarHBondContact O-N 3.05Å; M26-K30 WeakPolarHBondContact CA-O 3.39Å; M26-K30 HydrophobicContact CB-CB 4.1Å; M26-K30 WeakPolarHBondContact CB-O 3.12Å; M26-K30 HydrophobicContact CG-CB 4.24Å; M26-K30 WeakPolarHBondContact CG-O 3.38Å; M26-K30 PolarHBondContact N-O 3.01Å; M26-L70 HydrophobicContact CE-CD1 3.47Å; M26-L70 VanDerWaalsContact CE-CD1 3.47Å; M26-L70 HydrophobicContact CE-CD2 4.48Å; M26-L70 HydrophobicContact CE-CG 4.14Å; M26-L70 HydrophobicContact SD-CD1 3.91Å; M26-L70 HydrophobicContact SD-CD2 4.01Å; M26-L70 HydrophobicContact SD-CG 4.32Å; M26-N74 CarbonylContact C-O 3.52Å; M26-N74 VanDerWaalsContact CA-O 3.32Å; M26-N74 WeakPolarHBondContact CA-O 3.49Å; M26-N74 HydrophobicContact CE-CB 3.46Å; M26-N74 VanDerWaalsContact CE-CB 3.46Å; M26-I75 HydrophobicContact CE-CG1 4.4Å; M26-I75 HydrophobicContact SD-CG1 3.87Å
27	K	95.4	Very high	97.4	Very high	138 Å²	138	45.4 Å²	45.4	60%	0.6	25%	0.245	S	C	*	.	T	Hydrogen-bonded Turn	trans	-65.8	-16.4	179.3	-72.1	176.8	-178.8	163.6	0	115.1	S73 N74 V76	K27-S73 PolarHBondContact NZ-O 3.5Å; K27-N74 PolarHBondContact N-O 2.84Å; K27-V76 HydrophobicContact CB-CG2 4.17Å; K27-V76 HydrophobicContact CG-CG2 3.4Å; K27-V76 VanDerWaalsContact CG-CG2 3.4Å
28	N	91.1	Very high	97.4	Very high	84 Å²	84	46 Å²	46	45%	0.449	25%	0.252	S	S	.	.	T	Hydrogen-bonded Turn	trans	-116.4	42.9	-164.7	63.7	-33.8	0	0	0	113.1	M26 K30	M26-N28 VanDerWaalsContact CB-OD1 3.26Å; M26-N28 WeakPolarHBondContact CB-OD1 3.38Å; M26-N28 PolarHBondContact O-N 3.05Å; N28-K30 PolarHBondContact O-N 3.12Å; N28-K30 VanDerWaalsContact O-N 3.11Å
29	D	93.7	Very high	97.4	Very high	115 Å²	115	45.1 Å²	45.1	62%	0.615	25%	0.246	S	C	*	.	S	Bend	trans	55.3	31.9	-179.4	-54.9	-46.7	0	0	0	112.7	F55	D29-F55 HydrophobicContact CB-CB 4.27Å; D29-F55 WeakPolarHBondContact O-CD2 3.03Å; D29-F55 PolarHBondContact O-N 2.81Å
30	K	96.6	Very high	97.4	Very high	39 Å²	39	45.1 Å²	45.1	17%	0.17	23%	0.232	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	141.1	175.7	-68.5	-169.6	173.6	-154.8	0	110.9	M26 N28 E52 F53 E54	M26-K30 WeakPolarHBondContact CA-O 3.39Å; M26-K30 HydrophobicContact CB-CB 4.1Å; M26-K30 WeakPolarHBondContact CB-O 3.12Å; M26-K30 HydrophobicContact CG-CB 4.24Å; M26-K30 WeakPolarHBondContact CG-O 3.38Å; M26-K30 PolarHBondContact N-O 3.01Å; N28-K30 PolarHBondContact O-N 3.12Å; N28-K30 VanDerWaalsContact O-N 3.11Å; K30-E52 WeakPolarHBondContact CD-OE2 3.48Å; K30-E52 IonicContact NZ-OE1 3.83Å; K30-E52 IonicContact NZ-OE2 2.85Å; K30-E52 PolarHBondContact NZ-OE2 3.36Å; K30-F53 CarbonylContact C-O 3.52Å; K30-F53 VanDerWaalsContact CA-O 3.28Å; K30-F53 WeakPolarHBondContact CA-O 3.46Å; K30-E54 WeakPolarHBondContact CE-OE1 3.47Å; K30-E54 HydrophobicContact CG-CB 4.26Å; K30-E54 HydrophobicContact CG-CG 4.21Å; K30-E54 IonicContact NZ-OE1 3.48Å; K30-E54 PolarHBondContact NZ-OE1 2.98Å
31	E	97.6	Very high	97.2	Very high	38 Å²	38	46.7 Å²	46.7	18%	0.178	24%	0.243	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	147.6	172.4	-70.8	179.9	-159.1	0	0	109	H23 I24 I25 E52 F53 F55 P85	H23-E31 IonicContact CE1-OE2 3.19Å; H23-E31 PolarHBondContact CE1-OE2 3.11Å; H23-E31 WeakPolarHBondContact NE2-CB 3.32Å; H23-E31 IonicContact NE2-OE2 2.98Å; H23-E31 PolarHBondContact NE2-OE2 3.09Å; I24-E31 CarbonylContact O-C 3.54Å; I24-E31 VanDerWaalsContact O-CA 3.26Å; I24-E31 WeakPolarHBondContact O-CA 3.4Å; I25-E31 HydrophobicContact CB-CG 4.35Å; I25-E31 HydrophobicContact CG1-CG 3.88Å; I25-E31 HydrophobicContact CG2-CG 4.32Å; E31-E52 CarbonylContact O-C 3.49Å; E31-E52 WeakPolarHBondContact O-CA 3.42Å; E31-F53 HydrophobicContact CB-CB 4.25Å; E31-F53 HydrophobicContact CB-CD2 4.37Å; E31-F53 PolarHBondContact N-O 3.46Å; E31-F53 PolarHBondContact O-N 2.82Å; E31-F55 HydrophobicContact CB-CE2 4.4Å; E31-F55 HydrophobicContact CG-CE2 4.06Å; E31-P85 WeakPolarHBondContact OE2-CD 3.46Å; E31-P85 VanDerWaalsContact OE2-CG 3.29Å; E31-P85 WeakPolarHBondContact OE2-CG 3.3Å
32	M	97.2	Very high	97	Very high	14 Å²	14	48.4 Å²	48.4	7%	0.069	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-135.3	131.6	-179.3	-64.4	-179	-177.1	0	0	110	H23 I24 V50 T51 E52 I68 L70	H23-M32 CarbonylContact C-O 3.59Å; H23-M32 WeakPolarHBondContact CA-O 3.45Å; I24-M32 PolarHBondContact N-O 3.26Å; I24-M32 PolarHBondContact O-N 3.34Å; M32-V50 HydrophobicContact CB-CG1 4.17Å; M32-V50 HydrophobicContact CG-CG1 4.43Å; M32-T51 WeakPolarHBondContact CA-O 3.49Å; M32-E52 HydrophobicContact CE-CG 4.11Å; M32-E52 HydrophobicContact CG-CB 4.42Å; M32-E52 HydrophobicContact CG-CG 4.32Å; M32-I68 HydrophobicContact CE-CD1 4.37Å; M32-I68 HydrophobicContact SD-CD1 3.52Å; M32-I68 VanDerWaalsContact SD-CD1 3.52Å; M32-L70 HydrophobicContact CE-CD1 3.96Å; M32-L70 HydrophobicContact SD-CD1 3.59Å; M32-L70 VanDerWaalsContact SD-CD1 3.59Å; M32-L70 HydrophobicContact SD-CD2 4.37Å
33	V	98.3	Very high	97	Very high	13 Å²	13	50.3 Å²	50.3	8%	0.079	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	124.3	170	180	0	0	0	0	108.3	I22 H23 V50 T51 F53 G84	I22-V33 WeakPolarHBondContact O-CA 3.26Å; H23-V33 HydrophobicContact CB-CG2 4.08Å; V33-V50 CarbonylContact O-C 3.54Å; V33-V50 VanDerWaalsContact O-CA 3.32Å; V33-V50 WeakPolarHBondContact O-CA 3.46Å; V33-T51 PolarHBondContact N-O 3.33Å; V33-T51 PolarHBondContact O-N 2.75Å; V33-F53 HydrophobicContact CB-CE2 4.36Å; V33-F53 HydrophobicContact CG2-CE2 3.86Å; V33-G84 VanDerWaalsContact CG2-CA 3.43Å
34	G	98.4	Very high	96.9	Very high	2 Å²	2	51.3 Å²	51.3	2%	0.021	26%	0.264	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-165.3	173.1	-179.1	0	0	0	0	0	112.1	K21 I22 A48	K21-G34 CarbonylContact C-O 3.58Å; K21-G34 WeakPolarHBondContact CA-O 3.5Å; I22-G34 PolarHBondContact N-O 2.91Å; I22-G34 PolarHBondContact O-N 3.31Å; I22-G34 VanDerWaalsContact O-N 3.12Å; G34-A48 WeakPolarHBondContact CA-O 3.47Å
35	T	98.6	Very high	96.9	Very high	27 Å²	27	51.4 Å²	51.4	17%	0.166	26%	0.264	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.1	122.4	176.3	-56.2	0	0	0	0	109.5	S20 L37 L47 A48	S20-T35 WeakPolarHBondContact O-CA 3.42Å; T35-L37 HydrophobicContact CG2-CD2 4.35Å; T35-L37 PolarHBondContact O-N 2.95Å; T35-L47 VanDerWaalsContact O-CA 3.31Å; T35-L47 WeakPolarHBondContact O-CA 3.37Å; T35-A48 PolarHBondContact N-O 3Å; T35-A48 PolarHBondContact O-N 3.07Å
36	L	98.8	Very high	97	Very high	0 Å²	0	52.7 Å²	52.7	0%	0	27%	0.274	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.6	120.8	176.2	178.6	62.4	0	0	0	110.4	V14 C17 I18 G19 S20 I22 G38 M45 L47	V14-L36 HydrophobicContact CG1-CD2 3.96Å; V14-L36 WeakPolarHBondContact O-CD2 3.26Å; C17-L36 HydrophobicContact CB-CD2 3.94Å; I18-L36 HydrophobicContact CG1-CD2 4.22Å; I18-L36 HydrophobicContact CG1-CG 4.4Å; G19-L36 PolarHBondContact N-O 3.5Å; S20-L36 PolarHBondContact O-N 3.27Å; I22-L36 HydrophobicContact CD1-CB 3.85Å; I22-L36 HydrophobicContact CD1-CD1 4.32Å; I22-L36 HydrophobicContact CD1-CD2 4.3Å; I22-L36 HydrophobicContact CD1-CG 4.38Å; I22-L36 HydrophobicContact CG1-CB 4.25Å; L36-G38 WeakPolarHBondContact CD1-O 3.32Å; L36-M45 HydrophobicContact CD1-CB 3.83Å; L36-M45 HydrophobicContact CD1-CG 3.96Å; L36-M45 HydrophobicContact CD1-SD 3.88Å; L36-L47 HydrophobicContact CB-CD2 4.16Å; L36-L47 HydrophobicContact CD1-CD2 3.75Å
37	L	98.6	Very high	97.1	Very high	82 Å²	82	52 Å²	52	43%	0.429	27%	0.27	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.3	-27.8	176.3	-56.8	-169.6	0	0	0	112.7	T35 V46 A48	T35-L37 HydrophobicContact CG2-CD2 4.35Å; T35-L37 PolarHBondContact O-N 2.95Å; L37-V46 HydrophobicContact CB-CB 4.27Å; L37-V46 HydrophobicContact CB-CG1 4.17Å; L37-V46 WeakPolarHBondContact CB-O 3.36Å; L37-V46 HydrophobicContact CD1-CG1 4.04Å; L37-V46 HydrophobicContact CG-CG1 4.46Å; L37-V46 PolarHBondContact N-O 2.97Å; L37-A48 HydrophobicContact CD1-CB 3.95Å; L37-A48 HydrophobicContact CD2-CB 4Å; L37-A48 HydrophobicContact CG-CB 4.06Å
38	G	98.4	Very high	97.2	Very high	19 Å²	19	45.8 Å²	45.8	20%	0.196	25%	0.245	C	C	.	.	E	Extended strand (participates in β ladder)	trans	171.6	168.2	-179.2	0	0	0	0	0	111.6	L36 M45 V46	L36-G38 WeakPolarHBondContact CD1-O 3.32Å; G38-M45 WeakPolarHBondContact O-CA 3.26Å; G38-V46 PolarHBondContact O-N 3Å
39	F	98.4	Very high	97.6	Very high	56 Å²	56	47.6 Å²	47.6	25%	0.246	26%	0.255	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.4	166	-179.3	71.3	-72.6	0	0	0	111.2	L11 V14 D15 I18 N44 M45	L11-F39 HydrophobicContact CB-CE2 4.48Å; L11-F39 HydrophobicContact CD2-CE2 4.03Å; V14-F39 HydrophobicContact CB-CD2 4.44Å; V14-F39 HydrophobicContact CB-CE1 4.31Å; V14-F39 HydrophobicContact CB-CE2 4.26Å; V14-F39 HydrophobicContact CB-CZ 4.18Å; V14-F39 HydrophobicContact CG1-CB 4.22Å; V14-F39 HydrophobicContact CG1-CD1 3.6Å; V14-F39 HydrophobicContact CG1-CD2 3.77Å; V14-F39 HydrophobicContact CG1-CE1 3.87Å; V14-F39 HydrophobicContact CG1-CE2 4.04Å; V14-F39 HydrophobicContact CG1-CG 3.56Å; V14-F39 HydrophobicContact CG1-CZ 4.08Å; D15-F39 HydrophobicContact CB-CE1 4Å; D15-F39 HydrophobicContact CB-CZ 4.1Å; I18-F39 HydrophobicContact CD1-CD1 4.27Å; I18-F39 HydrophobicContact CD1-CE1 4.07Å; I18-F39 HydrophobicContact CG1-CD1 4.49Å; F39-N44 CarbonylContact C-O 3.6Å; F39-N44 WeakPolarHBondContact CA-O 3.21Å; F39-N44 WeakPolarHBondContact CB-O 3.26Å; F39-M45 HydrophobicContact CB-CG 4.15Å
40	D	97.4	Very high	97.8	Very high	61 Å²	61	42.2 Å²	42.2	33%	0.326	23%	0.226	S	C	.	.			trans	-110.5	-177.5	173.5	73	8.4	0	0	0	112.6	Y42 V43 N44	D40-Y42 PolarHBondContact O-N 2.84Å; D40-Y42 VanDerWaalsContact O-N 3.14Å; D40-Y42 VanDerWaalsContact OD1-C 3.3Å; D40-Y42 VanDerWaalsContact OD1-CA 3.31Å; D40-Y42 WeakPolarHBondContact OD1-CA 3.49Å; D40-Y42 WeakPolarHBondContact OD1-CB 3.45Å; D40-Y42 PolarHBondContact OD1-N 2.9Å; D40-V43 PolarHBondContact O-N 2.94Å; D40-V43 PolarHBondContact OD1-N 3.38Å; D40-N44 PolarHBondContact N-O 2.78Å; D40-N44 VanDerWaalsContact N-O 3.12Å; D40-N44 WeakPolarHBondContact OD1-CB 3.33Å; D40-N44 PolarHBondContact OD1-N 3.35Å; D40-N44 PolarHBondContact OD1-ND2 3.29Å; D40-N44 PolarHBondContact OD2-ND2 2.82Å
41	S	94.8	Very high	97.8	Very high	92 Å²	92	41 Å²	41	64%	0.643	22%	0.222	S	C	*	.	T	Hydrogen-bonded Turn	trans	-64.1	-16.4	178.8	58.7	0	0	0	0	114.7
42	Y	95.1	Very high	97.8	Very high	172 Å²	172	40.3 Å²	40.3	68%	0.675	22%	0.219	S	C	*	.	T	Hydrogen-bonded Turn	trans	-97.5	6	176	-60.5	-76.9	0	0	0	112.1	D40 N44	D40-Y42 PolarHBondContact O-N 2.84Å; D40-Y42 VanDerWaalsContact O-N 3.14Å; D40-Y42 VanDerWaalsContact OD1-C 3.3Å; D40-Y42 VanDerWaalsContact OD1-CA 3.31Å; D40-Y42 WeakPolarHBondContact OD1-CA 3.49Å; D40-Y42 WeakPolarHBondContact OD1-CB 3.45Å; D40-Y42 PolarHBondContact OD1-N 2.9Å; Y42-N44 PolarHBondContact O-N 3.39Å
43	V	96.5	Very high	97.8	Very high	39 Å²	39	40 Å²	40	24%	0.236	22%	0.216	C	C	.	.			trans	60.9	28.5	-178.2	-160.3	0	0	0	0	111.4	L11 D40 M45 G72 I75	L11-V43 HydrophobicContact CD2-CG2 4.03Å; D40-V43 PolarHBondContact O-N 2.94Å; D40-V43 PolarHBondContact OD1-N 3.38Å; V43-M45 HydrophobicContact CG1-CE 3.32Å; V43-M45 HydrophobicContact CG1-CG 4.47Å; V43-G72 WeakPolarHBondContact O-CA 3.29Å; V43-I75 HydrophobicContact CG1-CD1 4.41Å
44	N	97.8	Very high	97.8	Very high	38 Å²	38	41.6 Å²	41.6	20%	0.203	22%	0.223	C	C	.	.			trans	-68.4	132	160.4	-58.5	-52.4	0	0	0	107.5	F39 D40 Y42 L70 N71 G72	F39-N44 CarbonylContact C-O 3.6Å; F39-N44 WeakPolarHBondContact CA-O 3.21Å; F39-N44 WeakPolarHBondContact CB-O 3.26Å; D40-N44 PolarHBondContact N-O 2.78Å; D40-N44 VanDerWaalsContact N-O 3.12Å; D40-N44 WeakPolarHBondContact OD1-CB 3.33Å; D40-N44 PolarHBondContact OD1-N 3.35Å; D40-N44 PolarHBondContact OD1-ND2 3.29Å; D40-N44 PolarHBondContact OD2-ND2 2.82Å; Y42-N44 PolarHBondContact O-N 3.39Å; N44-L70 CarbonylContact C-O 3.57Å; N44-L70 WeakPolarHBondContact CA-O 3.31Å; N44-N71 WeakPolarHBondContact OD1-CA 3.31Å; N44-G72 PolarHBondContact OD1-N 2.88Å
45	M	98.4	Very high	97.6	Very high	1 Å²	1	45.1 Å²	45.1	1%	0.005	24%	0.238	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	137.9	-171.1	-60.7	-172.3	180	0	0	111.4	V14 I22 I24 L36 G38 F39 V43 L47 L70 I75 M78	V14-M45 HydrophobicContact CG1-CE 3.94Å; I22-M45 HydrophobicContact CD1-SD 3.78Å; I24-M45 HydrophobicContact CD1-SD 3.67Å; L36-M45 HydrophobicContact CD1-CB 3.83Å; L36-M45 HydrophobicContact CD1-CG 3.96Å; L36-M45 HydrophobicContact CD1-SD 3.88Å; G38-M45 WeakPolarHBondContact O-CA 3.26Å; F39-M45 HydrophobicContact CB-CG 4.15Å; V43-M45 HydrophobicContact CG1-CE 3.32Å; V43-M45 HydrophobicContact CG1-CG 4.47Å; M45-L47 HydrophobicContact CB-CD2 4.05Å; M45-L47 HydrophobicContact CB-CG 4.38Å; M45-L47 HydrophobicContact SD-CD2 4.48Å; M45-L70 HydrophobicContact CB-CB 4.31Å; M45-L70 PolarHBondContact N-O 2.85Å; M45-L70 PolarHBondContact O-N 2.77Å; M45-I75 HydrophobicContact CE-CD1 4Å; M45-I75 HydrophobicContact CG-CD1 4.38Å; M45-I75 HydrophobicContact SD-CD1 4.15Å; M45-M78 HydrophobicContact CE-SD 3.83Å
46	V	98.6	Very high	97.3	Very high	62 Å²	62	46.4 Å²	46.4	38%	0.376	25%	0.246	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-93.5	121.8	164.9	-175.7	0	0	0	0	107.6	L37 G38 I68 L69	L37-V46 HydrophobicContact CB-CB 4.27Å; L37-V46 HydrophobicContact CB-CG1 4.17Å; L37-V46 WeakPolarHBondContact CB-O 3.36Å; L37-V46 HydrophobicContact CD1-CG1 4.04Å; L37-V46 HydrophobicContact CG-CG1 4.46Å; L37-V46 PolarHBondContact N-O 2.97Å; G38-V46 PolarHBondContact O-N 3Å; V46-I68 WeakPolarHBondContact CA-O 3.41Å; V46-L69 HydrophobicContact CG2-CD1 4.08Å
47	L	98.6	Very high	97	Very high	0 Å²	0	51.3 Å²	51.3	0%	0	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	146.5	178.7	-51.5	179.1	0	0	0	111.1	I22 I24 T35 L36 M45 V50 H67 I68 L70	I22-L47 HydrophobicContact CD1-CD2 3.97Å; I22-L47 HydrophobicContact CG1-CD2 4.38Å; I24-L47 HydrophobicContact CD1-CD1 3.62Å; I24-L47 HydrophobicContact CD1-CD2 4.31Å; T35-L47 VanDerWaalsContact O-CA 3.31Å; T35-L47 WeakPolarHBondContact O-CA 3.37Å; L36-L47 HydrophobicContact CB-CD2 4.16Å; L36-L47 HydrophobicContact CD1-CD2 3.75Å; M45-L47 HydrophobicContact CB-CD2 4.05Å; M45-L47 HydrophobicContact CB-CG 4.38Å; M45-L47 HydrophobicContact SD-CD2 4.48Å; L47-V50 HydrophobicContact CB-CG2 3.48Å; L47-V50 VanDerWaalsContact CB-CG2 3.48Å; L47-V50 HydrophobicContact CD1-CG2 4.34Å; L47-H67 WeakPolarHBondContact O-CA 3.2Å; L47-I68 HydrophobicContact CB-CG1 4.01Å; L47-I68 HydrophobicContact CD1-CD1 4.15Å; L47-I68 HydrophobicContact CD1-CG1 4.43Å; L47-I68 HydrophobicContact CG-CG1 4.41Å; L47-I68 PolarHBondContact N-O 2.94Å; L47-I68 PolarHBondContact O-N 2.85Å; L47-L70 HydrophobicContact CD1-CD2 4.28Å
48	A	98.6	Very high	96.8	Very high	7 Å²	7	55.6 Å²	55.6	6%	0.058	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	161.7	169.7	0	0	0	0	0	112.2	G34 T35 L37 V50 P66	G34-A48 WeakPolarHBondContact CA-O 3.47Å; T35-A48 PolarHBondContact N-O 3Å; T35-A48 PolarHBondContact O-N 3.07Å; L37-A48 HydrophobicContact CD1-CB 3.95Å; L37-A48 HydrophobicContact CD2-CB 4Å; L37-A48 HydrophobicContact CG-CB 4.06Å; A48-V50 VanDerWaalsContact C-N 3.26Å; A48-V50 PolarHBondContact O-N 2.95Å; A48-P66 CarbonylContact C-O 3.55Å; A48-P66 VanDerWaalsContact CA-O 3.29Å; A48-P66 WeakPolarHBondContact CA-O 3.28Å
49	D	98.3	Very high	96.5	Very high	123 Å²	123	56.4 Å²	56.4	66%	0.658	31%	0.313	S	S	*	.	E	Extended strand (participates in β ladder)	trans	51.2	45.1	175.3	-60.6	-42.5	0	0	0	112.9	P66	D49-P66 PolarHBondContact N-O 3.26Å
50	V	98.3	Very high	96.2	Very high	1 Å²	1	57 Å²	57	1%	0.006	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81	138.3	-168.8	-176.5	0	0	0	0	111.3	M32 V33 L47 A48 K64 L65 I68	M32-V50 HydrophobicContact CB-CG1 4.17Å; M32-V50 HydrophobicContact CG-CG1 4.43Å; V33-V50 CarbonylContact O-C 3.54Å; V33-V50 VanDerWaalsContact O-CA 3.32Å; V33-V50 WeakPolarHBondContact O-CA 3.46Å; L47-V50 HydrophobicContact CB-CG2 3.48Å; L47-V50 VanDerWaalsContact CB-CG2 3.48Å; L47-V50 HydrophobicContact CD1-CG2 4.34Å; A48-V50 VanDerWaalsContact C-N 3.26Å; A48-V50 PolarHBondContact O-N 2.95Å; V50-K64 WeakPolarHBondContact O-CA 3.32Å; V50-L65 HydrophobicContact CB-CB 4.31Å; V50-L65 PolarHBondContact N-O 2.88Å; V50-L65 PolarHBondContact O-N 2.91Å; V50-I68 HydrophobicContact CG1-CD1 4.15Å; V50-I68 HydrophobicContact CG2-CD1 4.19Å; V50-I68 HydrophobicContact CG2-CG1 4.07Å
51	T	98	Very high	96.1	Very high	14 Å²	14	61.4 Å²	61.4	9%	0.086	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.2	112.8	162.5	-46.6	0	0	0	0	108	M32 V33 F53 I62 T63 K64	M32-T51 WeakPolarHBondContact CA-O 3.49Å; V33-T51 PolarHBondContact N-O 3.33Å; V33-T51 PolarHBondContact O-N 2.75Å; T51-F53 HydrophobicContact CG2-CD1 4.43Å; T51-F53 HydrophobicContact CG2-CD2 4.48Å; T51-F53 HydrophobicContact CG2-CE1 3.82Å; T51-F53 HydrophobicContact CG2-CE2 3.82Å; T51-F53 HydrophobicContact CG2-CZ 3.48Å; T51-F53 VanDerWaalsContact CG2-CZ 3.48Å; T51-I62 HydrophobicContact CG2-CG2 3.57Å; T51-T63 WeakPolarHBondContact CA-O 3.4Å; T51-K64 HydrophobicContact CG2-CD 4.07Å; T51-K64 PolarHBondContact OG1-NZ 3.14Å
52	E	97.5	Very high	96.2	Very high	24 Å²	24	60.5 Å²	60.5	11%	0.112	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.9	131.8	170.6	-176.4	-171.2	56.4	0	0	108.7	K30 E31 M32 I62 T63	K30-E52 WeakPolarHBondContact CD-OE2 3.48Å; K30-E52 IonicContact NZ-OE1 3.83Å; K30-E52 IonicContact NZ-OE2 2.85Å; K30-E52 PolarHBondContact NZ-OE2 3.36Å; E31-E52 CarbonylContact O-C 3.49Å; E31-E52 WeakPolarHBondContact O-CA 3.42Å; M32-E52 HydrophobicContact CE-CG 4.11Å; M32-E52 HydrophobicContact CG-CB 4.42Å; M32-E52 HydrophobicContact CG-CG 4.32Å; E52-I62 WeakPolarHBondContact O-CA 3.34Å; E52-T63 PolarHBondContact N-O 2.78Å; E52-T63 PolarHBondContact O-N 3.19Å
53	F	97.1	Very high	96.3	Very high	6 Å²	6	53.9 Å²	53.9	3%	0.026	29%	0.292	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	121.8	170.4	-54.6	-81.5	0	0	0	107.7	K30 E31 V33 T51 F55 R61 I62 P85 I87	K30-F53 CarbonylContact C-O 3.52Å; K30-F53 VanDerWaalsContact CA-O 3.28Å; K30-F53 WeakPolarHBondContact CA-O 3.46Å; E31-F53 HydrophobicContact CB-CB 4.25Å; E31-F53 HydrophobicContact CB-CD2 4.37Å; E31-F53 PolarHBondContact N-O 3.46Å; E31-F53 PolarHBondContact O-N 2.82Å; V33-F53 HydrophobicContact CB-CE2 4.36Å; V33-F53 HydrophobicContact CG2-CE2 3.86Å; T51-F53 HydrophobicContact CG2-CD1 4.43Å; T51-F53 HydrophobicContact CG2-CD2 4.48Å; T51-F53 HydrophobicContact CG2-CE1 3.82Å; T51-F53 HydrophobicContact CG2-CE2 3.82Å; T51-F53 HydrophobicContact CG2-CZ 3.48Å; T51-F53 VanDerWaalsContact CG2-CZ 3.48Å; F53-F55 HydrophobicContact CB-CE2 4.39Å; F53-R61 WeakPolarHBondContact CA-O 3.39Å; F53-I62 HydrophobicContact CD1-CD1 4.11Å; F53-I62 HydrophobicContact CD1-CG1 3.91Å; F53-I62 HydrophobicContact CD1-CG2 4.24Å; F53-I62 HydrophobicContact CE1-CD1 3.99Å; F53-I62 HydrophobicContact CE1-CG1 4.23Å; F53-I62 HydrophobicContact CE1-CG2 4.13Å; F53-P85 HydrophobicContact CB-CG 4.1Å; F53-P85 HydrophobicContact CD1-CG 4.11Å; F53-P85 HydrophobicContact CD2-CG 3.83Å; F53-P85 HydrophobicContact CE1-CG 4.44Å; F53-P85 HydrophobicContact CE2-CG 4.22Å; F53-P85 HydrophobicContact CG-CG 3.74Å; F53-P85 HydrophobicContact CZ-CG 4.48Å; F53-I87 HydrophobicContact CE1-CG1 4.31Å
54	E	96.8	Very high	96.4	Very high	47 Å²	47	59 Å²	59	22%	0.22	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	121.2	176.3	178.6	176.3	-132.3	0	0	108.3	K30 T56 K60 R61	K30-E54 WeakPolarHBondContact CE-OE1 3.47Å; K30-E54 HydrophobicContact CG-CB 4.26Å; K30-E54 HydrophobicContact CG-CG 4.21Å; K30-E54 IonicContact NZ-OE1 3.48Å; K30-E54 PolarHBondContact NZ-OE1 2.98Å; E54-T56 HydrophobicContact CG-CG2 3.88Å; E54-K60 WeakPolarHBondContact O-CA 3.47Å; E54-R61 HydrophobicContact CB-CB 4.32Å; E54-R61 PolarHBondContact N-O 2.86Å; E54-R61 PolarHBondContact O-N 2.95Å; E54-R61 IonicContact OE2-NH1 3.97Å
55	F	94.6	Very high	96.4	Very high	77 Å²	77	59.9 Å²	59.9	34%	0.338	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.1	112.8	178.7	-59.2	-85.1	0	0	0	108.9	D29 E31 F53 K60 P85	D29-F55 HydrophobicContact CB-CB 4.27Å; D29-F55 WeakPolarHBondContact O-CD2 3.03Å; D29-F55 PolarHBondContact O-N 2.81Å; E31-F55 HydrophobicContact CB-CE2 4.4Å; E31-F55 HydrophobicContact CG-CE2 4.06Å; F53-F55 HydrophobicContact CB-CE2 4.39Å; F55-K60 HydrophobicContact CD1-CG 4.37Å; F55-K60 HydrophobicContact CE1-CD 4Å; F55-K60 HydrophobicContact CE1-CG 4.22Å; F55-P85 HydrophobicContact CE2-CG 4.46Å; F55-P85 HydrophobicContact CZ-CB 3.88Å; F55-P85 HydrophobicContact CZ-CG 3.79Å
56	T	92.7	Very high	96.4	Very high	54 Å²	54	64.2 Å²	64.2	33%	0.331	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.7	165.5	-179.8	72.8	0	0	0	0	110.2	E54 Q58 G59	E54-T56 HydrophobicContact CG-CG2 3.88Å; T56-Q58 PolarHBondContact O-N 2.77Å; T56-Q58 VanDerWaalsContact O-N 3.14Å; T56-Q58 PolarHBondContact OG1-N 2.87Å; T56-Q58 PolarHBondContact OG1-OE1 3.22Å; T56-G59 PolarHBondContact N-O 3.11Å; T56-G59 PolarHBondContact O-N 3.12Å; T56-G59 PolarHBondContact OG1-N 2.85Å; T56-G59 PolarHBondContact OG1-O 2.78Å
57	A	93.1	Very high	96.4	Very high	103 Å²	103	67.2 Å²	67.2	85%	0.851	35%	0.354	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.2	-22	172.5	0	0	0	0	0	113
58	Q	92.8	Very high	96.3	Very high	172 Å²	172	68.8 Å²	68.8	80%	0.804	36%	0.361	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.2	-4.6	177.8	-63.2	74.9	25.9	0	0	112.8	T56	T56-Q58 PolarHBondContact O-N 2.77Å; T56-Q58 VanDerWaalsContact O-N 3.14Å; T56-Q58 PolarHBondContact OG1-N 2.87Å; T56-Q58 PolarHBondContact OG1-OE1 3.22Å
59	G	92	Very high	96.3	Very high	36 Å²	36	74.9 Å²	74.9	37%	0.371	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	123.3	-165	-178.3	0	0	0	0	0	113.2	T56	T56-G59 PolarHBondContact N-O 3.11Å; T56-G59 PolarHBondContact O-N 3.12Å; T56-G59 PolarHBondContact OG1-N 2.85Å; T56-G59 PolarHBondContact OG1-O 2.78Å
60	K	93.6	Very high	96.2	Very high	67 Å²	67	69.4 Å²	69.4	29%	0.291	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.4	124.7	-176.7	-176.2	176.2	175.7	178.7	0	110.5	E54 F55 I62 P85 E86	E54-K60 WeakPolarHBondContact O-CA 3.47Å; F55-K60 HydrophobicContact CD1-CG 4.37Å; F55-K60 HydrophobicContact CE1-CD 4Å; F55-K60 HydrophobicContact CE1-CG 4.22Å; K60-I62 HydrophobicContact CG-CG1 4.27Å; K60-P85 PolarHBondContact NZ-O 3.32Å; K60-E86 PolarHBondContact NZ-O 3.26Å
61	R	95.3	Very high	96.1	Very high	154 Å²	154	73.2 Å²	73.2	58%	0.581	38%	0.383	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.1	133.1	170.6	-178.4	-178.3	179.4	-178.8	2.4	109.4	F53 E54	F53-R61 WeakPolarHBondContact CA-O 3.39Å; E54-R61 HydrophobicContact CB-CB 4.32Å; E54-R61 PolarHBondContact N-O 2.86Å; E54-R61 PolarHBondContact O-N 2.95Å; E54-R61 IonicContact OE2-NH1 3.97Å
62	I	96.3	Very high	96	Very high	73 Å²	73	73.1 Å²	73.1	37%	0.374	39%	0.385	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.2	124.2	179.3	-51.1	-175.7	0	0	0	108.9	T51 E52 F53 K60 I87	T51-I62 HydrophobicContact CG2-CG2 3.57Å; E52-I62 WeakPolarHBondContact O-CA 3.34Å; F53-I62 HydrophobicContact CD1-CD1 4.11Å; F53-I62 HydrophobicContact CD1-CG1 3.91Å; F53-I62 HydrophobicContact CD1-CG2 4.24Å; F53-I62 HydrophobicContact CE1-CD1 3.99Å; F53-I62 HydrophobicContact CE1-CG1 4.23Å; F53-I62 HydrophobicContact CE1-CG2 4.13Å; K60-I62 HydrophobicContact CG-CG1 4.27Å; I62-I87 HydrophobicContact CD1-CG2 4.14Å
63	T	97.5	Very high	95.9	Very high	33 Å²	33	75.7 Å²	75.7	20%	0.202	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.8	134	178.6	-51.3	0	0	0	0	109.6	T51 E52 L65	T51-T63 WeakPolarHBondContact CA-O 3.4Å; E52-T63 PolarHBondContact N-O 2.78Å; E52-T63 PolarHBondContact O-N 3.19Å; T63-L65 HydrophobicContact CG2-CD2 3.92Å; T63-L65 HydrophobicContact CG2-CG 4.08Å
64	K	98.1	Very high	95.8	Very high	147 Å²	147	78.8 Å²	78.8	64%	0.639	42%	0.423	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.2	128.4	172.1	-64.9	-68.3	-176.8	173.6	0	109.4	V50 T51	V50-K64 WeakPolarHBondContact O-CA 3.32Å; T51-K64 HydrophobicContact CG2-CD 4.07Å; T51-K64 PolarHBondContact OG1-NZ 3.14Å
65	L	98.3	Very high	95.8	Very high	57 Å²	57	78 Å²	78	30%	0.298	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	129	-178.3	-61	170.9	0	0	0	108.8	V50 T63 I68	V50-L65 HydrophobicContact CB-CB 4.31Å; V50-L65 PolarHBondContact N-O 2.88Å; V50-L65 PolarHBondContact O-N 2.91Å; T63-L65 HydrophobicContact CG2-CD2 3.92Å; T63-L65 HydrophobicContact CG2-CG 4.08Å; L65-I68 HydrophobicContact CB-CG2 3.79Å; L65-I68 HydrophobicContact CD1-CG2 3.72Å; L65-I68 HydrophobicContact CG-CG2 4.37Å
66	P	98	Very high	95.9	Very high	92 Å²	92	78.8 Å²	78.8	60%	0.597	43%	0.431	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.3	-44.6	-175.9	26.1	-33	0	0	0	112.2	A48 D49	A48-P66 CarbonylContact C-O 3.55Å; A48-P66 VanDerWaalsContact CA-O 3.29Å; A48-P66 WeakPolarHBondContact CA-O 3.28Å; D49-P66 PolarHBondContact N-O 3.26Å
67	H	97.8	Very high	96.1	Very high	125 Å²	125	81 Å²	81	58%	0.579	44%	0.438	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-145	139	179.4	-69.5	81.2	0	0	0	109.9	L47	L47-H67 WeakPolarHBondContact O-CA 3.2Å
68	I	98	Very high	96.2	Very high	32 Å²	32	77.8 Å²	77.8	16%	0.164	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.9	156.7	173.5	72.9	174	0	0	0	111.2	M32 V46 L47 V50 L65 L70	M32-I68 HydrophobicContact CE-CD1 4.37Å; M32-I68 HydrophobicContact SD-CD1 3.52Å; M32-I68 VanDerWaalsContact SD-CD1 3.52Å; V46-I68 WeakPolarHBondContact CA-O 3.41Å; L47-I68 HydrophobicContact CB-CG1 4.01Å; L47-I68 HydrophobicContact CD1-CD1 4.15Å; L47-I68 HydrophobicContact CD1-CG1 4.43Å; L47-I68 HydrophobicContact CG-CG1 4.41Å; L47-I68 PolarHBondContact N-O 2.94Å; L47-I68 PolarHBondContact O-N 2.85Å; V50-I68 HydrophobicContact CG1-CD1 4.15Å; V50-I68 HydrophobicContact CG2-CD1 4.19Å; V50-I68 HydrophobicContact CG2-CG1 4.07Å; L65-I68 HydrophobicContact CB-CG2 3.79Å; L65-I68 HydrophobicContact CD1-CG2 3.72Å; L65-I68 HydrophobicContact CG-CG2 4.37Å; I68-L70 HydrophobicContact CD1-CB 4.41Å
69	L	98	Very high	96.5	Very high	135 Å²	135	72 Å²	72	71%	0.707	38%	0.382	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104	118	158.4	178.1	64.6	0	0	0	108	V46	V46-L69 HydrophobicContact CG2-CD1 4.08Å
70	L	97.1	Very high	96.7	Very high	9 Å²	9	73.3 Å²	73.3	5%	0.047	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.8	130.6	179	-172.6	64.5	0	0	0	110.3	I24 M26 M32 N44 M45 L47 I68 G72 I75	I24-L70 HydrophobicContact CB-CD2 4.48Å; I24-L70 HydrophobicContact CD1-CD2 3.42Å; I24-L70 VanDerWaalsContact CD1-CD2 3.42Å; I24-L70 HydrophobicContact CG2-CD2 3.97Å; M26-L70 HydrophobicContact CE-CD1 3.47Å; M26-L70 VanDerWaalsContact CE-CD1 3.47Å; M26-L70 HydrophobicContact CE-CD2 4.48Å; M26-L70 HydrophobicContact CE-CG 4.14Å; M26-L70 HydrophobicContact SD-CD1 3.91Å; M26-L70 HydrophobicContact SD-CD2 4.01Å; M26-L70 HydrophobicContact SD-CG 4.32Å; M32-L70 HydrophobicContact CE-CD1 3.96Å; M32-L70 HydrophobicContact SD-CD1 3.59Å; M32-L70 VanDerWaalsContact SD-CD1 3.59Å; M32-L70 HydrophobicContact SD-CD2 4.37Å; N44-L70 CarbonylContact C-O 3.57Å; N44-L70 WeakPolarHBondContact CA-O 3.31Å; M45-L70 HydrophobicContact CB-CB 4.31Å; M45-L70 PolarHBondContact N-O 2.85Å; M45-L70 PolarHBondContact O-N 2.77Å; L47-L70 HydrophobicContact CD1-CD2 4.28Å; I68-L70 HydrophobicContact CD1-CB 4.41Å; L70-G72 PolarHBondContact O-N 2.89Å; L70-I75 HydrophobicContact CD2-CD1 3.84Å; L70-I75 HydrophobicContact CD2-CG1 4.05Å; L70-I75 HydrophobicContact CG-CD1 4.41Å; L70-I75 HydrophobicContact CG-CG1 4.5Å
71	N	96.1	Very high	96.8	Very high	80 Å²	80	72.7 Å²	72.7	43%	0.428	40%	0.397	S	S	.	.			trans	-79	119.2	174.7	-177.7	-23.9	0	0	0	110.8	N44 S73 N74	N44-N71 WeakPolarHBondContact OD1-CA 3.31Å; N71-S73 VanDerWaalsContact C-N 3.26Å; N71-S73 PolarHBondContact O-N 3.48Å; N71-S73 VanDerWaalsContact OD1-CB 3.26Å; N71-S73 WeakPolarHBondContact OD1-CB 3.29Å; N71-S73 PolarHBondContact OD1-N 2.98Å; N71-S73 PolarHBondContact OD1-OG 3.19Å; N71-N74 PolarHBondContact O-N 2.71Å
72	G	95.3	Very high	96.8	Very high	12 Å²	12	66 Å²	66	12%	0.124	38%	0.377	C	S	.	.	G	3₁₀ helix	trans	-63.7	-25.5	-177.2	0	0	0	0	0	114.5	V43 N44 L70 N74 I75	V43-G72 WeakPolarHBondContact O-CA 3.29Å; N44-G72 PolarHBondContact OD1-N 2.88Å; L70-G72 PolarHBondContact O-N 2.89Å; G72-N74 PolarHBondContact O-N 2.9Å; G72-N74 VanDerWaalsContact O-N 3.09Å; G72-I75 PolarHBondContact O-N 2.88Å; G72-I75 VanDerWaalsContact O-N 3.11Å
73	S	95.4	Very high	96.7	Very high	79 Å²	79	71.1 Å²	71.1	55%	0.552	40%	0.399	S	S	*	.	G	3₁₀ helix	trans	-64	-19.7	-179.4	-57.6	0	0	0	0	113.6	K27 N71	K27-S73 PolarHBondContact NZ-O 3.5Å; N71-S73 VanDerWaalsContact C-N 3.26Å; N71-S73 PolarHBondContact O-N 3.48Å; N71-S73 VanDerWaalsContact OD1-CB 3.26Å; N71-S73 WeakPolarHBondContact OD1-CB 3.29Å; N71-S73 PolarHBondContact OD1-N 2.98Å; N71-S73 PolarHBondContact OD1-OG 3.19Å
74	N	94.4	Very high	96.4	Very high	71 Å²	71	70.7 Å²	70.7	38%	0.38	40%	0.401	S	S	.	.	G	3₁₀ helix	trans	-102.1	-3.4	-179.2	-67.5	-34.4	0	0	0	113.5	M26 K27 N71 G72	M26-N74 CarbonylContact C-O 3.52Å; M26-N74 VanDerWaalsContact CA-O 3.32Å; M26-N74 WeakPolarHBondContact CA-O 3.49Å; M26-N74 HydrophobicContact CE-CB 3.46Å; M26-N74 VanDerWaalsContact CE-CB 3.46Å; K27-N74 PolarHBondContact N-O 2.84Å; N71-N74 PolarHBondContact O-N 2.71Å; G72-N74 PolarHBondContact O-N 2.9Å; G72-N74 VanDerWaalsContact O-N 3.09Å
75	I	96.8	Very high	96.1	Very high	31 Å²	31	65 Å²	65	16%	0.159	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.1	128.5	175.8	-60.9	178.7	0	0	0	108.7	I24 M26 V43 M45 L70 G72	I24-I75 HydrophobicContact CG2-CB 4.35Å; I24-I75 HydrophobicContact CG2-CD1 4.14Å; I24-I75 HydrophobicContact CG2-CG1 3.87Å; I24-I75 HydrophobicContact CG2-CG2 3.81Å; M26-I75 HydrophobicContact CE-CG1 4.4Å; M26-I75 HydrophobicContact SD-CG1 3.87Å; V43-I75 HydrophobicContact CG1-CD1 4.41Å; M45-I75 HydrophobicContact CE-CD1 4Å; M45-I75 HydrophobicContact CG-CD1 4.38Å; M45-I75 HydrophobicContact SD-CD1 4.15Å; L70-I75 HydrophobicContact CD2-CD1 3.84Å; L70-I75 HydrophobicContact CD2-CG1 4.05Å; L70-I75 HydrophobicContact CG-CD1 4.41Å; L70-I75 HydrophobicContact CG-CG1 4.5Å; G72-I75 PolarHBondContact O-N 2.88Å; G72-I75 VanDerWaalsContact O-N 3.11Å
76	V	96.9	Very high	95.5	Very high	93 Å²	93	71.3 Å²	71.3	56%	0.564	41%	0.407	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.9	-46.4	173	176.7	0	0	0	0	109.9	I25 K27	I25-V76 WeakPolarHBondContact O-CB 3.4Å; I25-V76 PolarHBondContact O-N 2.91Å; K27-V76 HydrophobicContact CB-CG2 4.17Å; K27-V76 HydrophobicContact CG-CG2 3.4Å; K27-V76 VanDerWaalsContact CG-CG2 3.4Å
77	M	96.5	Very high	94.1	Very high	100 Å²	100	75.7 Å²	75.7	49%	0.493	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.8	147.1	-176.8	-177.1	164.6	66.9	0	0	110.7	I24 I25 V79	I24-M77 WeakPolarHBondContact CA-O 3.46Å; I25-M77 HydrophobicContact CB-CB 4.43Å; I25-M77 HydrophobicContact CD1-CB 4.2Å; I25-M77 HydrophobicContact CD1-CE 3.21Å; I25-M77 HydrophobicContact CD1-CG 4.45Å; I25-M77 PolarHBondContact N-O 3.38Å; I25-M77 PolarHBondContact O-N 2.84Å; M77-V79 HydrophobicContact CE-CG2 4.07Å; M77-V79 HydrophobicContact CG-CG2 4.26Å; M77-V79 HydrophobicContact SD-CG2 4.46Å
78	M	97	Very high	93.9	Very high	35 Å²	35	73.3 Å²	73.3	17%	0.172	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	131.7	168.8	-179.1	-170.1	71.4	0	0	108.5	L13 V14 I22 H23 M45 P80	L13-M78 HydrophobicContact CD2-CE 4.48Å; L13-M78 HydrophobicContact CG-CE 4.25Å; V14-M78 HydrophobicContact CB-CE 4.45Å; V14-M78 HydrophobicContact CG2-CE 3.8Å; V14-M78 HydrophobicContact CG2-SD 4.29Å; I22-M78 HydrophobicContact CB-CG 4.24Å; I22-M78 HydrophobicContact CD1-CG 4.16Å; I22-M78 HydrophobicContact CD1-SD 3.89Å; I22-M78 HydrophobicContact CG2-SD 4.3Å; H23-M78 CarbonylContact O-C 3.56Å; H23-M78 WeakPolarHBondContact O-CA 3.47Å; M45-M78 HydrophobicContact CE-SD 3.83Å; M78-P80 HydrophobicContact CE-CG 4.35Å
79	V	97.6	Very high	93.7	Very high	50 Å²	50	75.4 Å²	75.4	30%	0.303	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	105	176.9	-174.7	0	0	0	0	108.2	H23 I25 M77 G81 G82	H23-V79 HydrophobicContact CB-CB 4.21Å; H23-V79 PolarHBondContact N-O 2.67Å; H23-V79 PolarHBondContact O-N 3.39Å; I25-V79 HydrophobicContact CD1-CG2 4.37Å; M77-V79 HydrophobicContact CE-CG2 4.07Å; M77-V79 HydrophobicContact CG-CG2 4.26Å; M77-V79 HydrophobicContact SD-CG2 4.46Å; V79-G81 PolarHBondContact O-N 2.99Å; V79-G82 PolarHBondContact O-N 2.89Å
80	P	97.4	Very high	93.5	Very high	64 Å²	64	72.1 Å²	72.1	42%	0.416	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-56.2	128.5	174.4	-25.2	34.1	0	0	0	111.7	L13 M78 G82	L13-P80 HydrophobicContact CD1-CG 4Å; L13-P80 HydrophobicContact CD2-CG 4.38Å; L13-P80 HydrophobicContact CG-CG 4.37Å; M78-P80 HydrophobicContact CE-CG 4.35Å; P80-G82 PolarHBondContact O-N 2.74Å; P80-G82 VanDerWaalsContact O-N 3.14Å
81	G	95.8	Very high	93.3	Very high	55 Å²	55	75.8 Å²	75.8	57%	0.567	44%	0.435	S	S	*	.	T	Hydrogen-bonded Turn	trans	68.1	5.6	179.3	0	0	0	0	0	115.3	K21 V79	K21-G81 VanDerWaalsContact O-CA 3.31Å; K21-G81 WeakPolarHBondContact O-CA 3.35Å; K21-G81 PolarHBondContact O-N 3.14Å; V79-G81 PolarHBondContact O-N 2.99Å
82	G	94.7	Very high	93.1	Very high	14 Å²	14	75.6 Å²	75.6	14%	0.144	44%	0.436	C	S	.	.			trans	-64.5	138.8	178.7	0	0	0	0	0	112.1	V79 P80 G84	V79-G82 PolarHBondContact O-N 2.89Å; P80-G82 PolarHBondContact O-N 2.74Å; P80-G82 VanDerWaalsContact O-N 3.14Å; G82-G84 VanDerWaalsContact C-N 3.32Å
83	E	93.4	Very high	92.9	Very high	179 Å²	179	79.8 Å²	79.8	84%	0.836	46%	0.457	S	S	*	.			trans	-87.1	-5.3	-179.6	-60.6	-170.3	158.3	0	0	113.3
84	G	92.6	Very high	92.8	Very high	25 Å²	25	79.9 Å²	79.9	26%	0.258	45%	0.45	S	S	.	.			trans	87.9	-169	-175.8	0	0	0	0	0	113.2	V33 G82	V33-G84 VanDerWaalsContact CG2-CA 3.43Å; G82-G84 VanDerWaalsContact C-N 3.32Å
85	P	92.1	Very high	92.6	Very high	27 Å²	27	80.5 Å²	80.5	18%	0.175	46%	0.455	C	S	.	.	S	Bend	trans	-74.9	144.4	177.6	30.2	-30.8	0	0	0	110.3	E31 F53 F55 K60 I87	E31-P85 WeakPolarHBondContact OE2-CD 3.46Å; E31-P85 VanDerWaalsContact OE2-CG 3.29Å; E31-P85 WeakPolarHBondContact OE2-CG 3.3Å; F53-P85 HydrophobicContact CB-CG 4.1Å; F53-P85 HydrophobicContact CD1-CG 4.11Å; F53-P85 HydrophobicContact CD2-CG 3.83Å; F53-P85 HydrophobicContact CE1-CG 4.44Å; F53-P85 HydrophobicContact CE2-CG 4.22Å; F53-P85 HydrophobicContact CG-CG 3.74Å; F53-P85 HydrophobicContact CZ-CG 4.48Å; F55-P85 HydrophobicContact CE2-CG 4.46Å; F55-P85 HydrophobicContact CZ-CB 3.88Å; F55-P85 HydrophobicContact CZ-CG 3.79Å; K60-P85 PolarHBondContact NZ-O 3.32Å; P85-I87 PolarHBondContact O-N 3.49Å
86	E	84.1	Confident	92.3	Very high	190 Å²	190	84.7 Å²	84.7	89%	0.888	48%	0.48	S	S	*	.			trans	-50.8	134.8	174.7	-65.4	-175.7	175.4	0	0	110.9	K60	K60-E86 PolarHBondContact NZ-O 3.26Å
87	I	69.4	Low	91.9	Very high	184 Å²	184	83.9 Å²	83.9	94%	0.944	47%	0.472	S	S	*	.			trans	-80.6	0	-177.8	-62.5	178.1	0	0	0	110.2	F53 I62 P85	F53-I87 HydrophobicContact CE1-CG1 4.31Å; I62-I87 HydrophobicContact CD1-CG2 4.14Å; P85-I87 PolarHBondContact O-N 3.49Å

Retrieved 87 of 87 residues in 27.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).