G4VS33_SCHMA Loading...

Putative lipopolysaccharide-induced transcription factor regulating tumor necrosis factor alpha

AlphaFold DB , UniProt , Accession G4VS33, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 92 aa.

						>G4VS33_SCHMA|G4VS33
MKTPIVHQPTGLASTVFYGPQPVSSSCDICMNKITTIVHYRKGACTWMACTGIALLGGIFGCCLIPFYVNSCKDAYHSCPECGTLLGVYKRI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.1	Very low	54.3	Low	243 Å²	243	138.2 Å²	138.2	100%	1.197	77%	0.772	S	S	*	*				0	102.7	0	-164.7	87.2	171.8	0	0	107.8
2	K	42.5	Very low	54.7	Low	210 Å²	210	140.2 Å²	140.2	91%	0.913	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-85.6	123.4	174.5	-76.4	-179.2	174	-178.8	0	107.7
3	T	59.2	Low	55.2	Low	84 Å²	84	137.3 Å²	137.3	52%	0.515	78%	0.784	S	S	.	*	P	Polyproline II helix	trans	-65.6	144.5	177.7	44.7	0	0	0	0	111	I5	T3-I5 PolarHBondContact O-N 2.91Å
4	P	52.6	Low	55.8	Low	118 Å²	118	131.6 Å²	131.6	77%	0.766	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-64	131.6	175.4	26.3	-32.7	0	0	0	110.7	V6	P4-V6 PolarHBondContact O-N 2.91Å
5	I	57.3	Low	56.9	Low	103 Å²	103	132.1 Å²	132.1	53%	0.528	76%	0.764	S	S	.	*			trans	-74.2	100.9	176.5	-67.1	170.5	0	0	0	106.9	T3 H7 K33	T3-I5 PolarHBondContact O-N 2.91Å; I5-H7 PolarHBondContact O-N 2.82Å; I5-K33 HydrophobicContact CG2-CD 4.03Å
6	V	56.6	Low	58.3	Low	119 Å²	119	127.1 Å²	127.1	72%	0.721	74%	0.736	S	S	*	*			trans	-68.5	115	164.8	-177.2	0	0	0	0	106.8	P4 K33	P4-V6 PolarHBondContact O-N 2.91Å; V6-K33 PolarHBondContact O-NZ 3.18Å
7	H	55.1	Low	60	Low	160 Å²	160	129.4 Å²	129.4	74%	0.741	74%	0.735	S	S	*	*			trans	-79.1	110.7	167.3	-73.3	-96.3	0	0	0	106.9	I5 P9	I5-H7 PolarHBondContact O-N 2.82Å; H7-P9 WeakPolarHBondContact O-CD 3.28Å
8	Q	59.6	Low	61.7	Low	136 Å²	136	124.8 Å²	124.8	64%	0.636	70%	0.704	S	S	*	*	P	Polyproline II helix	trans	-85.2	120.4	171.2	-150.2	166.7	-2.7	0	0	107.1	S14	Q8-S14 PolarHBondContact OE1-OG 3.44Å
9	P	53.7	Low	63.3	Low	117 Å²	117	118.8 Å²	118.8	76%	0.76	67%	0.673	S	S	*	*	P	Polyproline II helix	trans	-63.5	138.1	-176.6	21.8	-29.6	0	0	0	111.3	H7	H7-P9 WeakPolarHBondContact O-CD 3.28Å
10	T	56.7	Low	64.7	Low	156 Å²	156	115.3 Å²	115.3	96%	0.957	66%	0.655	S	S	*	*	S	Bend	trans	-63.1	130.6	-171.5	-27.1	0	0	0	0	112.1
11	G	56.1	Low	66.1	Low	74 Å²	74	116.9 Å²	116.9	76%	0.763	66%	0.657	S	S	*	*	S	Bend	trans	161.5	-26.8	166.9	0	0	0	0	0	115.7
12	L	59	Low	68.2	Low	162 Å²	162	109 Å²	109	85%	0.848	62%	0.624	S	S	*	*	S	Bend	trans	-133	126.5	176.3	-72.8	151.1	0	0	0	106.9	S14	L12-S14 PolarHBondContact O-N 3.49Å
13	A	61.4	Low	70.5	Confident	103 Å²	103	100.7 Å²	100.7	85%	0.851	59%	0.591	S	S	*	*			trans	-51.5	106.9	171.7	0	0	0	0	0	108	T15	A13-T15 PolarHBondContact O-N 3.38Å; A13-T15 VanDerWaalsContact O-N 3.07Å
14	S	63.5	Low	72	Confident	58 Å²	58	99.4 Å²	99.4	41%	0.406	59%	0.585	S	S	.	*			trans	-74	108.2	-179.4	44.7	0	0	0	0	107.5	Q8 L12 V16	Q8-S14 PolarHBondContact OE1-OG 3.44Å; L12-S14 PolarHBondContact O-N 3.49Å; S14-V16 PolarHBondContact O-N 3.25Å
15	T	71.6	Confident	73.6	Confident	139 Å²	139	94 Å²	94	85%	0.853	55%	0.551	S	S	*	*			trans	-54.3	111.3	169.2	-54.9	0	0	0	0	107.7	A13 F17	A13-T15 PolarHBondContact O-N 3.38Å; A13-T15 VanDerWaalsContact O-N 3.07Å; T15-F17 PolarHBondContact O-N 3.18Å
16	V	80.5	Confident	75.1	Confident	52 Å²	52	92.9 Å²	92.9	32%	0.315	55%	0.552	S	S	.	*			trans	-67.8	118.8	176.6	178.2	0	0	0	0	107.6	S14 Y18 V23	S14-V16 PolarHBondContact O-N 3.25Å; V16-Y18 HydrophobicContact CB-CE2 4.11Å; V16-Y18 HydrophobicContact CG1-CD1 4.31Å; V16-Y18 HydrophobicContact CG1-CD2 4.42Å; V16-Y18 HydrophobicContact CG1-CE1 3.84Å; V16-Y18 HydrophobicContact CG1-CE2 3.98Å; V16-Y18 PolarHBondContact O-N 3.25Å; V16-V23 HydrophobicContact CG1-CG1 4.11Å; V16-V23 HydrophobicContact CG1-CG2 4.29Å
17	F	87.1	Confident	76.7	Confident	166 Å²	166	87.2 Å²	87.2	73%	0.728	52%	0.518	S	S	*	.			trans	-84.5	112.5	173	-174.3	-95.9	0	0	0	109.7	T15	T15-F17 PolarHBondContact O-N 3.18Å
18	Y	90.5	Very high	78.3	Confident	46 Å²	46	86.5 Å²	86.5	18%	0.18	52%	0.519	C	S	.	.			trans	-85.4	117.7	173.8	-63.4	-78	0	0	0	109.6	V16 V23 T36 H77 L86 Y89	V16-Y18 HydrophobicContact CB-CE2 4.11Å; V16-Y18 HydrophobicContact CG1-CD1 4.31Å; V16-Y18 HydrophobicContact CG1-CD2 4.42Å; V16-Y18 HydrophobicContact CG1-CE1 3.84Å; V16-Y18 HydrophobicContact CG1-CE2 3.98Å; V16-Y18 PolarHBondContact O-N 3.25Å; Y18-V23 HydrophobicContact CD1-CG1 3.51Å; Y18-V23 HydrophobicContact CE1-CG1 3.65Å; Y18-T36 HydrophobicContact CE1-CG2 4.13Å; Y18-H77 HydrophobicContact CD1-CB 3.74Å; Y18-H77 AromaticContact CD1-CD2 3.81Å; Y18-H77 AromaticContact CD1-CG 3.47Å; Y18-H77 VanDerWaalsContact CD1-CG 3.47Å; Y18-H77 AromaticContact CD1-ND1 3.71Å; Y18-H77 HydrophobicContact CE1-CB 3.96Å; Y18-L86 HydrophobicContact CE1-CB 4.21Å; Y18-L86 WeakPolarHBondContact CE2-O 3.47Å; Y18-L86 WeakPolarHBondContact OH-CB 3.3Å; Y18-L86 PolarHBondContact OH-O 3.07Å; Y18-Y89 WeakPolarHBondContact O-CD2 3.44Å
19	G	92.6	Very high	79.8	Confident	11 Å²	11	85.6 Å²	85.6	11%	0.113	52%	0.517	C	S	.	.			trans	-107.7	-162.6	176.1	0	0	0	0	0	112.3	Q21 H77 Y89	G19-Q21 PolarHBondContact O-N 3.41Å; G19-H77 PolarHBondContact O-CE1 3.48Å; G19-H77 PolarHBondContact O-NE2 3.48Å; G19-Y89 WeakPolarHBondContact O-CB 3.16Å
20	P	91.4	Very high	81.6	Confident	48 Å²	48	82.1 Å²	82.1	31%	0.312	50%	0.495	S	S	.	.	S	Bend	trans	-72.8	-16.2	177.7	28.9	-34.6	0	0	0	113.6	Y40 Y89	P20-Y40 PolarHBondContact O-OH 3.09Å; P20-Y89 HydrophobicContact CB-CD1 4.18Å; P20-Y89 HydrophobicContact CB-CE1 4.08Å; P20-Y89 HydrophobicContact CG-CE1 4.42Å
21	Q	92.8	Very high	83.1	Confident	150 Å²	150	82.7 Å²	82.7	70%	0.701	49%	0.489	S	S	*	.	S	Bend	trans	-108.2	151.8	-174.2	-68.5	178	-12.5	0	0	111.5	G19 V23 H77	G19-Q21 PolarHBondContact O-N 3.41Å; Q21-V23 PolarHBondContact O-N 3.27Å; Q21-H77 PolarHBondContact O-CE1 3.23Å; Q21-H77 VanDerWaalsContact O-CE1 3.28Å
22	P	92.3	Very high	84.5	Confident	76 Å²	76	83.5 Å²	83.5	49%	0.494	48%	0.476	S	S	.	.			trans	-47.1	132.7	171.3	-29.7	36.5	0	0	0	112.4	T35 T36 V38	P22-T35 HydrophobicContact CB-CG2 3.93Å; P22-T36 WeakPolarHBondContact CB-O 3.07Å; P22-V38 HydrophobicContact CB-CG2 4.3Å; P22-V38 HydrophobicContact CG-CG2 3.85Å
23	V	91	Very high	85.9	Confident	36 Å²	36	80 Å²	80	22%	0.218	45%	0.454	C	S	.	.			trans	-118.7	141.8	-180	66.3	0	0	0	0	110.2	V16 Y18 Q21 T36	V16-V23 HydrophobicContact CG1-CG1 4.11Å; V16-V23 HydrophobicContact CG1-CG2 4.29Å; Y18-V23 HydrophobicContact CD1-CG1 3.51Å; Y18-V23 HydrophobicContact CE1-CG1 3.65Å; Q21-V23 PolarHBondContact O-N 3.27Å; V23-T36 HydrophobicContact CG1-CG2 4Å; V23-T36 PolarHBondContact N-OG1 2.86Å; V23-T36 WeakPolarHBondContact O-CG2 3.42Å; V23-T36 PolarHBondContact O-N 3.46Å; V23-T36 PolarHBondContact O-OG1 3.4Å
24	S	90.5	Very high	87.3	Confident	57 Å²	57	75.6 Å²	75.6	40%	0.399	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.2	118.4	171.8	-64	0	0	0	0	109.1	I34	S24-I34 WeakPolarHBondContact CA-O 3.29Å
25	S	87.1	Confident	88.7	Confident	6 Å²	6	76 Å²	76	4%	0.042	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.2	166.6	-178.4	56.1	0	0	0	0	110.3	I34	S25-I34 PolarHBondContact N-O 2.97Å; S25-I34 PolarHBondContact O-N 2.78Å
26	S	88.9	Confident	89.7	Confident	79 Å²	79	69.5 Å²	69.5	55%	0.552	38%	0.376	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.2	133	171.6	-61.8	0	0	0	0	109
27	C	89.4	Confident	90.5	Very high	0 Å²	0	70.8 Å²	70.8	0%	0	38%	0.38	C	S	.	.			trans	-86.3	124.3	172.9	177.5	0	0	0	0	109.4	I29 C30 M31 N32 I34 C79 L86	C27-I29 PolarHBondContact O-N 2.96Å; C27-C30 HydrophobicContact CB-CB 4.1Å; C27-C30 PolarHBondContact O-N 3.42Å; C27-C30 PolarHBondContact SG-N 2.91Å; C27-C30 VanDerWaalsContact SG-N 3.45Å; C27-M31 WeakPolarHBondContact O-CA 3.4Å; C27-M31 PolarHBondContact O-N 3.04Å; C27-N32 PolarHBondContact N-O 3.32Å; C27-N32 VanDerWaalsContact N-O 3.08Å; C27-I34 HydrophobicContact CB-CG1 4.08Å; C27-C79 HydrophobicContact CB-CB 4.5Å; C27-L86 HydrophobicContact CB-CD2 4.47Å
28	D	87.9	Confident	90.8	Very high	145 Å²	145	63.9 Å²	63.9	78%	0.775	35%	0.352	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.1	-22.4	-179.9	-60.5	-38.1	0	0	0	113.1
29	I	92.7	Very high	91.1	Very high	116 Å²	116	66.1 Å²	66.1	60%	0.595	36%	0.364	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.1	-44.4	178.1	-53.7	-57.1	0	0	0	111.4	C27 T84	C27-I29 PolarHBondContact O-N 2.96Å; I29-T84 HydrophobicContact CG1-CG2 4.12Å
30	C	90	Very high	91.2	Very high	44 Å²	44	69.5 Å²	69.5	30%	0.297	37%	0.374	S	S	.	.	T	Hydrogen-bonded Turn	trans	-87.6	-15.5	-179.5	-58	0	0	0	0	112.9	C27 N32 C82	C27-C30 HydrophobicContact CB-CB 4.1Å; C27-C30 PolarHBondContact O-N 3.42Å; C27-C30 PolarHBondContact SG-N 2.91Å; C27-C30 VanDerWaalsContact SG-N 3.45Å; C30-N32 HydrophobicContact CB-CB 4.23Å; C30-N32 PolarHBondContact O-N 3.15Å; C30-C82 VanDerWaalsContact SG-CB 3.58Å; C30-C82 PolarHBondContact SG-SG 2.96Å
31	M	88.7	Confident	91.3	Very high	169 Å²	169	74.4 Å²	74.4	83%	0.833	39%	0.386	S	S	*	.			trans	50.4	26	-169.3	-58.6	-177.6	-68.2	0	0	113.6	C27	C27-M31 WeakPolarHBondContact O-CA 3.4Å; C27-M31 PolarHBondContact O-N 3.04Å
32	N	85	Confident	91.1	Very high	91 Å²	91	73.6 Å²	73.6	49%	0.487	38%	0.38	S	S	.	.	S	Bend	trans	-115.3	147.6	-176.6	-160.4	25.9	0	0	0	110.6	C27 C30 I34	C27-N32 PolarHBondContact N-O 3.32Å; C27-N32 VanDerWaalsContact N-O 3.08Å; C30-N32 HydrophobicContact CB-CB 4.23Å; C30-N32 PolarHBondContact O-N 3.15Å; N32-I34 HydrophobicContact CB-CG2 4.46Å; N32-I34 PolarHBondContact O-N 3.17Å
33	K	89.1	Confident	91.1	Very high	88 Å²	88	70.4 Å²	70.4	38%	0.383	36%	0.361	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.4	118.2	173.9	-171.6	168.8	-173.2	158.7	0	108.8	I5 V6	I5-K33 HydrophobicContact CG2-CD 4.03Å; V6-K33 PolarHBondContact O-NZ 3.18Å
34	I	90	Very high	91	Very high	10 Å²	10	71.2 Å²	71.2	5%	0.051	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	162.6	-175	58.6	76	0	0	0	110.8	S24 S25 C27 N32 T36 P80 E81 L86	S24-I34 WeakPolarHBondContact CA-O 3.29Å; S25-I34 PolarHBondContact N-O 2.97Å; S25-I34 PolarHBondContact O-N 2.78Å; C27-I34 HydrophobicContact CB-CG1 4.08Å; N32-I34 HydrophobicContact CB-CG2 4.46Å; N32-I34 PolarHBondContact O-N 3.17Å; I34-T36 HydrophobicContact CD1-CG2 3.84Å; I34-P80 HydrophobicContact CB-CG 4.12Å; I34-P80 HydrophobicContact CG2-CG 4.34Å; I34-E81 HydrophobicContact CG2-CG 4.25Å; I34-L86 HydrophobicContact CD1-CD1 3.72Å; I34-L86 HydrophobicContact CG1-CD1 4.48Å
35	T	93.7	Very high	90.9	Very high	66 Å²	66	69.6 Å²	69.6	41%	0.405	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.9	121.5	161.2	-57.9	0	0	0	0	107.2	P22	P22-T35 HydrophobicContact CB-CG2 3.93Å
36	T	93.4	Very high	91.1	Very high	3 Å²	3	69.3 Å²	69.3	2%	0.018	36%	0.358	C	S	.	.	P	Polyproline II helix	trans	-62.2	141.8	-176.9	60.6	0	0	0	0	111.2	Y18 P22 V23 I34 H77 S78 L86	Y18-T36 HydrophobicContact CE1-CG2 4.13Å; P22-T36 WeakPolarHBondContact CB-O 3.07Å; V23-T36 HydrophobicContact CG1-CG2 4Å; V23-T36 PolarHBondContact N-OG1 2.86Å; V23-T36 WeakPolarHBondContact O-CG2 3.42Å; V23-T36 PolarHBondContact O-N 3.46Å; V23-T36 PolarHBondContact O-OG1 3.4Å; I34-T36 HydrophobicContact CD1-CG2 3.84Å; T36-H77 HydrophobicContact CG2-CB 3.95Å; T36-H77 PolarHBondContact OG1-ND1 3.39Å; T36-S78 WeakPolarHBondContact CA-O 3.43Å; T36-L86 HydrophobicContact CG2-CD1 3.93Å
37	I	95.6	Very high	91.2	Very high	79 Å²	79	73 Å²	73	41%	0.405	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.5	133.7	164.1	-62.4	175.5	0	0	0	108.3	H77 S78 P80	I37-H77 WeakPolarHBondContact O-CA 3.38Å; I37-S78 PolarHBondContact N-O 3.32Å; I37-S78 PolarHBondContact O-N 3.45Å; I37-P80 HydrophobicContact CD1-CB 3.72Å; I37-P80 HydrophobicContact CG1-CB 4.03Å
38	V	95.2	Very high	91.2	Very high	22 Å²	22	78 Å²	78	13%	0.133	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.6	119.8	178.9	-179.3	0	0	0	0	110.3	P22 Y40 A75 Y76 H77	P22-V38 HydrophobicContact CB-CG2 4.3Å; P22-V38 HydrophobicContact CG-CG2 3.85Å; V38-Y40 HydrophobicContact CG1-CD1 4.38Å; V38-Y40 HydrophobicContact CG1-CD2 4.44Å; V38-Y40 HydrophobicContact CG1-CE1 4.01Å; V38-Y40 HydrophobicContact CG1-CE2 4.06Å; V38-A75 HydrophobicContact CG1-CB 3.49Å; V38-A75 VanDerWaalsContact CG1-CB 3.49Å; V38-Y76 CarbonylContact C-O 3.58Å; V38-Y76 WeakPolarHBondContact CA-O 3.46Å; V38-H77 VanDerWaalsContact CG2-CE1 3.45Å; V38-H77 WeakPolarHBondContact CG2-CE1 3.34Å
39	H	95.1	Very high	91.3	Very high	93 Å²	93	72.6 Å²	72.6	43%	0.431	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	118.2	171.3	-62	-73.5	0	0	0	110	Y76	H39-Y76 PolarHBondContact N-O 3.06Å; H39-Y76 WeakPolarHBondContact O-CB 3.44Å; H39-Y76 PolarHBondContact O-N 3.36Å
40	Y	94.6	Very high	91.1	Very high	82 Å²	82	67.6 Å²	67.6	32%	0.322	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.9	121.8	178.3	-65.2	-78	0	0	0	111.4	P20 V38 N70 K73 D74 A75	P20-Y40 PolarHBondContact O-OH 3.09Å; V38-Y40 HydrophobicContact CG1-CD1 4.38Å; V38-Y40 HydrophobicContact CG1-CD2 4.44Å; V38-Y40 HydrophobicContact CG1-CE1 4.01Å; V38-Y40 HydrophobicContact CG1-CE2 4.06Å; Y40-N70 HydrophobicContact CD1-CB 3.93Å; Y40-N70 HydrophobicContact CD2-CB 4.07Å; Y40-N70 HydrophobicContact CE1-CB 4.06Å; Y40-N70 HydrophobicContact CE2-CB 4.21Å; Y40-N70 HydrophobicContact CG-CB 3.92Å; Y40-K73 HydrophobicContact CD1-CB 4.29Å; Y40-D74 CarbonylContact C-O 3.57Å; Y40-D74 VanDerWaalsContact CA-O 3.28Å; Y40-D74 WeakPolarHBondContact CA-O 3.42Å; Y40-A75 HydrophobicContact CD1-CB 4.26Å; Y40-A75 HydrophobicContact CE1-CB 4.07Å
41	R	93.6	Very high	91.1	Very high	151 Å²	151	69.2 Å²	69.2	57%	0.57	34%	0.344	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-118	147.2	177.2	-60.9	-172.9	176.7	-170	-0.1	111.6	G43 K73 D74 Y76	R41-G43 PolarHBondContact O-N 3.32Å; R41-K73 CarbonylContact O-C 3.56Å; R41-K73 WeakPolarHBondContact O-CA 3.47Å; R41-K73 VanDerWaalsContact O-CB 3.23Å; R41-K73 WeakPolarHBondContact O-CB 3.42Å; R41-D74 PolarHBondContact N-O 2.89Å; R41-D74 PolarHBondContact O-N 3.26Å; R41-Y76 HydrophobicContact CB-CD2 4Å; R41-Y76 HydrophobicContact CB-CE2 3.68Å; R41-Y76 HydrophobicContact CG-CD2 3.83Å; R41-Y76 HydrophobicContact CG-CE2 3.91Å
42	K	90.3	Very high	91.3	Very high	132 Å²	132	62.6 Å²	62.6	57%	0.574	32%	0.319	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-66.8	116.8	177.6	-61.3	171.4	180	-177.3	0	108.8	T46 F67	K42-T46 HydrophobicContact CB-CG2 4.36Å; K42-F67 HydrophobicContact CD-CD1 3.64Å; K42-F67 HydrophobicContact CD-CE1 4.07Å; K42-F67 HydrophobicContact CG-CD1 4.08Å
43	G	90.8	Very high	91.5	Very high	9 Å²	9	60.6 Å²	60.6	9%	0.093	31%	0.308	C	S	.	.			trans	-119.3	-171.3	-178.8	0	0	0	0	0	112.6	R41 C45 T46 W47 D74	R41-G43 PolarHBondContact O-N 3.32Å; G43-C45 PolarHBondContact O-N 3.05Å; G43-T46 PolarHBondContact N-OG1 3.5Å; G43-T46 PolarHBondContact O-N 3.11Å; G43-T46 PolarHBondContact O-OG1 2.93Å; G43-W47 PolarHBondContact O-N 3.46Å; G43-D74 WeakPolarHBondContact CA-OD2 3.26Å
44	A	89.4	Confident	91.5	Very high	53 Å²	53	58.3 Å²	58.3	44%	0.438	31%	0.305	S	S	.	.	H	α-helix	trans	-54.5	-38.7	-179.4	0	0	0	0	0	112.6	T46 W47 M48	A44-T46 PolarHBondContact O-N 3.41Å; A44-W47 PolarHBondContact O-N 3.42Å; A44-M48 PolarHBondContact O-N 3.44Å
45	C	89.2	Confident	91.4	Very high	23 Å²	23	64.6 Å²	64.6	16%	0.155	34%	0.339	C	S	.	.	H	α-helix	trans	-57.3	-45.6	175.8	-174.3	0	0	0	0	113.2	G43 W47 M48 A49 C72 R91 I92	G43-C45 PolarHBondContact O-N 3.05Å; C45-W47 VanDerWaalsContact C-N 3.34Å; C45-W47 PolarHBondContact O-N 3.1Å; C45-M48 PolarHBondContact O-N 3.21Å; C45-A49 WeakPolarHBondContact O-CB 3.19Å; C45-A49 PolarHBondContact O-N 3.4Å; C45-C72 VanDerWaalsContact CB-O 3.3Å; C45-C72 WeakPolarHBondContact CB-O 3.23Å; C45-R91 HydrophobicContact CB-CB 3.91Å; C45-I92 VanDerWaalsContact CA-CD1 3.44Å; C45-I92 HydrophobicContact CB-CB 4.45Å; C45-I92 HydrophobicContact CB-CD1 3.44Å; C45-I92 VanDerWaalsContact CB-CD1 3.44Å; C45-I92 HydrophobicContact CB-CG1 3.73Å
46	T	89.6	Confident	91.2	Very high	0 Å²	0	69 Å²	69	0%	0	36%	0.359	C	S	.	.	H	α-helix	trans	-57.9	-47.1	175.8	56.1	0	0	0	0	111.6	K42 G43 A44 A49 C50 C72 K73	K42-T46 HydrophobicContact CB-CG2 4.36Å; G43-T46 PolarHBondContact N-OG1 3.5Å; G43-T46 PolarHBondContact O-N 3.11Å; G43-T46 PolarHBondContact O-OG1 2.93Å; A44-T46 PolarHBondContact O-N 3.41Å; T46-A49 PolarHBondContact O-N 3.04Å; T46-C50 PolarHBondContact O-N 3.01Å; T46-C50 PolarHBondContact O-SG 3.19Å; T46-C72 VanDerWaalsContact CG2-C 3.45Å; T46-C72 HydrophobicContact CG2-CB 3.76Å; T46-C72 WeakPolarHBondContact CG2-O 3.33Å; T46-C72 PolarHBondContact N-O 3.47Å; T46-C72 VanDerWaalsContact N-O 3.14Å; T46-K73 HydrophobicContact CG2-CB 4.46Å; T46-K73 HydrophobicContact CG2-CG 3.66Å
47	W	91.1	Very high	90.8	Very high	157 Å²	157	71.4 Å²	71.4	60%	0.595	38%	0.384	S	S	*	.	H	α-helix	trans	-66.7	-41.9	-177.4	-73.9	99.4	0	0	0	113	G43 A44 C45 C50 T51	G43-W47 PolarHBondContact O-N 3.46Å; A44-W47 PolarHBondContact O-N 3.42Å; C45-W47 VanDerWaalsContact C-N 3.34Å; C45-W47 PolarHBondContact O-N 3.1Å; W47-C50 PolarHBondContact O-N 3.01Å; W47-T51 WeakPolarHBondContact O-CB 3.44Å; W47-T51 PolarHBondContact O-N 3.15Å; W47-T51 PolarHBondContact O-OG1 3.13Å
48	M	90.7	Very high	90.1	Very high	105 Å²	105	68.1 Å²	68.1	52%	0.517	37%	0.369	S	S	.	.	H	α-helix	trans	-67.4	-40.9	178.2	-71.3	-163.5	-66.6	0	0	112.2	A44 C45 T51 G52 I92	A44-M48 PolarHBondContact O-N 3.44Å; C45-M48 PolarHBondContact O-N 3.21Å; M48-T51 PolarHBondContact O-N 2.64Å; M48-G52 PolarHBondContact O-N 2.98Å; M48-I92 HydrophobicContact CE-CB 4.41Å; M48-I92 HydrophobicContact CE-CD1 3.09Å; M48-I92 HydrophobicContact CE-CG1 4.27Å; M48-I92 HydrophobicContact CE-CG2 3.8Å
49	A	89.1	Confident	89.2	Confident	32 Å²	32	73.1 Å²	73.1	26%	0.264	39%	0.394	S	S	.	.	H	α-helix	trans	-61.7	-44.6	174.7	0	0	0	0	0	111.5	C45 T46 T51 G52 I53 P66	C45-A49 WeakPolarHBondContact O-CB 3.19Å; C45-A49 PolarHBondContact O-N 3.4Å; T46-A49 PolarHBondContact O-N 3.04Å; A49-T51 VanDerWaalsContact C-N 3.34Å; A49-T51 PolarHBondContact O-N 3.22Å; A49-G52 PolarHBondContact O-N 2.91Å; A49-I53 WeakPolarHBondContact O-CD1 3.49Å; A49-I53 VanDerWaalsContact O-CG1 3.26Å; A49-I53 WeakPolarHBondContact O-CG1 3.43Å; A49-I53 PolarHBondContact O-N 3.5Å; A49-P66 HydrophobicContact CB-CB 3.71Å; A49-P66 HydrophobicContact CB-CG 3.65Å
50	C	89.3	Confident	88.3	Confident	11 Å²	11	78.8 Å²	78.8	7%	0.074	42%	0.418	C	S	.	.	H	α-helix	trans	-60.6	-44.7	176.3	-65.1	0	0	0	0	111.8	T46 W47 I53 A54 C63 F67	T46-C50 PolarHBondContact O-N 3.01Å; T46-C50 PolarHBondContact O-SG 3.19Å; W47-C50 PolarHBondContact O-N 3.01Å; C50-I53 PolarHBondContact O-N 3.05Å; C50-A54 WeakPolarHBondContact O-CB 3.32Å; C50-A54 PolarHBondContact O-N 2.96Å; C50-C63 WeakPolarHBondContact CB-O 3.26Å; C50-C63 PolarHBondContact SG-O 3.25Å; C50-F67 HydrophobicContact CB-CE2 4.11Å; C50-F67 HydrophobicContact CB-CZ 4.4Å; C50-F67 VanDerWaalsContact SG-CD2 3.52Å; C50-F67 WeakPolarHBondContact SG-CE2 3.4Å
51	T	90.1	Very high	87.4	Confident	77 Å²	77	76.6 Å²	76.6	47%	0.472	42%	0.42	S	S	.	.	H	α-helix	trans	-63.8	-46.1	179.2	-55.4	0	0	0	0	111	W47 M48 A49 I53 A54 L55	W47-T51 WeakPolarHBondContact O-CB 3.44Å; W47-T51 PolarHBondContact O-N 3.15Å; W47-T51 PolarHBondContact O-OG1 3.13Å; M48-T51 PolarHBondContact O-N 2.64Å; A49-T51 VanDerWaalsContact C-N 3.34Å; A49-T51 PolarHBondContact O-N 3.22Å; T51-I53 PolarHBondContact O-N 3.14Å; T51-A54 PolarHBondContact O-N 3.02Å; T51-L55 HydrophobicContact CG2-CD1 4.05Å; T51-L55 HydrophobicContact CG2-CG 4.37Å; T51-L55 WeakPolarHBondContact O-CB 3.32Å; T51-L55 VanDerWaalsContact O-CG 3.28Å; T51-L55 WeakPolarHBondContact O-CG 3.37Å; T51-L55 PolarHBondContact O-N 2.72Å
52	G	91.6	Very high	86.8	Confident	31 Å²	31	71.6 Å²	71.6	32%	0.32	41%	0.408	S	S	.	.	H	α-helix	trans	-58.8	-45.2	176.6	0	0	0	0	0	112.5	M48 A49 A54 L55 L56	M48-G52 PolarHBondContact O-N 2.98Å; A49-G52 PolarHBondContact O-N 2.91Å; G52-A54 PolarHBondContact O-N 3.16Å; G52-L55 PolarHBondContact O-N 3.08Å; G52-L56 VanDerWaalsContact O-CG 3.26Å; G52-L56 WeakPolarHBondContact O-CG 3.41Å; G52-L56 PolarHBondContact O-N 2.91Å; G52-L56 VanDerWaalsContact O-N 3.09Å
53	I	89.2	Confident	86.4	Confident	49 Å²	49	66.7 Å²	66.7	25%	0.251	39%	0.39	S	S	.	.	H	α-helix	trans	-64.4	-42.5	177.4	-64.4	164	0	0	0	111.2	A49 C50 T51 L55 L56 G58 C62 C63 P66	A49-I53 WeakPolarHBondContact O-CD1 3.49Å; A49-I53 VanDerWaalsContact O-CG1 3.26Å; A49-I53 WeakPolarHBondContact O-CG1 3.43Å; A49-I53 PolarHBondContact O-N 3.5Å; C50-I53 PolarHBondContact O-N 3.05Å; T51-I53 PolarHBondContact O-N 3.14Å; I53-L55 PolarHBondContact O-N 2.92Å; I53-L56 PolarHBondContact O-N 2.81Å; I53-G58 VanDerWaalsContact O-CA 3.29Å; I53-G58 WeakPolarHBondContact O-CA 3.38Å; I53-G58 PolarHBondContact O-N 3.17Å; I53-C62 HydrophobicContact CG2-CB 4.13Å; I53-C63 HydrophobicContact CG2-CB 4.26Å; I53-P66 HydrophobicContact CD1-CG 3.56Å
54	A	89.1	Confident	86	Confident	39 Å²	39	70.5 Å²	70.5	32%	0.322	41%	0.407	S	S	.	.	H	α-helix	trans	-62.2	-42.7	178	0	0	0	0	0	111.9	C50 T51 G52 L56 G57 C63	C50-A54 WeakPolarHBondContact O-CB 3.32Å; C50-A54 PolarHBondContact O-N 2.96Å; T51-A54 PolarHBondContact O-N 3.02Å; G52-A54 PolarHBondContact O-N 3.16Å; A54-L56 VanDerWaalsContact C-N 3.29Å; A54-L56 PolarHBondContact O-N 3.31Å; A54-G57 PolarHBondContact O-N 3.1Å; A54-C63 HydrophobicContact CB-CB 4.23Å
55	L	89.6	Confident	85.8	Confident	143 Å²	143	72.4 Å²	72.4	75%	0.749	41%	0.409	S	S	*	.	H	α-helix	trans	-64.7	-31.9	177.2	-71.8	175.4	0	0	0	112.9	T51 G52 I53 G57	T51-L55 HydrophobicContact CG2-CD1 4.05Å; T51-L55 HydrophobicContact CG2-CG 4.37Å; T51-L55 WeakPolarHBondContact O-CB 3.32Å; T51-L55 VanDerWaalsContact O-CG 3.28Å; T51-L55 WeakPolarHBondContact O-CG 3.37Å; T51-L55 PolarHBondContact O-N 2.72Å; G52-L55 PolarHBondContact O-N 3.08Å; I53-L55 PolarHBondContact O-N 2.92Å; L55-G57 PolarHBondContact O-N 3.08Å
56	L	89.6	Confident	85.6	Confident	158 Å²	158	71.5 Å²	71.5	83%	0.827	40%	0.403	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81	13.2	176.7	-64.7	173.5	0	0	0	113.4	G52 I53 A54	G52-L56 VanDerWaalsContact O-CG 3.26Å; G52-L56 WeakPolarHBondContact O-CG 3.41Å; G52-L56 PolarHBondContact O-N 2.91Å; G52-L56 VanDerWaalsContact O-N 3.09Å; I53-L56 PolarHBondContact O-N 2.81Å; A54-L56 VanDerWaalsContact C-N 3.29Å; A54-L56 PolarHBondContact O-N 3.31Å
57	G	84.3	Confident	85.4	Confident	53 Å²	53	73.2 Å²	73.2	55%	0.546	41%	0.411	S	S	.	.	T	Hydrogen-bonded Turn	trans	87	8.6	178	0	0	0	0	0	114.3	A54 L55 I59	A54-G57 PolarHBondContact O-N 3.1Å; L55-G57 PolarHBondContact O-N 3.08Å; G57-I59 PolarHBondContact O-N 3.18Å
58	G	80.6	Confident	85.1	Confident	10 Å²	10	74.6 Å²	74.6	10%	0.103	42%	0.417	C	S	.	.			trans	-77.8	50.7	-178.8	0	0	0	0	0	115.2	I53 C62 C63	I53-G58 VanDerWaalsContact O-CA 3.29Å; I53-G58 WeakPolarHBondContact O-CA 3.38Å; I53-G58 PolarHBondContact O-N 3.17Å; G58-C62 WeakPolarHBondContact CA-SG 3.42Å; G58-C62 PolarHBondContact O-SG 2.88Å; G58-C63 WeakPolarHBondContact O-CB 3.49Å; G58-C63 PolarHBondContact O-N 2.82Å; G58-C63 VanDerWaalsContact O-N 3.17Å
59	I	75.1	Confident	84.9	Confident	127 Å²	127	72.5 Å²	72.5	65%	0.651	41%	0.41	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.4	-18.9	-174.5	-68.1	169.8	0	0	0	112.5	G57 G61	G57-I59 PolarHBondContact O-N 3.18Å; I59-G61 PolarHBondContact O-N 3.17Å
60	F	77.7	Confident	84.7	Confident	213 Å²	213	74.3 Å²	74.3	93%	0.934	42%	0.415	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.5	39	178.8	-68.1	-76.5	0	0	0	114
61	G	75.8	Confident	84.5	Confident	35 Å²	35	77.3 Å²	77.3	36%	0.361	44%	0.437	S	S	.	.	T	Hydrogen-bonded Turn	trans	90.3	-10.9	175.4	0	0	0	0	0	115.4	I59 C63 L64	I59-G61 PolarHBondContact O-N 3.17Å; G61-C63 PolarHBondContact O-N 2.82Å; G61-L64 WeakPolarHBondContact O-CB 2.85Å; G61-L64 PolarHBondContact O-N 2.9Å
62	C	81.5	Confident	84.2	Confident	46 Å²	46	74.8 Å²	74.8	31%	0.311	42%	0.422	S	S	.	.	G	3₁₀ helix	trans	-67.9	-24.1	176	54.4	0	0	0	0	112.9	I53 G58 L64 I65	I53-C62 HydrophobicContact CG2-CB 4.13Å; G58-C62 WeakPolarHBondContact CA-SG 3.42Å; G58-C62 PolarHBondContact O-SG 2.88Å; C62-L64 PolarHBondContact O-N 2.9Å; C62-L64 VanDerWaalsContact O-N 3.15Å; C62-I65 HydrophobicContact CB-CD1 3.66Å; C62-I65 HydrophobicContact CB-CG1 4.47Å; C62-I65 WeakPolarHBondContact O-CB 3.31Å; C62-I65 WeakPolarHBondContact O-CG1 3.3Å; C62-I65 PolarHBondContact O-N 3.43Å; C62-I65 VanDerWaalsContact O-N 3.15Å
63	C	80.3	Confident	84.2	Confident	30 Å²	30	74.6 Å²	74.6	20%	0.203	41%	0.412	C	S	.	.	G	3₁₀ helix	trans	-61.1	-17.9	169.9	65.9	0	0	0	0	113.9	C50 I53 A54 G58 G61 P66	C50-C63 WeakPolarHBondContact CB-O 3.26Å; C50-C63 PolarHBondContact SG-O 3.25Å; I53-C63 HydrophobicContact CG2-CB 4.26Å; A54-C63 HydrophobicContact CB-CB 4.23Å; G58-C63 WeakPolarHBondContact O-CB 3.49Å; G58-C63 PolarHBondContact O-N 2.82Å; G58-C63 VanDerWaalsContact O-N 3.17Å; G61-C63 PolarHBondContact O-N 2.82Å; C63-P66 WeakPolarHBondContact O-CD 3.05Å
64	L	82	Confident	84.5	Confident	88 Å²	88	72.7 Å²	72.7	46%	0.461	40%	0.402	S	S	.	.	G	3₁₀ helix	trans	-88.1	-15.9	178	-62.6	177.1	0	0	0	113.4	G61 C62 P66 F67 Y68	G61-L64 WeakPolarHBondContact O-CB 2.85Å; G61-L64 PolarHBondContact O-N 2.9Å; C62-L64 PolarHBondContact O-N 2.9Å; C62-L64 VanDerWaalsContact O-N 3.15Å; L64-P66 VanDerWaalsContact C-CD 3.4Å; L64-P66 VanDerWaalsContact C-N 3.34Å; L64-F67 HydrophobicContact CD2-CD2 4.05Å; L64-F67 HydrophobicContact CD2-CE2 4.23Å; L64-F67 WeakPolarHBondContact O-CB 3.28Å; L64-F67 PolarHBondContact O-N 3.43Å; L64-Y68 HydrophobicContact CB-CE2 4.37Å; L64-Y68 VanDerWaalsContact O-CD2 3.32Å; L64-Y68 WeakPolarHBondContact O-CD2 3.4Å
65	I	86.2	Confident	84.8	Confident	93 Å²	93	70.8 Å²	70.8	48%	0.477	39%	0.387	S	S	.	.	H	α-helix	trans	-52.1	-44.5	-177.7	-63.2	168.5	0	0	0	112.3	C62 F67 Y68 V69	C62-I65 HydrophobicContact CB-CD1 3.66Å; C62-I65 HydrophobicContact CB-CG1 4.47Å; C62-I65 WeakPolarHBondContact O-CB 3.31Å; C62-I65 WeakPolarHBondContact O-CG1 3.3Å; C62-I65 PolarHBondContact O-N 3.43Å; C62-I65 VanDerWaalsContact O-N 3.15Å; I65-F67 PolarHBondContact O-N 2.78Å; I65-F67 VanDerWaalsContact O-N 3.1Å; I65-Y68 PolarHBondContact O-N 2.84Å; I65-V69 HydrophobicContact CG2-CG2 3.83Å; I65-V69 WeakPolarHBondContact O-CG2 3.03Å; I65-V69 PolarHBondContact O-N 3.34Å; I65-V69 VanDerWaalsContact O-N 3.13Å
66	P	84.3	Confident	85.1	Confident	5 Å²	5	66.4 Å²	66.4	3%	0.032	36%	0.361	C	S	.	.	H	α-helix	trans	-63.3	-20.7	-179	-20.5	33	0	0	0	114.2	A49 I53 C63 L64 Y68 C72	A49-P66 HydrophobicContact CB-CB 3.71Å; A49-P66 HydrophobicContact CB-CG 3.65Å; I53-P66 HydrophobicContact CD1-CG 3.56Å; C63-P66 WeakPolarHBondContact O-CD 3.05Å; L64-P66 VanDerWaalsContact C-CD 3.4Å; L64-P66 VanDerWaalsContact C-N 3.34Å; P66-Y68 VanDerWaalsContact C-N 3.33Å; P66-C72 HydrophobicContact CB-CB 4.14Å
67	F	86.1	Confident	85.4	Confident	36 Å²	36	58.9 Å²	58.9	16%	0.158	32%	0.321	C	S	.	.	H	α-helix	trans	-75.4	-22.5	174.9	-68.1	-67.1	0	0	0	113.3	K42 C50 L64 I65 K73	K42-F67 HydrophobicContact CD-CD1 3.64Å; K42-F67 HydrophobicContact CD-CE1 4.07Å; K42-F67 HydrophobicContact CG-CD1 4.08Å; C50-F67 HydrophobicContact CB-CE2 4.11Å; C50-F67 HydrophobicContact CB-CZ 4.4Å; C50-F67 VanDerWaalsContact SG-CD2 3.52Å; C50-F67 WeakPolarHBondContact SG-CE2 3.4Å; L64-F67 HydrophobicContact CD2-CD2 4.05Å; L64-F67 HydrophobicContact CD2-CE2 4.23Å; L64-F67 WeakPolarHBondContact O-CB 3.28Å; L64-F67 PolarHBondContact O-N 3.43Å; I65-F67 PolarHBondContact O-N 2.78Å; I65-F67 VanDerWaalsContact O-N 3.1Å; F67-K73 WeakPolarHBondContact O-CE 3.39Å; F67-K73 PolarHBondContact O-NZ 3.43Å
68	Y	84.8	Confident	85.9	Confident	186 Å²	186	57.1 Å²	57.1	73%	0.729	30%	0.301	S	S	*	.	H	α-helix	trans	-95.3	-27.8	178.7	-66.6	-83.9	0	0	0	111.7	L64 I65 P66 N70	L64-Y68 HydrophobicContact CB-CE2 4.37Å; L64-Y68 VanDerWaalsContact O-CD2 3.32Å; L64-Y68 WeakPolarHBondContact O-CD2 3.4Å; I65-Y68 PolarHBondContact O-N 2.84Å; P66-Y68 VanDerWaalsContact C-N 3.33Å; Y68-N70 PolarHBondContact O-N 3.44Å
69	V	87	Confident	86.6	Confident	60 Å²	60	56.8 Å²	56.8	36%	0.364	30%	0.297	S	S	.	.			trans	-82.7	119.5	-179.4	-175.8	0	0	0	0	111	I65 S71 C72	I65-V69 HydrophobicContact CG2-CG2 3.83Å; I65-V69 WeakPolarHBondContact O-CG2 3.03Å; I65-V69 PolarHBondContact O-N 3.34Å; I65-V69 VanDerWaalsContact O-N 3.13Å; V69-S71 PolarHBondContact O-N 2.91Å; V69-S71 VanDerWaalsContact O-N 3.17Å; V69-C72 PolarHBondContact O-N 3.44Å
70	N	84.3	Confident	87.5	Confident	70 Å²	70	53.4 Å²	53.4	37%	0.374	28%	0.283	S	S	.	.	G	3₁₀ helix	trans	-65.2	-17.5	177.1	-66.7	-20.7	0	0	0	112.8	Y40 Y68 C72 K73 R91	Y40-N70 HydrophobicContact CD1-CB 3.93Å; Y40-N70 HydrophobicContact CD2-CB 4.07Å; Y40-N70 HydrophobicContact CE1-CB 4.06Å; Y40-N70 HydrophobicContact CE2-CB 4.21Å; Y40-N70 HydrophobicContact CG-CB 3.92Å; Y68-N70 PolarHBondContact O-N 3.44Å; N70-C72 PolarHBondContact O-N 3.28Å; N70-C72 VanDerWaalsContact O-N 3.17Å; N70-K73 PolarHBondContact O-N 3.24Å; N70-K73 VanDerWaalsContact O-N 3.1Å; N70-K73 PolarHBondContact OD1-NZ 2.85Å; N70-K73 VanDerWaalsContact OD1-NZ 3.16Å; N70-R91 PolarHBondContact O-NE 3.17Å; N70-R91 PolarHBondContact O-NH2 2.93Å; N70-R91 VanDerWaalsContact O-NH2 3.08Å
71	S	84.5	Confident	88.3	Confident	75 Å²	75	50 Å²	50	52%	0.524	27%	0.27	S	S	.	.	G	3₁₀ helix	trans	-63.8	-10.9	172.7	-51.5	0	0	0	0	114.9	V69 R91	V69-S71 PolarHBondContact O-N 2.91Å; V69-S71 VanDerWaalsContact O-N 3.17Å; S71-R91 VanDerWaalsContact C-NE 3.32Å; S71-R91 VanDerWaalsContact C-NH1 3.3Å; S71-R91 VanDerWaalsContact CA-NH1 3.31Å; S71-R91 WeakPolarHBondContact O-CD 3.16Å; S71-R91 PolarHBondContact O-NE 3.35Å; S71-R91 VanDerWaalsContact O-NE 3.08Å; S71-R91 PolarHBondContact O-NH1 3.37Å
72	C	84.7	Confident	89.2	Confident	23 Å²	23	50.9 Å²	50.9	16%	0.155	27%	0.27	C	S	.	.	G	3₁₀ helix	trans	-109.5	-4.4	174.4	-59.7	0	0	0	0	112.6	C45 T46 P66 V69 N70	C45-C72 VanDerWaalsContact CB-O 3.3Å; C45-C72 WeakPolarHBondContact CB-O 3.23Å; T46-C72 VanDerWaalsContact CG2-C 3.45Å; T46-C72 HydrophobicContact CG2-CB 3.76Å; T46-C72 WeakPolarHBondContact CG2-O 3.33Å; T46-C72 PolarHBondContact N-O 3.47Å; T46-C72 VanDerWaalsContact N-O 3.14Å; P66-C72 HydrophobicContact CB-CB 4.14Å; V69-C72 PolarHBondContact O-N 3.44Å; N70-C72 PolarHBondContact O-N 3.28Å; N70-C72 VanDerWaalsContact O-N 3.17Å
73	K	92.2	Very high	89.9	Confident	28 Å²	28	51.1 Å²	51.1	12%	0.122	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.9	147.7	-175.4	-66.4	176.5	-164.5	163.1	0	111.5	Y40 R41 T46 F67 N70 R91	Y40-K73 HydrophobicContact CD1-CB 4.29Å; R41-K73 CarbonylContact O-C 3.56Å; R41-K73 WeakPolarHBondContact O-CA 3.47Å; R41-K73 VanDerWaalsContact O-CB 3.23Å; R41-K73 WeakPolarHBondContact O-CB 3.42Å; T46-K73 HydrophobicContact CG2-CB 4.46Å; T46-K73 HydrophobicContact CG2-CG 3.66Å; F67-K73 WeakPolarHBondContact O-CE 3.39Å; F67-K73 PolarHBondContact O-NZ 3.43Å; N70-K73 PolarHBondContact O-N 3.24Å; N70-K73 VanDerWaalsContact O-N 3.1Å; N70-K73 PolarHBondContact OD1-NZ 2.85Å; N70-K73 VanDerWaalsContact OD1-NZ 3.16Å; K73-R91 VanDerWaalsContact O-CD 3.31Å; K73-R91 WeakPolarHBondContact O-CD 3.34Å; K73-R91 PolarHBondContact O-NE 3.2Å
74	D	94.9	Very high	90.5	Very high	8 Å²	8	52.3 Å²	52.3	4%	0.043	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.4	144.1	172.7	-61.2	-26.8	0	0	0	109.7	Y40 R41 G43 Y76 Y89 K90 R91	Y40-D74 CarbonylContact C-O 3.57Å; Y40-D74 VanDerWaalsContact CA-O 3.28Å; Y40-D74 WeakPolarHBondContact CA-O 3.42Å; R41-D74 PolarHBondContact N-O 2.89Å; R41-D74 PolarHBondContact O-N 3.26Å; G43-D74 WeakPolarHBondContact CA-OD2 3.26Å; D74-Y76 HydrophobicContact CB-CD2 4.4Å; D74-Y76 HydrophobicContact CB-CE2 3.78Å; D74-Y89 WeakPolarHBondContact CA-O 3.35Å; D74-K90 WeakPolarHBondContact OD1-CA 3.41Å; D74-R91 PolarHBondContact OD1-N 2.88Å
75	A	94.5	Very high	91.1	Very high	0 Å²	0	52.5 Å²	52.5	0%	0	29%	0.288	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.4	116.7	-178.4	0	0	0	0	0	110.5	V38 Y40 V88 Y89	V38-A75 HydrophobicContact CG1-CB 3.49Å; V38-A75 VanDerWaalsContact CG1-CB 3.49Å; Y40-A75 HydrophobicContact CD1-CB 4.26Å; Y40-A75 HydrophobicContact CE1-CB 4.07Å; A75-V88 CarbonylContact O-C 3.54Å; A75-V88 WeakPolarHBondContact O-CA 3.38Å; A75-Y89 HydrophobicContact CB-CD1 4.38Å; A75-Y89 PolarHBondContact N-O 2.98Å; A75-Y89 PolarHBondContact O-N 2.86Å
76	Y	96.5	Very high	91.4	Very high	50 Å²	50	49.8 Å²	49.8	20%	0.196	27%	0.274	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	117.6	178.7	-71.3	-108.8	0	0	0	109.4	V38 H39 R41 D74 L85 V88	V38-Y76 CarbonylContact C-O 3.58Å; V38-Y76 WeakPolarHBondContact CA-O 3.46Å; H39-Y76 PolarHBondContact N-O 3.06Å; H39-Y76 WeakPolarHBondContact O-CB 3.44Å; H39-Y76 PolarHBondContact O-N 3.36Å; R41-Y76 HydrophobicContact CB-CD2 4Å; R41-Y76 HydrophobicContact CB-CE2 3.68Å; R41-Y76 HydrophobicContact CG-CD2 3.83Å; R41-Y76 HydrophobicContact CG-CE2 3.91Å; D74-Y76 HydrophobicContact CB-CD2 4.4Å; D74-Y76 HydrophobicContact CB-CE2 3.78Å; Y76-L85 HydrophobicContact CD1-CD1 3.92Å; Y76-L85 HydrophobicContact CD1-CD2 4.41Å; Y76-L85 HydrophobicContact CG-CD1 4.44Å; Y76-V88 HydrophobicContact CD1-CB 4.49Å; Y76-V88 HydrophobicContact CD1-CG1 4.12Å; Y76-V88 HydrophobicContact CD1-CG2 3.56Å; Y76-V88 HydrophobicContact CD2-CG1 4.22Å; Y76-V88 HydrophobicContact CE1-CG1 3.92Å; Y76-V88 HydrophobicContact CE1-CG2 3.72Å; Y76-V88 HydrophobicContact CE2-CG1 3.99Å; Y76-V88 HydrophobicContact CG-CG1 4.26Å; Y76-V88 HydrophobicContact CG-CG2 4.23Å
77	H	95.1	Very high	91.8	Very high	0 Å²	0	50.1 Å²	50.1	0%	0	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	117.2	-176.7	-67.3	-103.2	0	0	0	110.2	Y18 G19 Q21 T36 I37 V38 L85 L86 G87	Y18-H77 HydrophobicContact CD1-CB 3.74Å; Y18-H77 AromaticContact CD1-CD2 3.81Å; Y18-H77 AromaticContact CD1-CG 3.47Å; Y18-H77 VanDerWaalsContact CD1-CG 3.47Å; Y18-H77 AromaticContact CD1-ND1 3.71Å; Y18-H77 HydrophobicContact CE1-CB 3.96Å; G19-H77 PolarHBondContact O-CE1 3.48Å; G19-H77 PolarHBondContact O-NE2 3.48Å; Q21-H77 PolarHBondContact O-CE1 3.23Å; Q21-H77 VanDerWaalsContact O-CE1 3.28Å; T36-H77 HydrophobicContact CG2-CB 3.95Å; T36-H77 PolarHBondContact OG1-ND1 3.39Å; I37-H77 WeakPolarHBondContact O-CA 3.38Å; V38-H77 VanDerWaalsContact CG2-CE1 3.45Å; V38-H77 WeakPolarHBondContact CG2-CE1 3.34Å; H77-L85 WeakPolarHBondContact O-CD1 3.44Å; H77-L86 PolarHBondContact O-N 2.87Å; H77-G87 WeakPolarHBondContact CB-O 3.44Å; H77-G87 PolarHBondContact N-O 2.87Å; H77-G87 PolarHBondContact O-N 2.93Å
78	S	95.5	Very high	92.2	Very high	17 Å²	17	51.1 Å²	51.1	12%	0.119	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	149.5	178.9	-51.3	0	0	0	0	110.9	T36 I37 T84	T36-S78 WeakPolarHBondContact CA-O 3.43Å; I37-S78 PolarHBondContact N-O 3.32Å; I37-S78 PolarHBondContact O-N 3.45Å; S78-T84 CarbonylContact C-O 3.59Å; S78-T84 VanDerWaalsContact CA-O 3.3Å; S78-T84 WeakPolarHBondContact CA-O 3.45Å
79	C	94.9	Very high	92.6	Very high	3 Å²	3	45.6 Å²	45.6	2%	0.02	27%	0.265	C	S	.	.			trans	-67.4	129.5	172	-178.2	0	0	0	0	109.7	C27 E81 C82 G83 T84 L86	C27-C79 HydrophobicContact CB-CB 4.5Å; C79-E81 VanDerWaalsContact C-N 3.26Å; C79-E81 PolarHBondContact O-N 3.02Å; C79-C82 WeakPolarHBondContact CB-SG 3.49Å; C79-G83 WeakPolarHBondContact O-CA 3.41Å; C79-G83 PolarHBondContact O-N 2.77Å; C79-T84 PolarHBondContact N-O 3.05Å; C79-L86 HydrophobicContact CB-CD1 4.11Å; C79-L86 HydrophobicContact CB-CG 4.48Å
80	P	95.4	Very high	92.9	Very high	56 Å²	56	49.1 Å²	49.1	36%	0.364	28%	0.276	S	S	.	.	T	Hydrogen-bonded Turn	trans	-66.8	-27	177.4	26.4	-34	0	0	0	113.4	I34 I37	I34-P80 HydrophobicContact CB-CG 4.12Å; I34-P80 HydrophobicContact CG2-CG 4.34Å; I37-P80 HydrophobicContact CD1-CB 3.72Å; I37-P80 HydrophobicContact CG1-CB 4.03Å
81	E	94.2	Very high	93.1	Very high	141 Å²	141	49.1 Å²	49.1	66%	0.659	27%	0.27	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.2	-45.5	-175	-58.5	-60.8	137.8	0	0	112.4	I34 C79	I34-E81 HydrophobicContact CG2-CG 4.25Å; C79-E81 VanDerWaalsContact C-N 3.26Å; C79-E81 PolarHBondContact O-N 3.02Å
82	C	94.9	Very high	93.2	Very high	54 Å²	54	51.7 Å²	51.7	37%	0.365	28%	0.277	S	S	.	.	T	Hydrogen-bonded Turn	trans	-111.8	-10.6	-176.3	65.2	0	0	0	0	114.7	C30 C79 T84	C30-C82 VanDerWaalsContact SG-CB 3.58Å; C30-C82 PolarHBondContact SG-SG 2.96Å; C79-C82 WeakPolarHBondContact CB-SG 3.49Å; C82-T84 PolarHBondContact O-N 3.41Å; C82-T84 PolarHBondContact SG-OG1 2.98Å
83	G	94.7	Very high	93.6	Very high	50 Å²	50	53.1 Å²	53.1	52%	0.515	28%	0.283	S	S	.	.			trans	75.2	-1.6	-176.9	0	0	0	0	0	115.3	C79 L85	C79-G83 WeakPolarHBondContact O-CA 3.41Å; C79-G83 PolarHBondContact O-N 2.77Å; G83-L85 PolarHBondContact O-N 3.08Å
84	T	94.7	Very high	93.7	Very high	55 Å²	55	54.4 Å²	54.4	34%	0.337	29%	0.292	S	S	.	.			trans	-59.4	134.4	178.6	-59.5	0	0	0	0	111.1	I29 S78 C79 C82 L86	I29-T84 HydrophobicContact CG1-CG2 4.12Å; S78-T84 CarbonylContact C-O 3.59Å; S78-T84 VanDerWaalsContact CA-O 3.3Å; S78-T84 WeakPolarHBondContact CA-O 3.45Å; C79-T84 PolarHBondContact N-O 3.05Å; C82-T84 PolarHBondContact O-N 3.41Å; C82-T84 PolarHBondContact SG-OG1 2.98Å; T84-L86 PolarHBondContact O-N 3.41Å
85	L	94.2	Very high	93.7	Very high	93 Å²	93	57 Å²	57	49%	0.487	31%	0.305	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.2	120.4	173.5	-175.8	73.4	0	0	0	109.9	Y76 H77 G83 V88	Y76-L85 HydrophobicContact CD1-CD1 3.92Å; Y76-L85 HydrophobicContact CD1-CD2 4.41Å; Y76-L85 HydrophobicContact CG-CD1 4.44Å; H77-L85 WeakPolarHBondContact O-CD1 3.44Å; G83-L85 PolarHBondContact O-N 3.08Å; L85-V88 HydrophobicContact CD1-CG2 4.19Å; L85-V88 HydrophobicContact CD2-CG2 3.93Å; L85-V88 HydrophobicContact CG-CG2 4.39Å
86	L	92.6	Very high	93.6	Very high	36 Å²	36	60.4 Å²	60.4	19%	0.188	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	-28.6	-176.9	-61.5	175.4	0	0	0	112.5	Y18 C27 I34 T36 H77 C79 T84	Y18-L86 HydrophobicContact CE1-CB 4.21Å; Y18-L86 WeakPolarHBondContact CE2-O 3.47Å; Y18-L86 WeakPolarHBondContact OH-CB 3.3Å; Y18-L86 PolarHBondContact OH-O 3.07Å; C27-L86 HydrophobicContact CB-CD2 4.47Å; I34-L86 HydrophobicContact CD1-CD1 3.72Å; I34-L86 HydrophobicContact CG1-CD1 4.48Å; T36-L86 HydrophobicContact CG2-CD1 3.93Å; H77-L86 PolarHBondContact O-N 2.87Å; C79-L86 HydrophobicContact CB-CD1 4.11Å; C79-L86 HydrophobicContact CB-CG 4.48Å; T84-L86 PolarHBondContact O-N 3.41Å
87	G	92.3	Very high	93.4	Very high	12 Å²	12	61 Å²	61	12%	0.124	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-172.5	162.3	-179.4	0	0	0	0	0	113.2	H77	H77-G87 WeakPolarHBondContact CB-O 3.44Å; H77-G87 PolarHBondContact N-O 2.87Å; H77-G87 PolarHBondContact O-N 2.93Å
88	V	93.8	Very high	93.3	Very high	56 Å²	56	65.1 Å²	65.1	34%	0.339	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	123.2	176.2	-174.8	0	0	0	0	108.8	A75 Y76 L85 K90	A75-V88 CarbonylContact O-C 3.54Å; A75-V88 WeakPolarHBondContact O-CA 3.38Å; Y76-V88 HydrophobicContact CD1-CB 4.49Å; Y76-V88 HydrophobicContact CD1-CG1 4.12Å; Y76-V88 HydrophobicContact CD1-CG2 3.56Å; Y76-V88 HydrophobicContact CD2-CG1 4.22Å; Y76-V88 HydrophobicContact CE1-CG1 3.92Å; Y76-V88 HydrophobicContact CE1-CG2 3.72Å; Y76-V88 HydrophobicContact CE2-CG1 3.99Å; Y76-V88 HydrophobicContact CG-CG1 4.26Å; Y76-V88 HydrophobicContact CG-CG2 4.23Å; L85-V88 HydrophobicContact CD1-CG2 4.19Å; L85-V88 HydrophobicContact CD2-CG2 3.93Å; L85-V88 HydrophobicContact CG-CG2 4.39Å; V88-K90 HydrophobicContact CG1-CG 4.04Å
89	Y	94.4	Very high	93.2	Very high	70 Å²	70	68.5 Å²	68.5	28%	0.275	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.2	99.7	166.8	175.8	-105.8	0	0	0	108.6	Y18 G19 P20 D74 A75 R91	Y18-Y89 WeakPolarHBondContact O-CD2 3.44Å; G19-Y89 WeakPolarHBondContact O-CB 3.16Å; P20-Y89 HydrophobicContact CB-CD1 4.18Å; P20-Y89 HydrophobicContact CB-CE1 4.08Å; P20-Y89 HydrophobicContact CG-CE1 4.42Å; D74-Y89 WeakPolarHBondContact CA-O 3.35Å; A75-Y89 HydrophobicContact CB-CD1 4.38Å; A75-Y89 PolarHBondContact N-O 2.98Å; A75-Y89 PolarHBondContact O-N 2.86Å; Y89-R91 HydrophobicContact CD1-CG 4.47Å; Y89-R91 HydrophobicContact CE1-CG 3.96Å
90	K	93.2	Very high	93	Very high	135 Å²	135	73.5 Å²	73.5	59%	0.587	40%	0.397	S	S	*	.			trans	-79.3	135	169.7	-68.9	-171.3	174.3	-179.8	0	109.2	D74 V88 I92	D74-K90 WeakPolarHBondContact OD1-CA 3.41Å; V88-K90 HydrophobicContact CG1-CG 4.04Å; K90-I92 VanDerWaalsContact C-N 3.27Å; K90-I92 WeakPolarHBondContact CB-O 3.5Å
91	R	88.5	Confident	92.8	Very high	69 Å²	69	75 Å²	75	26%	0.26	40%	0.4	S	S	.	.			trans	-76.1	-21.4	176.8	-69.1	-167.7	-179.2	-107.9	-8.6	112.6	C45 N70 S71 K73 D74 Y89	C45-R91 HydrophobicContact CB-CB 3.91Å; N70-R91 PolarHBondContact O-NE 3.17Å; N70-R91 PolarHBondContact O-NH2 2.93Å; N70-R91 VanDerWaalsContact O-NH2 3.08Å; S71-R91 VanDerWaalsContact C-NE 3.32Å; S71-R91 VanDerWaalsContact C-NH1 3.3Å; S71-R91 VanDerWaalsContact CA-NH1 3.31Å; S71-R91 WeakPolarHBondContact O-CD 3.16Å; S71-R91 PolarHBondContact O-NE 3.35Å; S71-R91 VanDerWaalsContact O-NE 3.08Å; S71-R91 PolarHBondContact O-NH1 3.37Å; K73-R91 VanDerWaalsContact O-CD 3.31Å; K73-R91 WeakPolarHBondContact O-CD 3.34Å; K73-R91 PolarHBondContact O-NE 3.2Å; D74-R91 PolarHBondContact OD1-N 2.88Å; Y89-R91 HydrophobicContact CD1-CG 4.47Å; Y89-R91 HydrophobicContact CE1-CG 3.96Å
92	I	86.5	Confident	92.7	Very high	129 Å²	129	69 Å²	69	66%	0.662	38%	0.376	S	S	*	.			trans	-145.8	0	-179.5	-58.7	-179.1	0	0	0	108.9	C45 M48 K90	C45-I92 VanDerWaalsContact CA-CD1 3.44Å; C45-I92 HydrophobicContact CB-CB 4.45Å; C45-I92 HydrophobicContact CB-CD1 3.44Å; C45-I92 VanDerWaalsContact CB-CD1 3.44Å; C45-I92 HydrophobicContact CB-CG1 3.73Å; M48-I92 HydrophobicContact CE-CB 4.41Å; M48-I92 HydrophobicContact CE-CD1 3.09Å; M48-I92 HydrophobicContact CE-CG1 4.27Å; M48-I92 HydrophobicContact CE-CG2 3.8Å; K90-I92 VanDerWaalsContact C-N 3.27Å; K90-I92 WeakPolarHBondContact CB-O 3.5Å

Retrieved 92 of 92 residues in 57.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).