G4VSD2_SCHMA Loading...

DNA primase

AlphaFold DB , UniProt , Accession G4VSD2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 53 aa.

						>G4VSD2_SCHMA|G4VSD2
MENDSGQIGNAKKWGVKIVRDGLLLANPRWKCIAPPDEGFQPTETARFHQSYC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.9	Very low	59.5	Low	212 Å²	212	101.4 Å²	101.4	100%	1.044	59%	0.587	S	S	*	*				0	99.2	0	-73.4	175.4	-173.5	0	0	105.8	D21	M1-D21 VanDerWaalsContact CB-OD1 3.28Å; M1-D21 WeakPolarHBondContact CB-OD1 3.36Å; M1-D21 WeakPolarHBondContact CG-OD1 3.28Å
2	E	47.4	Very low	60.7	Low	151 Å²	151	101.3 Å²	101.3	71%	0.706	58%	0.575	S	S	*	*			trans	-91.1	121.4	-172	-169.9	166.8	-165.7	0	0	108.2
3	N	51.9	Low	61.9	Low	105 Å²	105	100.1 Å²	100.1	56%	0.561	56%	0.559	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-98.3	113.1	174.5	-70.9	-41.9	0	0	0	107.1	R20	N3-R20 WeakPolarHBondContact OD1-CG 3.49Å
4	D	63.6	Low	63.5	Low	91 Å²	91	94.4 Å²	94.4	49%	0.487	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.7	113.2	178.9	-81.6	-15.2	0	0	0	110.2	V19	D4-V19 HydrophobicContact CB-CB 4.3Å; D4-V19 PolarHBondContact N-O 2.88Å; D4-V19 VanDerWaalsContact N-O 3.16Å; D4-V19 PolarHBondContact O-N 2.84Å
5	S	65.6	Low	65	Low	107 Å²	107	88.3 Å²	88.3	75%	0.748	49%	0.491	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.3	121	163.4	56.4	0	0	0	0	109.2	K17	S5-K17 WeakPolarHBondContact CA-O 3.37Å
6	G	68.8	Low	66.4	Low	32 Å²	32	85.2 Å²	85.2	33%	0.33	48%	0.475	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	132.3	-174.8	0	0	0	0	0	112.2	V16 K17	G6-V16 WeakPolarHBondContact O-CA 3.35Å; G6-K17 PolarHBondContact N-O 3.22Å; G6-K17 VanDerWaalsContact N-O 3.12Å; G6-K17 PolarHBondContact O-N 2.87Å
7	Q	64.8	Low	67.8	Low	138 Å²	138	84.5 Å²	84.5	65%	0.645	47%	0.466	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.5	134.4	167	-65	-176	23.5	0	0	109.4	G15 V16	Q7-G15 WeakPolarHBondContact CA-O 3.48Å; Q7-V16 HydrophobicContact CG-CG2 4.36Å
8	I	61.6	Low	69	Low	73 Å²	73	84.2 Å²	84.2	37%	0.374	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.2	108.2	177.3	-60.3	170.1	0	0	0	108	W14 G15 K17	I8-W14 CarbonylContact O-C 3.51Å; I8-W14 WeakPolarHBondContact O-CA 3.45Å; I8-G15 PolarHBondContact N-O 3.19Å; I8-G15 PolarHBondContact O-N 3.28Å; I8-K17 HydrophobicContact CD1-CD 3.52Å; I8-K17 HydrophobicContact CD1-CG 4.03Å; I8-K17 VanDerWaalsContact CD1-NZ 3.3Å
9	G	53.2	Low	70.2	Confident	52 Å²	52	81.7 Å²	81.7	54%	0.536	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112	121.5	169.6	0	0	0	0	0	110.3	K13	G9-K13 CarbonylContact C-O 3.54Å; G9-K13 VanDerWaalsContact CA-O 3.32Å; G9-K13 WeakPolarHBondContact CA-O 3.38Å
10	N	66	Low	71.3	Confident	83 Å²	83	84.5 Å²	84.5	44%	0.444	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	171.3	160.7	75.5	12.6	0	0	0	109.1	K12 K13 H49	N10-K12 PolarHBondContact O-N 2.97Å; N10-K13 PolarHBondContact N-O 2.96Å; N10-K13 PolarHBondContact O-N 2.93Å; N10-K13 VanDerWaalsContact OD1-CB 3.28Å; N10-K13 WeakPolarHBondContact OD1-CB 3.41Å; N10-K13 WeakPolarHBondContact OD1-CG 3.4Å; N10-K13 PolarHBondContact OD1-N 2.83Å; N10-H49 PolarHBondContact O-CE1 3.16Å; N10-H49 PolarHBondContact O-NE2 3.32Å
11	A	69.1	Low	72.3	Confident	71 Å²	71	85.1 Å²	85.1	59%	0.587	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.7	-4.3	-166.9	0	0	0	0	0	116.8	T45	A11-T45 WeakPolarHBondContact O-CG2 3.37Å; A11-T45 PolarHBondContact O-OG1 3.42Å
12	K	74	Confident	74.7	Confident	100 Å²	100	78.5 Å²	78.5	44%	0.435	44%	0.443	S	S	.	.	T	Hydrogen-bonded Turn	trans	-141.5	1.7	178.1	-51.5	179.9	179.5	-163.8	0	113.5	N10 K31 C32 F40	N10-K12 PolarHBondContact O-N 2.97Å; K12-K31 CarbonylContact O-C 3.6Å; K12-K31 VanDerWaalsContact O-CA 3.31Å; K12-K31 WeakPolarHBondContact O-CA 3.2Å; K12-C32 PolarHBondContact O-N 3.35Å; K12-F40 HydrophobicContact CB-CD1 4.24Å; K12-F40 HydrophobicContact CB-CE1 3.96Å; K12-F40 HydrophobicContact CB-CZ 4.25Å; K12-F40 HydrophobicContact CD-CD1 4.15Å; K12-F40 HydrophobicContact CD-CD2 3.57Å; K12-F40 HydrophobicContact CD-CE1 3.97Å; K12-F40 HydrophobicContact CD-CE2 3.36Å; K12-F40 HydrophobicContact CD-CG 3.95Å; K12-F40 HydrophobicContact CD-CZ 3.57Å; K12-F40 HydrophobicContact CG-CD1 3.71Å; K12-F40 HydrophobicContact CG-CD2 3.98Å; K12-F40 HydrophobicContact CG-CE1 3.77Å; K12-F40 HydrophobicContact CG-CE2 4.04Å; K12-F40 HydrophobicContact CG-CG 3.8Å; K12-F40 HydrophobicContact CG-CZ 3.92Å
13	K	76.1	Confident	76.8	Confident	86 Å²	86	76.7 Å²	76.7	37%	0.374	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.3	138.1	-170.5	-53.5	-178	-177.2	169.5	0	111.4	G9 N10 W30 K31 H49	G9-K13 CarbonylContact C-O 3.54Å; G9-K13 VanDerWaalsContact CA-O 3.32Å; G9-K13 WeakPolarHBondContact CA-O 3.38Å; N10-K13 PolarHBondContact N-O 2.96Å; N10-K13 PolarHBondContact O-N 2.93Å; N10-K13 VanDerWaalsContact OD1-CB 3.28Å; N10-K13 WeakPolarHBondContact OD1-CB 3.41Å; N10-K13 WeakPolarHBondContact OD1-CG 3.4Å; N10-K13 PolarHBondContact OD1-N 2.83Å; K13-W30 VanDerWaalsContact CA-O 3.29Å; K13-W30 WeakPolarHBondContact CA-O 3.08Å; K13-K31 HydrophobicContact CG-CG 4.24Å; K13-H49 PolarHBondContact O-NE2 3.21Å
14	W	84	Confident	78.7	Confident	21 Å²	21	76.1 Å²	76.1	8%	0.08	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.5	147.8	168.7	-169	87.7	0	0	0	109.8	I8 V16 R29 W30 F48 Y52	I8-W14 CarbonylContact O-C 3.51Å; I8-W14 WeakPolarHBondContact O-CA 3.45Å; W14-V16 HydrophobicContact CH2-CG2 3.53Å; W14-V16 HydrophobicContact CZ2-CG2 3.97Å; W14-V16 HydrophobicContact CZ3-CG2 4.08Å; W14-R29 CarbonylContact O-C 3.56Å; W14-R29 VanDerWaalsContact O-CA 3.32Å; W14-R29 WeakPolarHBondContact O-CA 3.36Å; W14-W30 HydrophobicContact CE3-CD2 4.48Å; W14-W30 AromaticContact CE3-CE3 3.44Å; W14-W30 HydrophobicContact CE3-CE3 3.44Å; W14-W30 VanDerWaalsContact CE3-CE3 3.44Å; W14-W30 AromaticContact CE3-CZ3 3.48Å; W14-W30 HydrophobicContact CE3-CZ3 3.48Å; W14-W30 VanDerWaalsContact CE3-CZ3 3.48Å; W14-W30 AromaticContact CZ3-CE3 3.75Å; W14-W30 HydrophobicContact CZ3-CE3 3.75Å; W14-W30 AromaticContact CZ3-CH2 3.99Å; W14-W30 HydrophobicContact CZ3-CH2 3.99Å; W14-W30 AromaticContact CZ3-CZ3 3.26Å; W14-W30 HydrophobicContact CZ3-CZ3 3.26Å; W14-W30 PolarHBondContact N-O 2.83Å; W14-W30 PolarHBondContact O-N 3.03Å; W14-F48 HydrophobicContact CB-CE1 4.34Å; W14-Y52 HydrophobicContact CD2-CG 4.46Å; W14-Y52 HydrophobicContact CE3-CD2 4.4Å; W14-Y52 AromaticContact CE3-CG 3.91Å; W14-Y52 HydrophobicContact CE3-CG 3.91Å; W14-Y52 WeakPolarHBondContact CH2-O 3.4Å; W14-Y52 WeakPolarHBondContact CZ2-O 3.5Å; W14-Y52 VanDerWaalsContact CZ3-CB 3.4Å; W14-Y52 HydrophobicContact CZ3-CG 4.16Å
15	G	85.8	Confident	80.1	Confident	2 Å²	2	76 Å²	76	2%	0.021	43%	0.433	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-175.1	163.7	172.2	0	0	0	0	0	113.2	Q7 I8 P28	Q7-G15 WeakPolarHBondContact CA-O 3.48Å; I8-G15 PolarHBondContact N-O 3.19Å; I8-G15 PolarHBondContact O-N 3.28Å; G15-P28 WeakPolarHBondContact CA-O 3.31Å
16	V	87.1	Confident	81.3	Confident	39 Å²	39	72.5 Å²	72.5	24%	0.236	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	139.9	176	178.8	0	0	0	0	108.3	G6 Q7 W14 I18 N27 P28	G6-V16 WeakPolarHBondContact O-CA 3.35Å; Q7-V16 HydrophobicContact CG-CG2 4.36Å; W14-V16 HydrophobicContact CH2-CG2 3.53Å; W14-V16 HydrophobicContact CZ2-CG2 3.97Å; W14-V16 HydrophobicContact CZ3-CG2 4.08Å; V16-I18 HydrophobicContact CG1-CG1 4.4Å; V16-N27 WeakPolarHBondContact O-CA 3.15Å; V16-P28 HydrophobicContact CB-CG 4.49Å; V16-P28 PolarHBondContact N-O 2.95Å; V16-P28 WeakPolarHBondContact O-CD 3.46Å
17	K	90.5	Very high	82.4	Confident	74 Å²	74	73.4 Å²	73.4	32%	0.322	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	138.5	168.2	-70	-178.2	-179.8	168.3	0	110	S5 G6 I8 A26 N27	S5-K17 WeakPolarHBondContact CA-O 3.37Å; G6-K17 PolarHBondContact N-O 3.22Å; G6-K17 VanDerWaalsContact N-O 3.12Å; G6-K17 PolarHBondContact O-N 2.87Å; I8-K17 HydrophobicContact CD1-CD 3.52Å; I8-K17 HydrophobicContact CD1-CG 4.03Å; I8-K17 VanDerWaalsContact CD1-NZ 3.3Å; K17-A26 WeakPolarHBondContact CA-O 3.32Å; K17-N27 HydrophobicContact CG-CB 4.43Å; K17-N27 WeakPolarHBondContact CG-OD1 3.29Å
18	I	90.6	Very high	83.7	Confident	78 Å²	78	69.6 Å²	69.6	40%	0.4	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	116.6	170.5	-55.2	177.9	0	0	0	106.9	V16 L25 A26	V16-I18 HydrophobicContact CG1-CG1 4.4Å; I18-L25 HydrophobicContact CB-CB 4.35Å; I18-L25 HydrophobicContact CG2-CB 4.15Å; I18-L25 HydrophobicContact CG2-CD1 4.13Å; I18-L25 PolarHBondContact O-N 3.25Å; I18-A26 HydrophobicContact CB-CB 4.14Å; I18-A26 HydrophobicContact CD1-CB 4.06Å; I18-A26 HydrophobicContact CG1-CB 4.17Å; I18-A26 PolarHBondContact N-O 3.17Å; I18-A26 PolarHBondContact O-N 2.98Å
19	V	91.8	Very high	85	Confident	37 Å²	37	73.9 Å²	73.9	22%	0.224	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	133.8	176.1	-178.3	0	0	0	0	108.9	D4 L23 L24	D4-V19 HydrophobicContact CB-CB 4.3Å; D4-V19 PolarHBondContact N-O 2.88Å; D4-V19 VanDerWaalsContact N-O 3.16Å; D4-V19 PolarHBondContact O-N 2.84Å; V19-L23 WeakPolarHBondContact CA-O 3.32Å; V19-L24 HydrophobicContact CG2-CD1 3.94Å
20	R	91.2	Very high	86.7	Confident	137 Å²	137	76 Å²	76	52%	0.517	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.6	125.5	175.2	177.4	176.5	-63	171.9	1.9	108.9	N3 G22 L23 L25	N3-R20 WeakPolarHBondContact OD1-CG 3.49Å; R20-G22 PolarHBondContact O-N 3.05Å; R20-L23 PolarHBondContact N-O 3.12Å; R20-L23 WeakPolarHBondContact O-CA 3.4Å; R20-L23 WeakPolarHBondContact O-CB 3.12Å; R20-L23 PolarHBondContact O-N 2.82Å; R20-L25 HydrophobicContact CB-CD1 3.59Å; R20-L25 HydrophobicContact CB-CG 4.11Å
21	D	92.2	Very high	87.6	Confident	98 Å²	98	78.7 Å²	78.7	52%	0.524	41%	0.406	S	S	.	.	T	Hydrogen-bonded Turn	trans	53.5	38.2	178.4	-56.2	-45.5	0	0	0	112.9	M1 L23	M1-D21 VanDerWaalsContact CB-OD1 3.28Å; M1-D21 WeakPolarHBondContact CB-OD1 3.36Å; M1-D21 WeakPolarHBondContact CG-OD1 3.28Å; D21-L23 PolarHBondContact O-N 3.19Å
22	G	93.5	Very high	88.3	Confident	73 Å²	73	76.3 Å²	76.3	75%	0.753	39%	0.385	S	S	*	.	T	Hydrogen-bonded Turn	trans	75.6	-6.7	-176.3	0	0	0	0	0	115.1	R20	R20-G22 PolarHBondContact O-N 3.05Å
23	L	91.7	Very high	88.8	Confident	114 Å²	114	78.6 Å²	78.6	60%	0.597	40%	0.4	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.6	128.2	176	-174.5	66	0	0	0	111	V19 R20 D21 L25	V19-L23 WeakPolarHBondContact CA-O 3.32Å; R20-L23 PolarHBondContact N-O 3.12Å; R20-L23 WeakPolarHBondContact O-CA 3.4Å; R20-L23 WeakPolarHBondContact O-CB 3.12Å; R20-L23 PolarHBondContact O-N 2.82Å; D21-L23 PolarHBondContact O-N 3.19Å; L23-L25 HydrophobicContact CD2-CD2 3.91Å; L23-L25 HydrophobicContact CG-CD2 4.14Å; L23-L25 PolarHBondContact O-N 2.65Å
24	L	91.5	Very high	89.3	Confident	92 Å²	92	75.4 Å²	75.4	48%	0.482	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.3	110.2	171.9	-176.9	67.7	0	0	0	110	V19 A26 N27	V19-L24 HydrophobicContact CG2-CD1 3.94Å; L24-A26 WeakPolarHBondContact CD1-O 3.28Å; L24-N27 HydrophobicContact CD1-CB 4.23Å; L24-N27 HydrophobicContact CD2-CB 4.06Å; L24-N27 HydrophobicContact CG-CB 4.44Å
25	L	93.1	Very high	89.3	Confident	89 Å²	89	77.5 Å²	77.5	47%	0.466	41%	0.406	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.5	-37.4	179.9	-58.3	-175	0	0	0	112.5	I18 R20 L23	I18-L25 HydrophobicContact CB-CB 4.35Å; I18-L25 HydrophobicContact CG2-CB 4.15Å; I18-L25 HydrophobicContact CG2-CD1 4.13Å; I18-L25 PolarHBondContact O-N 3.25Å; R20-L25 HydrophobicContact CB-CD1 3.59Å; R20-L25 HydrophobicContact CB-CG 4.11Å; L23-L25 HydrophobicContact CD2-CD2 3.91Å; L23-L25 HydrophobicContact CG-CD2 4.14Å; L23-L25 PolarHBondContact O-N 2.65Å
26	A	91.4	Very high	89.4	Confident	33 Å²	33	82.7 Å²	82.7	27%	0.273	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.2	145.1	179.3	0	0	0	0	0	111.2	K17 I18 L24	K17-A26 WeakPolarHBondContact CA-O 3.32Å; I18-A26 HydrophobicContact CB-CB 4.14Å; I18-A26 HydrophobicContact CD1-CB 4.06Å; I18-A26 HydrophobicContact CG1-CB 4.17Å; I18-A26 PolarHBondContact N-O 3.17Å; I18-A26 PolarHBondContact O-N 2.98Å; L24-A26 WeakPolarHBondContact CD1-O 3.28Å
27	N	91.6	Very high	89.4	Confident	52 Å²	52	89.2 Å²	89.2	28%	0.278	47%	0.473	S	S	.	.			trans	-147.6	53.4	173.8	-174.4	24	0	0	0	111.4	V16 K17 L24 R29	V16-N27 WeakPolarHBondContact O-CA 3.15Å; K17-N27 HydrophobicContact CG-CB 4.43Å; K17-N27 WeakPolarHBondContact CG-OD1 3.29Å; L24-N27 HydrophobicContact CD1-CB 4.23Å; L24-N27 HydrophobicContact CD2-CB 4.06Å; L24-N27 HydrophobicContact CG-CB 4.44Å; N27-R29 PolarHBondContact O-N 3.33Å
28	P	91.5	Very high	89	Confident	58 Å²	58	91.7 Å²	91.7	38%	0.377	49%	0.486	S	S	.	.			trans	-60.5	133.6	173.2	28.2	-37.2	0	0	0	110.2	G15 V16 W30	G15-P28 WeakPolarHBondContact CA-O 3.31Å; V16-P28 HydrophobicContact CB-CG 4.49Å; V16-P28 PolarHBondContact N-O 2.95Å; V16-P28 WeakPolarHBondContact O-CD 3.46Å; P28-W30 HydrophobicContact CB-CH2 3.76Å; P28-W30 HydrophobicContact CB-CZ3 3.8Å; P28-W30 HydrophobicContact CG-CH2 4.36Å; P28-W30 HydrophobicContact CG-CZ3 4.32Å
29	R	89.1	Confident	88.6	Confident	162 Å²	162	89.9 Å²	89.9	61%	0.611	49%	0.487	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-140.7	137	179.3	-65.8	-169.8	-66.9	-163.1	-2.7	110.7	W14 N27	W14-R29 CarbonylContact O-C 3.56Å; W14-R29 VanDerWaalsContact O-CA 3.32Å; W14-R29 WeakPolarHBondContact O-CA 3.36Å; N27-R29 PolarHBondContact O-N 3.33Å
30	W	89.7	Confident	88.2	Confident	97 Å²	97	91.1 Å²	91.1	37%	0.367	49%	0.489	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	149.8	173.3	-61.1	-99	0	0	0	109.5	K13 W14 P28 F48 Y52	K13-W30 VanDerWaalsContact CA-O 3.29Å; K13-W30 WeakPolarHBondContact CA-O 3.08Å; W14-W30 HydrophobicContact CE3-CD2 4.48Å; W14-W30 AromaticContact CE3-CE3 3.44Å; W14-W30 HydrophobicContact CE3-CE3 3.44Å; W14-W30 VanDerWaalsContact CE3-CE3 3.44Å; W14-W30 AromaticContact CE3-CZ3 3.48Å; W14-W30 HydrophobicContact CE3-CZ3 3.48Å; W14-W30 VanDerWaalsContact CE3-CZ3 3.48Å; W14-W30 AromaticContact CZ3-CE3 3.75Å; W14-W30 HydrophobicContact CZ3-CE3 3.75Å; W14-W30 AromaticContact CZ3-CH2 3.99Å; W14-W30 HydrophobicContact CZ3-CH2 3.99Å; W14-W30 AromaticContact CZ3-CZ3 3.26Å; W14-W30 HydrophobicContact CZ3-CZ3 3.26Å; W14-W30 PolarHBondContact N-O 2.83Å; W14-W30 PolarHBondContact O-N 3.03Å; P28-W30 HydrophobicContact CB-CH2 3.76Å; P28-W30 HydrophobicContact CB-CZ3 3.8Å; P28-W30 HydrophobicContact CG-CH2 4.36Å; P28-W30 HydrophobicContact CG-CZ3 4.32Å; W30-F48 HydrophobicContact CB-CE1 4.36Å; W30-F48 HydrophobicContact CB-CZ 3.66Å; W30-Y52 HydrophobicContact CB-CE2 4.2Å; W30-Y52 AromaticContact CD1-CE1 3.66Å; W30-Y52 AromaticContact CD1-CZ 3.64Å; W30-Y52 HydrophobicContact CD2-CD1 4.06Å; W30-Y52 AromaticContact CD2-CE1 3.83Å; W30-Y52 HydrophobicContact CD2-CE1 3.83Å; W30-Y52 AromaticContact CE2-CD1 3.99Å; W30-Y52 AromaticContact CE2-CE1 3.64Å; W30-Y52 HydrophobicContact CE3-CD1 4.43Å; W30-Y52 HydrophobicContact CG-CD1 4.43Å; W30-Y52 AromaticContact CG-CE1 3.82Å; W30-Y52 HydrophobicContact CG-CE1 3.82Å; W30-Y52 HydrophobicContact CG-CE2 4.26Å; W30-Y52 AromaticContact CG-CZ 3.73Å; W30-Y52 HydrophobicContact CZ2-CD1 4.24Å; W30-Y52 HydrophobicContact CZ2-CE1 4.23Å; W30-Y52 AromaticContact NE1-CE1 3.55Å
31	K	85.2	Confident	88	Confident	139 Å²	139	89.2 Å²	89.2	60%	0.604	49%	0.486	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.6	131.3	175.1	-60.5	-178.1	-175	170.3	0	107.8	K12 K13 F48	K12-K31 CarbonylContact O-C 3.6Å; K12-K31 VanDerWaalsContact O-CA 3.31Å; K12-K31 WeakPolarHBondContact O-CA 3.2Å; K13-K31 HydrophobicContact CG-CG 4.24Å; K31-F48 WeakPolarHBondContact O-CZ 3.42Å
32	C	82.7	Confident	87.7	Confident	21 Å²	21	89.5 Å²	89.5	14%	0.142	49%	0.493	C	S	.	.			trans	-64.9	135.4	158.6	-171.9	0	0	0	0	106.5	K12 F40 F48	K12-C32 PolarHBondContact O-N 3.35Å; C32-F40 HydrophobicContact CB-CD1 4.18Å; C32-F40 HydrophobicContact CB-CE1 3.89Å; C32-F40 WeakPolarHBondContact O-CE1 3.01Å; C32-F48 HydrophobicContact CB-CD1 3.78Å; C32-F48 HydrophobicContact CB-CD2 4.47Å; C32-F48 HydrophobicContact CB-CE1 3.99Å; C32-F48 HydrophobicContact CB-CG 4.05Å; C32-F48 HydrophobicContact CB-CZ 4.38Å
33	I	85.2	Confident	87.5	Confident	148 Å²	148	90.3 Å²	90.3	76%	0.759	48%	0.484	S	S	*	.			trans	-121.6	109.1	175.8	-58.9	176.9	0	0	0	106.1
34	A	85.2	Confident	87.3	Confident	20 Å²	20	89.7 Å²	89.7	17%	0.165	48%	0.478	C	S	.	.	P	Polyproline II helix	trans	-77	152.1	170.1	0	0	0	0	0	110.1	G39 F40	A34-G39 WeakPolarHBondContact CB-O 3.24Å; A34-F40 HydrophobicContact CB-CD1 4.18Å; A34-F40 HydrophobicContact CB-CD2 4.12Å; A34-F40 HydrophobicContact CB-CE1 4.07Å; A34-F40 HydrophobicContact CB-CE2 4.02Å; A34-F40 HydrophobicContact CB-CG 4.23Å; A34-F40 HydrophobicContact CB-CZ 4.01Å
35	P	85.2	Confident	87	Confident	64 Å²	64	85.8 Å²	85.8	42%	0.416	46%	0.458	S	S	.	.	P	Polyproline II helix	trans	-54.2	153.9	166.9	-25.3	37	0	0	0	111.7	D37 E38	P35-D37 PolarHBondContact O-N 3.43Å; P35-E38 HydrophobicContact CB-CB 4.36Å; P35-E38 HydrophobicContact CB-CG 4.22Å; P35-E38 WeakPolarHBondContact CG-OE2 3.48Å; P35-E38 PolarHBondContact O-N 3.02Å
36	P	86.7	Confident	86.6	Confident	111 Å²	111	83.6 Å²	83.6	72%	0.721	45%	0.453	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.1	141.6	169.1	-23.8	34.2	0	0	0	110.6	E38	P36-E38 PolarHBondContact O-N 3.45Å
37	D	87.2	Confident	86.5	Confident	176 Å²	176	90 Å²	90	94%	0.941	47%	0.47	S	S	*	.	T	Hydrogen-bonded Turn	trans	65.3	-2.8	175	-50	-44.2	0	0	0	118	P35	P35-D37 PolarHBondContact O-N 3.43Å
38	E	82.7	Confident	86.2	Confident	127 Å²	127	89.3 Å²	89.3	59%	0.593	46%	0.464	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.6	-17.6	-179.1	-70.9	-177.4	-167.8	0	0	114.7	P35 P36	P35-E38 HydrophobicContact CB-CB 4.36Å; P35-E38 HydrophobicContact CB-CG 4.22Å; P35-E38 WeakPolarHBondContact CG-OE2 3.48Å; P35-E38 PolarHBondContact O-N 3.02Å; P36-E38 PolarHBondContact O-N 3.45Å
39	G	82.3	Confident	85.9	Confident	40 Å²	40	88.4 Å²	88.4	41%	0.412	46%	0.455	S	S	.	.			trans	63.3	-178.4	-175.2	0	0	0	0	0	113	A34	A34-G39 WeakPolarHBondContact CB-O 3.24Å
40	F	84.4	Confident	85.8	Confident	62 Å²	62	87 Å²	87	27%	0.272	46%	0.456	S	S	.	.			trans	-97.9	122.2	-176.8	-71.1	-98	0	0	0	109.9	K12 C32 A34	K12-F40 HydrophobicContact CB-CD1 4.24Å; K12-F40 HydrophobicContact CB-CE1 3.96Å; K12-F40 HydrophobicContact CB-CZ 4.25Å; K12-F40 HydrophobicContact CD-CD1 4.15Å; K12-F40 HydrophobicContact CD-CD2 3.57Å; K12-F40 HydrophobicContact CD-CE1 3.97Å; K12-F40 HydrophobicContact CD-CE2 3.36Å; K12-F40 HydrophobicContact CD-CG 3.95Å; K12-F40 HydrophobicContact CD-CZ 3.57Å; K12-F40 HydrophobicContact CG-CD1 3.71Å; K12-F40 HydrophobicContact CG-CD2 3.98Å; K12-F40 HydrophobicContact CG-CE1 3.77Å; K12-F40 HydrophobicContact CG-CE2 4.04Å; K12-F40 HydrophobicContact CG-CG 3.8Å; K12-F40 HydrophobicContact CG-CZ 3.92Å; C32-F40 HydrophobicContact CB-CD1 4.18Å; C32-F40 HydrophobicContact CB-CE1 3.89Å; C32-F40 WeakPolarHBondContact O-CE1 3.01Å; A34-F40 HydrophobicContact CB-CD1 4.18Å; A34-F40 HydrophobicContact CB-CD2 4.12Å; A34-F40 HydrophobicContact CB-CE1 4.07Å; A34-F40 HydrophobicContact CB-CE2 4.02Å; A34-F40 HydrophobicContact CB-CG 4.23Å; A34-F40 HydrophobicContact CB-CZ 4.01Å
41	Q	87.1	Confident	85.7	Confident	98 Å²	98	86.3 Å²	86.3	46%	0.458	47%	0.465	S	S	.	.			trans	-81.3	130.6	172.8	-57.7	-57.4	-41.7	0	0	109.9	T43 E44 T45	Q41-T43 VanDerWaalsContact C-N 3.26Å; Q41-T43 PolarHBondContact O-N 2.97Å; Q41-E44 HydrophobicContact CB-CB 4.13Å; Q41-E44 HydrophobicContact CB-CG 3.88Å; Q41-E44 WeakPolarHBondContact CB-OE2 3.49Å; Q41-E44 WeakPolarHBondContact CG-OE2 3.34Å; Q41-E44 PolarHBondContact O-N 2.85Å; Q41-T45 PolarHBondContact O-N 3Å; Q41-T45 PolarHBondContact O-OG1 3.34Å
42	P	86	Confident	85.5	Confident	103 Å²	103	83.8 Å²	83.8	67%	0.669	45%	0.452	S	S	*	.	H	α-helix	trans	-55.7	-40.3	179.4	-28.2	35.3	0	0	0	113.1	T45 A46	P42-T45 PolarHBondContact O-N 3.47Å; P42-A46 WeakPolarHBondContact O-CB 3.08Å; P42-A46 PolarHBondContact O-N 2.96Å
43	T	88.6	Confident	84.4	Confident	90 Å²	90	88.9 Å²	88.9	55%	0.552	49%	0.487	S	S	*	.	H	α-helix	trans	-65.7	-41.9	179.3	-52.6	0	0	0	0	112.3	Q41 A46 R47	Q41-T43 VanDerWaalsContact C-N 3.26Å; Q41-T43 PolarHBondContact O-N 2.97Å; T43-A46 PolarHBondContact O-N 3.42Å; T43-R47 WeakPolarHBondContact O-CG 3.4Å; T43-R47 PolarHBondContact O-N 3.28Å
44	E	86.5	Confident	84.4	Confident	102 Å²	102	86 Å²	86	48%	0.477	47%	0.473	S	S	.	.	H	α-helix	trans	-68.9	-41.6	178.2	-65.2	178.1	153.6	0	0	111.4	Q41 A46 R47 F48	Q41-E44 HydrophobicContact CB-CB 4.13Å; Q41-E44 HydrophobicContact CB-CG 3.88Å; Q41-E44 WeakPolarHBondContact CB-OE2 3.49Å; Q41-E44 WeakPolarHBondContact CG-OE2 3.34Å; Q41-E44 PolarHBondContact O-N 2.85Å; E44-A46 VanDerWaalsContact C-N 3.32Å; E44-A46 PolarHBondContact O-N 3.44Å; E44-R47 PolarHBondContact O-N 3.29Å; E44-F48 WeakPolarHBondContact O-CB 3.35Å; E44-F48 PolarHBondContact O-N 2.96Å
45	T	84.8	Confident	84.3	Confident	9 Å²	9	89.4 Å²	89.4	6%	0.055	49%	0.49	C	S	.	.	H	α-helix	trans	-60.6	-43.1	174.7	-56.8	0	0	0	0	110.9	A11 Q41 P42 F48 H49	A11-T45 WeakPolarHBondContact O-CG2 3.37Å; A11-T45 PolarHBondContact O-OG1 3.42Å; Q41-T45 PolarHBondContact O-N 3Å; Q41-T45 PolarHBondContact O-OG1 3.34Å; P42-T45 PolarHBondContact O-N 3.47Å; T45-F48 WeakPolarHBondContact O-CB 3.36Å; T45-F48 PolarHBondContact O-N 3.42Å; T45-H49 PolarHBondContact O-N 2.69Å
46	A	86.3	Confident	84.3	Confident	44 Å²	44	90.8 Å²	90.8	36%	0.364	49%	0.494	S	S	.	.	H	α-helix	trans	-63.2	-43.9	176.9	0	0	0	0	0	112	P42 T43 E44 H49 Q50	P42-A46 WeakPolarHBondContact O-CB 3.08Å; P42-A46 PolarHBondContact O-N 2.96Å; T43-A46 PolarHBondContact O-N 3.42Å; E44-A46 VanDerWaalsContact C-N 3.32Å; E44-A46 PolarHBondContact O-N 3.44Å; A46-H49 PolarHBondContact O-N 3.22Å; A46-Q50 WeakPolarHBondContact O-CG 3.46Å; A46-Q50 PolarHBondContact O-N 3.24Å
47	R	87.9	Confident	84.1	Confident	168 Å²	168	89.6 Å²	89.6	63%	0.634	48%	0.48	S	S	*	.	H	α-helix	trans	-62.2	-41.4	174.4	-73.2	175.7	-179.5	171.6	0.7	112.2	T43 E44 Q50 S51	T43-R47 WeakPolarHBondContact O-CG 3.4Å; T43-R47 PolarHBondContact O-N 3.28Å; E44-R47 PolarHBondContact O-N 3.29Å; R47-Q50 PolarHBondContact O-N 3.48Å; R47-S51 PolarHBondContact O-N 3.33Å
48	F	86.1	Confident	83.9	Confident	36 Å²	36	84.3 Å²	84.3	16%	0.158	45%	0.452	C	S	.	.	H	α-helix	trans	-59.6	-46.3	174.9	171.7	-96.8	0	0	0	111	W14 W30 K31 C32 E44 T45 Q50 S51 Y52	W14-F48 HydrophobicContact CB-CE1 4.34Å; W30-F48 HydrophobicContact CB-CE1 4.36Å; W30-F48 HydrophobicContact CB-CZ 3.66Å; K31-F48 WeakPolarHBondContact O-CZ 3.42Å; C32-F48 HydrophobicContact CB-CD1 3.78Å; C32-F48 HydrophobicContact CB-CD2 4.47Å; C32-F48 HydrophobicContact CB-CE1 3.99Å; C32-F48 HydrophobicContact CB-CG 4.05Å; C32-F48 HydrophobicContact CB-CZ 4.38Å; E44-F48 WeakPolarHBondContact O-CB 3.35Å; E44-F48 PolarHBondContact O-N 2.96Å; T45-F48 WeakPolarHBondContact O-CB 3.36Å; T45-F48 PolarHBondContact O-N 3.42Å; F48-Q50 VanDerWaalsContact C-N 3.34Å; F48-Q50 PolarHBondContact O-N 2.92Å; F48-S51 PolarHBondContact O-N 3.41Å; F48-S51 PolarHBondContact O-OG 3.2Å; F48-Y52 AromaticContact CD2-CE2 3.85Å; F48-Y52 HydrophobicContact CD2-CE2 3.85Å; F48-Y52 HydrophobicContact CE1-CE2 4.13Å; F48-Y52 HydrophobicContact CE2-CD2 4.49Å; F48-Y52 AromaticContact CE2-CE2 3.43Å; F48-Y52 HydrophobicContact CE2-CE2 3.43Å; F48-Y52 VanDerWaalsContact CE2-CE2 3.43Å; F48-Y52 HydrophobicContact CG-CE2 4.38Å; F48-Y52 HydrophobicContact CZ-CD2 4.4Å; F48-Y52 AromaticContact CZ-CE2 3.58Å; F48-Y52 HydrophobicContact CZ-CE2 3.58Å; F48-Y52 VanDerWaalsContact O-CD2 3.24Å; F48-Y52 WeakPolarHBondContact O-CD2 3.39Å
49	H	85.5	Confident	84	Confident	39 Å²	39	81.4 Å²	81.4	18%	0.181	44%	0.442	C	S	.	.	H	α-helix	trans	-60.9	-41	175.1	-65.9	167.4	0	0	0	112.6	N10 K13 T45 A46 S51 Y52	N10-H49 PolarHBondContact O-CE1 3.16Å; N10-H49 PolarHBondContact O-NE2 3.32Å; K13-H49 PolarHBondContact O-NE2 3.21Å; T45-H49 PolarHBondContact O-N 2.69Å; A46-H49 PolarHBondContact O-N 3.22Å; H49-S51 VanDerWaalsContact C-N 3.29Å; H49-S51 PolarHBondContact O-N 2.99Å; H49-Y52 PolarHBondContact O-N 3.33Å
50	Q	87.3	Confident	84.1	Confident	134 Å²	134	84.4 Å²	84.4	63%	0.626	44%	0.444	S	S	*	.	H	α-helix	trans	-66	-28.7	177.6	-72.4	170.7	-7.8	0	0	113.2	A46 R47 F48 Y52 C53	A46-Q50 WeakPolarHBondContact O-CG 3.46Å; A46-Q50 PolarHBondContact O-N 3.24Å; R47-Q50 PolarHBondContact O-N 3.48Å; F48-Q50 VanDerWaalsContact C-N 3.34Å; F48-Q50 PolarHBondContact O-N 2.92Å; Q50-Y52 PolarHBondContact O-N 3.03Å; Q50-C53 PolarHBondContact O-N 3.27Å
51	S	87.5	Confident	84.1	Confident	81 Å²	81	86.1 Å²	86.1	57%	0.566	46%	0.458	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.7	-11.7	178.2	69.2	0	0	0	0	114.9	R47 F48 H49	R47-S51 PolarHBondContact O-N 3.33Å; F48-S51 PolarHBondContact O-N 3.41Å; F48-S51 PolarHBondContact O-OG 3.2Å; H49-S51 VanDerWaalsContact C-N 3.29Å; H49-S51 PolarHBondContact O-N 2.99Å
52	Y	80	Confident	83.9	Confident	86 Å²	86	85.1 Å²	85.1	34%	0.337	46%	0.458	S	S	.	.	T	Hydrogen-bonded Turn	trans	-111.6	2.4	177.4	-62.3	-80.5	0	0	0	113.9	W14 W30 F48 H49 Q50	W14-Y52 HydrophobicContact CD2-CG 4.46Å; W14-Y52 HydrophobicContact CE3-CD2 4.4Å; W14-Y52 AromaticContact CE3-CG 3.91Å; W14-Y52 HydrophobicContact CE3-CG 3.91Å; W14-Y52 WeakPolarHBondContact CH2-O 3.4Å; W14-Y52 WeakPolarHBondContact CZ2-O 3.5Å; W14-Y52 VanDerWaalsContact CZ3-CB 3.4Å; W14-Y52 HydrophobicContact CZ3-CG 4.16Å; W30-Y52 HydrophobicContact CB-CE2 4.2Å; W30-Y52 AromaticContact CD1-CE1 3.66Å; W30-Y52 AromaticContact CD1-CZ 3.64Å; W30-Y52 HydrophobicContact CD2-CD1 4.06Å; W30-Y52 AromaticContact CD2-CE1 3.83Å; W30-Y52 HydrophobicContact CD2-CE1 3.83Å; W30-Y52 AromaticContact CE2-CD1 3.99Å; W30-Y52 AromaticContact CE2-CE1 3.64Å; W30-Y52 HydrophobicContact CE3-CD1 4.43Å; W30-Y52 HydrophobicContact CG-CD1 4.43Å; W30-Y52 AromaticContact CG-CE1 3.82Å; W30-Y52 HydrophobicContact CG-CE1 3.82Å; W30-Y52 HydrophobicContact CG-CE2 4.26Å; W30-Y52 AromaticContact CG-CZ 3.73Å; W30-Y52 HydrophobicContact CZ2-CD1 4.24Å; W30-Y52 HydrophobicContact CZ2-CE1 4.23Å; W30-Y52 AromaticContact NE1-CE1 3.55Å; F48-Y52 AromaticContact CD2-CE2 3.85Å; F48-Y52 HydrophobicContact CD2-CE2 3.85Å; F48-Y52 HydrophobicContact CE1-CE2 4.13Å; F48-Y52 HydrophobicContact CE2-CD2 4.49Å; F48-Y52 AromaticContact CE2-CE2 3.43Å; F48-Y52 HydrophobicContact CE2-CE2 3.43Å; F48-Y52 VanDerWaalsContact CE2-CE2 3.43Å; F48-Y52 HydrophobicContact CG-CE2 4.38Å; F48-Y52 HydrophobicContact CZ-CD2 4.4Å; F48-Y52 AromaticContact CZ-CE2 3.58Å; F48-Y52 HydrophobicContact CZ-CE2 3.58Å; F48-Y52 VanDerWaalsContact O-CD2 3.24Å; F48-Y52 WeakPolarHBondContact O-CD2 3.39Å; H49-Y52 PolarHBondContact O-N 3.33Å; Q50-Y52 PolarHBondContact O-N 3.03Å
53	C	60.2	Low	83.7	Confident	129 Å²	129	83.5 Å²	83.5	87%	0.872	44%	0.438	S	S	*	.			trans	-107.7	0	173.2	-76.3	0	0	0	0	110.6	Q50	Q50-C53 PolarHBondContact O-N 3.27Å

Retrieved 53 of 53 residues in 17.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).