G4VSR2_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession G4VSR2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 64 aa.

						>G4VSR2_SCHMA|G4VSR2
MYEDYALKIQSTMKISQRIIDWLSCSPDIISWGVIQAPDNSVITFLIAVLDIKGQNNYEGTSHF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.8	Low	51.7	Low	195 Å²	195	126.4 Å²	126.4	96%	0.961	61%	0.61	S	S	*	*				0	-53.3	0	-75.3	-165.9	-174.6	0	0	112.6	E3 Y5	M1-E3 PolarHBondContact O-N 2.95Å; M1-Y5 VanDerWaalsContact O-CD2 3.27Å; M1-Y5 WeakPolarHBondContact O-CD2 3.34Å
2	Y	52.5	Low	51.7	Low	214 Å²	214	122.7 Å²	122.7	84%	0.839	60%	0.601	S	S	*	*	H	α-helix	trans	-65.8	-33.1	179.1	-93.2	-86.9	0	0	0	114.6	D4 Y5 A6	Y2-D4 VanDerWaalsContact C-N 3.33Å; Y2-D4 PolarHBondContact O-N 3.07Å; Y2-Y5 PolarHBondContact O-N 3.5Å; Y2-A6 PolarHBondContact O-N 3.37Å
3	E	52.2	Low	51	Low	159 Å²	159	123.1 Å²	123.1	74%	0.743	60%	0.604	S	S	*	*	H	α-helix	trans	-64.1	-34.7	-179.1	-67.1	177.7	164.9	0	0	113.1	M1 Y5 A6 L7	M1-E3 PolarHBondContact O-N 2.95Å; E3-Y5 VanDerWaalsContact C-N 3.35Å; E3-Y5 PolarHBondContact O-N 3.32Å; E3-A6 PolarHBondContact O-N 3.37Å; E3-L7 WeakPolarHBondContact O-CG 3.21Å; E3-L7 PolarHBondContact O-N 2.63Å; E3-L7 VanDerWaalsContact O-N 3.13Å
4	D	57.2	Low	51.3	Low	98 Å²	98	125.1 Å²	125.1	52%	0.524	61%	0.607	S	S	.	*	H	α-helix	trans	-67	-35.1	178.3	-66.4	-45.4	0	0	0	112.5	Y2 K8	Y2-D4 VanDerWaalsContact C-N 3.33Å; Y2-D4 PolarHBondContact O-N 3.07Å; D4-K8 WeakPolarHBondContact O-CB 3.28Å; D4-K8 VanDerWaalsContact O-CG 3.31Å; D4-K8 WeakPolarHBondContact O-CG 3.4Å; D4-K8 PolarHBondContact O-N 2.87Å
5	Y	50	Low	51.6	Low	156 Å²	156	123.5 Å²	123.5	61%	0.612	60%	0.602	S	S	*	*	H	α-helix	trans	-69.8	-41.3	177.2	-72.3	-79.7	0	0	0	111.3	M1 Y2 E3 L7 K8 I9	M1-Y5 VanDerWaalsContact O-CD2 3.27Å; M1-Y5 WeakPolarHBondContact O-CD2 3.34Å; Y2-Y5 PolarHBondContact O-N 3.5Å; E3-Y5 VanDerWaalsContact C-N 3.35Å; E3-Y5 PolarHBondContact O-N 3.32Å; Y5-L7 VanDerWaalsContact C-N 3.34Å; Y5-L7 PolarHBondContact O-N 3Å; Y5-K8 PolarHBondContact O-N 2.88Å; Y5-I9 WeakPolarHBondContact O-CB 3.47Å; Y5-I9 VanDerWaalsContact O-CG1 3.24Å; Y5-I9 WeakPolarHBondContact O-CG1 2.77Å; Y5-I9 PolarHBondContact O-N 2.9Å
6	A	48.7	Very low	51.9	Low	52 Å²	52	119.3 Å²	119.3	43%	0.43	59%	0.589	S	S	.	*	H	α-helix	trans	-62.6	-41.4	177.4	0	0	0	0	0	111.7	Y2 E3 I9 Q10	Y2-A6 PolarHBondContact O-N 3.37Å; E3-A6 PolarHBondContact O-N 3.37Å; A6-I9 PolarHBondContact O-N 2.86Å; A6-Q10 WeakPolarHBondContact O-CB 3.39Å; A6-Q10 WeakPolarHBondContact O-CG 3.48Å; A6-Q10 PolarHBondContact O-N 3.24Å
7	L	52.9	Low	52	Low	106 Å²	106	118.1 Å²	118.1	56%	0.555	58%	0.581	S	S	*	*	H	α-helix	trans	-66.5	-41.3	176	-72.2	169.2	0	0	0	112.5	E3 Y5 Q10 S11	E3-L7 WeakPolarHBondContact O-CG 3.21Å; E3-L7 PolarHBondContact O-N 2.63Å; E3-L7 VanDerWaalsContact O-N 3.13Å; Y5-L7 VanDerWaalsContact C-N 3.34Å; Y5-L7 PolarHBondContact O-N 3Å; L7-Q10 PolarHBondContact O-N 2.93Å; L7-S11 WeakPolarHBondContact O-CB 3.27Å; L7-S11 PolarHBondContact O-N 2.83Å; L7-S11 PolarHBondContact O-OG 2.96Å
8	K	55.8	Low	52.4	Low	140 Å²	140	122.2 Å²	122.2	61%	0.609	59%	0.589	S	S	*	*	H	α-helix	trans	-63.2	-41	173.7	-76.1	177	-176.7	178.9	0	111.8	D4 Y5 S11 T12	D4-K8 WeakPolarHBondContact O-CB 3.28Å; D4-K8 VanDerWaalsContact O-CG 3.31Å; D4-K8 WeakPolarHBondContact O-CG 3.4Å; D4-K8 PolarHBondContact O-N 2.87Å; Y5-K8 PolarHBondContact O-N 2.88Å; K8-S11 WeakPolarHBondContact CA-OG 3.2Å; K8-S11 PolarHBondContact O-OG 3.4Å; K8-T12 VanDerWaalsContact O-CB 3.29Å; K8-T12 WeakPolarHBondContact O-CB 3.31Å; K8-T12 PolarHBondContact O-N 3.02Å; K8-T12 PolarHBondContact O-OG1 3.45Å
9	I	45.8	Very low	52.8	Low	103 Å²	103	120.2 Å²	120.2	53%	0.528	58%	0.581	S	S	.	*	H	α-helix	trans	-67.4	-46.9	176.7	-68	166	0	0	0	110.6	Y5 A6 S11 T12 M13	Y5-I9 WeakPolarHBondContact O-CB 3.47Å; Y5-I9 VanDerWaalsContact O-CG1 3.24Å; Y5-I9 WeakPolarHBondContact O-CG1 2.77Å; Y5-I9 PolarHBondContact O-N 2.9Å; A6-I9 PolarHBondContact O-N 2.86Å; I9-S11 PolarHBondContact O-N 2.78Å; I9-T12 PolarHBondContact O-N 3.42Å; I9-M13 HydrophobicContact CG2-CG 4.23Å; I9-M13 HydrophobicContact CG2-SD 3.97Å; I9-M13 WeakPolarHBondContact O-CB 3.41Å; I9-M13 VanDerWaalsContact O-CG 3.29Å; I9-M13 WeakPolarHBondContact O-CG 3.34Å; I9-M13 PolarHBondContact O-N 3.43Å
10	Q	47.2	Very low	53.1	Low	110 Å²	110	119 Å²	119	51%	0.514	58%	0.576	S	S	.	*	H	α-helix	trans	-62.1	-42.6	177.8	-77.9	-173.1	2.2	0	0	112.7	A6 L7 M13 K14	A6-Q10 WeakPolarHBondContact O-CB 3.39Å; A6-Q10 WeakPolarHBondContact O-CG 3.48Å; A6-Q10 PolarHBondContact O-N 3.24Å; L7-Q10 PolarHBondContact O-N 2.93Å; Q10-M13 PolarHBondContact O-N 3.21Å; Q10-K14 WeakPolarHBondContact O-CB 3.12Å; Q10-K14 VanDerWaalsContact O-CG 3.31Å; Q10-K14 WeakPolarHBondContact O-CG 3.37Å; Q10-K14 PolarHBondContact O-N 3.14Å
11	S	49.9	Very low	53.5	Low	57 Å²	57	117.1 Å²	117.1	40%	0.399	57%	0.569	S	S	.	*	H	α-helix	trans	-65.5	-41	176.5	51.6	0	0	0	0	111.6	L7 K8 I9 K14 I15	L7-S11 WeakPolarHBondContact O-CB 3.27Å; L7-S11 PolarHBondContact O-N 2.83Å; L7-S11 PolarHBondContact O-OG 2.96Å; K8-S11 WeakPolarHBondContact CA-OG 3.2Å; K8-S11 PolarHBondContact O-OG 3.4Å; I9-S11 PolarHBondContact O-N 2.78Å; S11-K14 PolarHBondContact O-N 2.76Å; S11-I15 WeakPolarHBondContact O-CD1 3.31Å; S11-I15 VanDerWaalsContact O-CG1 3.29Å; S11-I15 WeakPolarHBondContact O-CG1 3.39Å; S11-I15 PolarHBondContact O-N 3.03Å
12	T	51.1	Low	53.4	Low	82 Å²	82	112 Å²	112	50%	0.503	54%	0.54	S	S	.	.	H	α-helix	trans	-63.7	-44.6	174.2	-53.7	0	0	0	0	111.3	K8 I9 K14 I15 S16	K8-T12 VanDerWaalsContact O-CB 3.29Å; K8-T12 WeakPolarHBondContact O-CB 3.31Å; K8-T12 PolarHBondContact O-N 3.02Å; K8-T12 PolarHBondContact O-OG1 3.45Å; I9-T12 PolarHBondContact O-N 3.42Å; T12-K14 PolarHBondContact O-N 2.98Å; T12-I15 PolarHBondContact O-N 3.44Å; T12-S16 PolarHBondContact O-N 3.43Å; T12-S16 PolarHBondContact O-OG 2.76Å; T12-S16 VanDerWaalsContact O-OG 3.09Å
13	M	42.5	Very low	53.6	Low	128 Å²	128	104.5 Å²	104.5	63%	0.631	51%	0.513	S	S	*	.	H	α-helix	trans	-60.9	-42.2	175.9	-74.3	-178.3	78.2	0	0	112	I9 Q10 I15 S16 Q17	I9-M13 HydrophobicContact CG2-CG 4.23Å; I9-M13 HydrophobicContact CG2-SD 3.97Å; I9-M13 WeakPolarHBondContact O-CB 3.41Å; I9-M13 VanDerWaalsContact O-CG 3.29Å; I9-M13 WeakPolarHBondContact O-CG 3.34Å; I9-M13 PolarHBondContact O-N 3.43Å; Q10-M13 PolarHBondContact O-N 3.21Å; M13-I15 VanDerWaalsContact C-N 3.35Å; M13-I15 PolarHBondContact O-N 3.31Å; M13-S16 PolarHBondContact O-N 3.46Å; M13-Q17 WeakPolarHBondContact O-CB 3.27Å; M13-Q17 PolarHBondContact O-N 2.99Å
14	K	55.4	Low	54	Low	151 Å²	151	101.3 Å²	101.3	66%	0.657	51%	0.509	S	S	*	.	H	α-helix	trans	-63.3	-40	176.3	-75.8	179	-176.8	-177.3	0	112	Q10 S11 T12 R18	Q10-K14 WeakPolarHBondContact O-CB 3.12Å; Q10-K14 VanDerWaalsContact O-CG 3.31Å; Q10-K14 WeakPolarHBondContact O-CG 3.37Å; Q10-K14 PolarHBondContact O-N 3.14Å; S11-K14 PolarHBondContact O-N 2.76Å; T12-K14 PolarHBondContact O-N 2.98Å; K14-R18 VanDerWaalsContact O-CB 3.25Å; K14-R18 WeakPolarHBondContact O-CB 3.49Å; K14-R18 PolarHBondContact O-N 3.33Å
15	I	56.6	Low	54.1	Low	102 Å²	102	101.1 Å²	101.1	52%	0.523	51%	0.514	S	S	.	.	H	α-helix	trans	-66.9	-47	176.3	-67.9	162.5	0	0	0	110	S11 T12 M13 Q17 R18 I19	S11-I15 WeakPolarHBondContact O-CD1 3.31Å; S11-I15 VanDerWaalsContact O-CG1 3.29Å; S11-I15 WeakPolarHBondContact O-CG1 3.39Å; S11-I15 PolarHBondContact O-N 3.03Å; T12-I15 PolarHBondContact O-N 3.44Å; M13-I15 VanDerWaalsContact C-N 3.35Å; M13-I15 PolarHBondContact O-N 3.31Å; I15-Q17 PolarHBondContact O-N 3.24Å; I15-R18 PolarHBondContact O-N 3.45Å; I15-I19 HydrophobicContact CG2-CD1 3.66Å; I15-I19 HydrophobicContact CG2-CG1 4.3Å; I15-I19 VanDerWaalsContact O-CG1 3.27Å; I15-I19 WeakPolarHBondContact O-CG1 3.29Å; I15-I19 PolarHBondContact O-N 3.37Å
16	S	55.7	Low	54.5	Low	56 Å²	56	98.4 Å²	98.4	39%	0.392	52%	0.518	S	S	.	.	H	α-helix	trans	-60.7	-44.7	178.5	-61.3	0	0	0	0	112.2	T12 M13 I19 I20	T12-S16 PolarHBondContact O-N 3.43Å; T12-S16 PolarHBondContact O-OG 2.76Å; T12-S16 VanDerWaalsContact O-OG 3.09Å; M13-S16 PolarHBondContact O-N 3.46Å; S16-I19 PolarHBondContact O-N 2.92Å; S16-I20 VanDerWaalsContact O-CG1 3.26Å; S16-I20 WeakPolarHBondContact O-CG1 3.45Å; S16-I20 PolarHBondContact O-N 3.09Å
17	Q	52.9	Low	54.9	Low	99 Å²	99	97 Å²	97	46%	0.463	50%	0.504	S	S	.	.	H	α-helix	trans	-64.9	-42	176.7	-167.8	62.8	47	0	0	111.2	M13 I15 I19 I20 D21	M13-Q17 WeakPolarHBondContact O-CB 3.27Å; M13-Q17 PolarHBondContact O-N 2.99Å; I15-Q17 PolarHBondContact O-N 3.24Å; Q17-I19 VanDerWaalsContact C-N 3.33Å; Q17-I19 PolarHBondContact O-N 3.42Å; Q17-I20 PolarHBondContact O-N 3.29Å; Q17-I20 VanDerWaalsContact O-N 3.16Å; Q17-D21 PolarHBondContact NE2-OD1 3.5Å; Q17-D21 WeakPolarHBondContact O-CB 3.29Å; Q17-D21 PolarHBondContact O-N 3.01Å
18	R	59.1	Low	55.1	Low	191 Å²	191	97.3 Å²	97.3	72%	0.721	51%	0.506	S	S	*	.	H	α-helix	trans	-63.4	-38.5	176.3	-173.4	174.6	179.6	173.3	-0	112.2	K14 I15 W22	K14-R18 VanDerWaalsContact O-CB 3.25Å; K14-R18 WeakPolarHBondContact O-CB 3.49Å; K14-R18 PolarHBondContact O-N 3.33Å; I15-R18 PolarHBondContact O-N 3.45Å; R18-W22 WeakPolarHBondContact O-CB 3.29Å; R18-W22 PolarHBondContact O-N 2.96Å
19	I	60	Low	54.9	Low	84 Å²	84	95.7 Å²	95.7	43%	0.431	50%	0.503	S	S	.	.	H	α-helix	trans	-65.2	-41.8	173.9	-68.2	166.7	0	0	0	110	I15 S16 Q17 W22 L23	I15-I19 HydrophobicContact CG2-CD1 3.66Å; I15-I19 HydrophobicContact CG2-CG1 4.3Å; I15-I19 VanDerWaalsContact O-CG1 3.27Å; I15-I19 WeakPolarHBondContact O-CG1 3.29Å; I15-I19 PolarHBondContact O-N 3.37Å; S16-I19 PolarHBondContact O-N 2.92Å; Q17-I19 VanDerWaalsContact C-N 3.33Å; Q17-I19 PolarHBondContact O-N 3.42Å; I19-W22 PolarHBondContact O-N 2.79Å; I19-L23 HydrophobicContact CG2-CD1 3.85Å; I19-L23 HydrophobicContact CG2-CG 4.17Å; I19-L23 VanDerWaalsContact O-CB 3.31Å; I19-L23 WeakPolarHBondContact O-CB 3.25Å; I19-L23 WeakPolarHBondContact O-CG 3.24Å; I19-L23 PolarHBondContact O-N 2.88Å
20	I	59.5	Low	55.7	Low	96 Å²	96	95.1 Å²	95.1	49%	0.492	50%	0.501	S	S	.	.	H	α-helix	trans	-66	-51.9	178	-69.3	164.3	0	0	0	111.3	S16 Q17 W22 L23 S24	S16-I20 VanDerWaalsContact O-CG1 3.26Å; S16-I20 WeakPolarHBondContact O-CG1 3.45Å; S16-I20 PolarHBondContact O-N 3.09Å; Q17-I20 PolarHBondContact O-N 3.29Å; Q17-I20 VanDerWaalsContact O-N 3.16Å; I20-W22 PolarHBondContact O-N 2.66Å; I20-L23 PolarHBondContact O-N 2.87Å; I20-S24 WeakPolarHBondContact O-CB 3.46Å; I20-S24 PolarHBondContact O-N 3.37Å
21	D	61.8	Low	57	Low	81 Å²	81	93 Å²	93	43%	0.433	50%	0.498	S	S	.	.	H	α-helix	trans	-55.1	-43	176	-65.5	-13	0	0	0	109.4	Q17 S24 C25	Q17-D21 PolarHBondContact NE2-OD1 3.5Å; Q17-D21 WeakPolarHBondContact O-CB 3.29Å; Q17-D21 PolarHBondContact O-N 3.01Å; D21-S24 PolarHBondContact O-N 2.91Å; D21-S24 PolarHBondContact O-OG 3.3Å; D21-C25 PolarHBondContact O-N 3.16Å; D21-C25 PolarHBondContact O-SG 2.93Å
22	W	53.9	Low	58.5	Low	88 Å²	88	99.7 Å²	99.7	33%	0.333	51%	0.514	S	S	.	.	H	α-helix	trans	-69.5	-41.7	178.3	-174.9	71.9	0	0	0	113.7	R18 I19 I20 S24 C25 P27 A48 L50	R18-W22 WeakPolarHBondContact O-CB 3.29Å; R18-W22 PolarHBondContact O-N 2.96Å; I19-W22 PolarHBondContact O-N 2.79Å; I20-W22 PolarHBondContact O-N 2.66Å; W22-S24 PolarHBondContact O-N 3.46Å; W22-C25 WeakPolarHBondContact O-CB 3.41Å; W22-C25 PolarHBondContact O-N 3.38Å; W22-C25 VanDerWaalsContact O-N 3.1Å; W22-P27 HydrophobicContact CH2-CB 4.28Å; W22-A48 HydrophobicContact CH2-CB 4.33Å; W22-A48 HydrophobicContact CZ3-CB 4Å; W22-L50 HydrophobicContact CH2-CB 3.57Å; W22-L50 HydrophobicContact CH2-CD1 4.25Å; W22-L50 HydrophobicContact CH2-CG 4.27Å; W22-L50 HydrophobicContact CZ2-CB 3.46Å; W22-L50 VanDerWaalsContact CZ2-CB 3.46Å; W22-L50 HydrophobicContact CZ2-CD1 3.22Å; W22-L50 HydrophobicContact CZ2-CD2 4Å; W22-L50 HydrophobicContact CZ2-CG 3.65Å
23	L	58.3	Low	59.9	Low	55 Å²	55	96.5 Å²	96.5	29%	0.288	50%	0.498	S	S	.	.	H	α-helix	trans	-63.2	-30.7	172.5	-75.3	173.5	0	0	0	111.8	I19 I20 C25 P27 A48	I19-L23 HydrophobicContact CG2-CD1 3.85Å; I19-L23 HydrophobicContact CG2-CG 4.17Å; I19-L23 VanDerWaalsContact O-CB 3.31Å; I19-L23 WeakPolarHBondContact O-CB 3.25Å; I19-L23 WeakPolarHBondContact O-CG 3.24Å; I19-L23 PolarHBondContact O-N 2.88Å; I20-L23 PolarHBondContact O-N 2.87Å; L23-C25 PolarHBondContact O-N 3.1Å; L23-P27 HydrophobicContact CD2-CB 4.47Å; L23-P27 HydrophobicContact CD2-CG 4.05Å; L23-P27 WeakPolarHBondContact O-CD 3.49Å; L23-A48 HydrophobicContact CD2-CB 3.92Å
24	S	60	Low	62	Low	93 Å²	93	94.6 Å²	94.6	65%	0.65	49%	0.493	S	S	*	.	H	α-helix	trans	-71.9	-17.6	175.5	79.7	0	0	0	0	113.5	I20 D21 W22 S26	I20-S24 WeakPolarHBondContact O-CB 3.46Å; I20-S24 PolarHBondContact O-N 3.37Å; D21-S24 PolarHBondContact O-N 2.91Å; D21-S24 PolarHBondContact O-OG 3.3Å; W22-S24 PolarHBondContact O-N 3.46Å; S24-S26 VanDerWaalsContact C-N 3.33Å; S24-S26 PolarHBondContact O-N 3.43Å
25	C	59.4	Low	63.7	Low	94 Å²	94	91.6 Å²	91.6	64%	0.635	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.4	3.8	-178.7	-66.5	0	0	0	0	114.7	D21 W22 L23	D21-C25 PolarHBondContact O-N 3.16Å; D21-C25 PolarHBondContact O-SG 2.93Å; W22-C25 WeakPolarHBondContact O-CB 3.41Å; W22-C25 PolarHBondContact O-N 3.38Å; W22-C25 VanDerWaalsContact O-N 3.1Å; L23-C25 PolarHBondContact O-N 3.1Å
26	S	58.9	Low	65.4	Low	99 Å²	99	93.1 Å²	93.1	69%	0.692	49%	0.489	S	S	*	.			trans	84.7	81.9	-175.5	-40.8	0	0	0	0	114	S24 D28	S24-S26 VanDerWaalsContact C-N 3.33Å; S24-S26 PolarHBondContact O-N 3.43Å; S26-D28 PolarHBondContact O-N 3.32Å
27	P	56.9	Low	67	Low	22 Å²	22	91.2 Å²	91.2	14%	0.143	48%	0.476	C	S	.	.			trans	-62	131.4	165.7	27.6	-35.8	0	0	0	109.7	W22 L23 I29 I30 A48	W22-P27 HydrophobicContact CH2-CB 4.28Å; L23-P27 HydrophobicContact CD2-CB 4.47Å; L23-P27 HydrophobicContact CD2-CG 4.05Å; L23-P27 WeakPolarHBondContact O-CD 3.49Å; P27-I29 PolarHBondContact O-N 2.83Å; P27-I30 HydrophobicContact CB-CG1 4.09Å; P27-I30 HydrophobicContact CG-CD1 3.5Å; P27-I30 HydrophobicContact CG-CG1 3.42Å; P27-I30 VanDerWaalsContact CG-CG1 3.42Å; P27-A48 HydrophobicContact CB-CB 4.41Å
28	D	56.2	Low	68.8	Low	112 Å²	112	93.2 Å²	93.2	60%	0.599	50%	0.497	S	S	*	.	S	Bend	trans	-62.9	-29	-176.2	-69.4	-59.4	0	0	0	112.8	S26 D51	S26-D28 PolarHBondContact O-N 3.32Å; D28-D51 WeakPolarHBondContact OD2-CB 3.47Å
29	I	52.9	Low	70.6	Confident	106 Å²	106	89.5 Å²	89.5	54%	0.544	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144	122.1	175.4	-55.2	176.7	0	0	0	110.4	P27 V49	P27-I29 PolarHBondContact O-N 2.83Å; I29-V49 HydrophobicContact CB-CB 4.33Å; I29-V49 PolarHBondContact O-N 3.47Å
30	I	62.6	Low	72.1	Confident	92 Å²	92	91.3 Å²	91.3	47%	0.472	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	124.4	167.6	-54.7	178.6	0	0	0	108.2	P27 L46	P27-I30 HydrophobicContact CB-CG1 4.09Å; P27-I30 HydrophobicContact CG-CD1 3.5Å; P27-I30 HydrophobicContact CG-CG1 3.42Å; P27-I30 VanDerWaalsContact CG-CG1 3.42Å; I30-L46 HydrophobicContact CG2-CD1 3.41Å; I30-L46 VanDerWaalsContact CG2-CD1 3.41Å; I30-L46 HydrophobicContact CG2-CG 4.1Å
31	S	73.7	Confident	73.6	Confident	65 Å²	65	89.1 Å²	89.1	46%	0.455	50%	0.496	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120	142.3	167.9	-174.9	0	0	0	0	109.2	I47	S31-I47 PolarHBondContact N-O 3.13Å; S31-I47 PolarHBondContact O-N 3.48Å; S31-I47 VanDerWaalsContact O-O 3.13Å
32	W	80.7	Confident	74.8	Confident	197 Å²	197	89.9 Å²	89.9	75%	0.746	50%	0.503	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-113.8	146.6	168.3	65.4	74.3	0	0	0	109.7	F45 L46	W32-F45 CarbonylContact C-O 3.6Å; W32-F45 WeakPolarHBondContact CA-O 3.31Å; W32-L46 HydrophobicContact CB-CD1 4.26Å
33	G	81.6	Confident	76.4	Confident	15 Å²	15	89.6 Å²	89.6	16%	0.155	51%	0.507	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.8	152	175.2	0	0	0	0	0	110.8	T44 F45	G33-T44 WeakPolarHBondContact O-CA 3.47Å; G33-F45 PolarHBondContact N-O 3.24Å; G33-F45 PolarHBondContact O-N 2.91Å
34	V	86.4	Confident	77.6	Confident	89 Å²	89	91.7 Å²	91.7	54%	0.539	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127	124.2	174.8	-178.2	0	0	0	0	107.2	V42 I43 T44	V34-V42 HydrophobicContact CG1-CG1 3.32Å; V34-I43 WeakPolarHBondContact CA-O 2.96Å; V34-T44 HydrophobicContact CG2-CG2 4.33Å
35	I	90	Very high	78.7	Confident	88 Å²	88	91 Å²	91	45%	0.451	51%	0.508	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	138.9	171.8	57.4	175.9	0	0	0	109.1	I43 F45	I35-I43 HydrophobicContact CD1-CB 4.34Å; I35-I43 HydrophobicContact CD1-CD1 4.25Å; I35-I43 HydrophobicContact CG1-CB 3.78Å; I35-I43 HydrophobicContact CG1-CD1 4.4Å; I35-I43 HydrophobicContact CG1-CG2 4.38Å; I35-I43 PolarHBondContact N-O 2.77Å; I35-I43 PolarHBondContact O-N 3.46Å; I35-F45 HydrophobicContact CD1-CE1 4.46Å; I35-F45 HydrophobicContact CG1-CD1 4.47Å; I35-F45 HydrophobicContact CG1-CE1 4.22Å; I35-F45 HydrophobicContact CG2-CE1 3.88Å
36	Q	92.7	Very high	79.6	Confident	134 Å²	134	91.4 Å²	91.4	63%	0.626	50%	0.503	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.9	119.6	169.4	-169.9	164.3	2.7	0	0	108.1	N40 S41	Q36-N40 PolarHBondContact NE2-OD1 2.89Å; Q36-S41 WeakPolarHBondContact CA-O 3.48Å
37	A	89.1	Confident	80.3	Confident	16 Å²	16	90.8 Å²	90.8	13%	0.132	49%	0.491	C	S	.	.			trans	-72.1	160.1	174.8	0	0	0	0	0	110.4	D39 N40 S41 I43	A37-D39 WeakPolarHBondContact CB-OD1 3.38Å; A37-D39 PolarHBondContact O-N 3.38Å; A37-N40 PolarHBondContact O-N 3.19Å; A37-S41 WeakPolarHBondContact CB-OG 3.45Å; A37-S41 PolarHBondContact N-O 2.91Å; A37-I43 HydrophobicContact CB-CD1 4.12Å
38	P	92.5	Very high	80.9	Confident	140 Å²	140	91.5 Å²	91.5	91%	0.909	50%	0.499	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.7	-20.5	-178	-25	34.9	0	0	0	114.9	N40	P38-N40 VanDerWaalsContact C-N 3.26Å; P38-N40 PolarHBondContact O-N 3.35Å
39	D	95	Very high	81.3	Confident	113 Å²	113	89.9 Å²	89.9	60%	0.604	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.6	9.8	176.3	68.4	-17	0	0	0	113.4	A37 S41	A37-D39 WeakPolarHBondContact CB-OD1 3.38Å; A37-D39 PolarHBondContact O-N 3.38Å; D39-S41 PolarHBondContact O-N 2.63Å; D39-S41 VanDerWaalsContact OD1-CB 3.28Å; D39-S41 WeakPolarHBondContact OD1-CB 3.26Å; D39-S41 PolarHBondContact OD1-N 3.31Å; D39-S41 PolarHBondContact OD1-OG 2.86Å; D39-S41 PolarHBondContact OD2-OG 2.84Å
40	N	91.4	Very high	81.5	Confident	122 Å²	122	88.9 Å²	88.9	65%	0.652	49%	0.488	S	S	*	.	S	Bend	trans	67	8.5	-171.8	-56.9	-55	0	0	0	115.6	Q36 A37 P38	Q36-N40 PolarHBondContact NE2-OD1 2.89Å; A37-N40 PolarHBondContact O-N 3.19Å; P38-N40 VanDerWaalsContact C-N 3.26Å; P38-N40 PolarHBondContact O-N 3.35Å
41	S	92.2	Very high	81.3	Confident	50 Å²	50	88.2 Å²	88.2	35%	0.35	49%	0.486	S	S	.	.			trans	-71.4	150.6	170.1	68.6	0	0	0	0	111.1	Q36 A37 D39	Q36-S41 WeakPolarHBondContact CA-O 3.48Å; A37-S41 WeakPolarHBondContact CB-OG 3.45Å; A37-S41 PolarHBondContact N-O 2.91Å; D39-S41 PolarHBondContact O-N 2.63Å; D39-S41 VanDerWaalsContact OD1-CB 3.28Å; D39-S41 WeakPolarHBondContact OD1-CB 3.26Å; D39-S41 PolarHBondContact OD1-N 3.31Å; D39-S41 PolarHBondContact OD1-OG 2.86Å; D39-S41 PolarHBondContact OD2-OG 2.84Å
42	V	86.9	Confident	80.5	Confident	98 Å²	98	89.3 Å²	89.3	59%	0.594	49%	0.486	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.4	117.3	-179.3	179.7	0	0	0	0	108.9	V34	V34-V42 HydrophobicContact CG1-CG1 3.32Å
43	I	88	Confident	79.1	Confident	81 Å²	81	88.1 Å²	88.1	42%	0.415	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	116.9	176	-54	170.6	0	0	0	108.3	V34 I35 A37	V34-I43 WeakPolarHBondContact CA-O 2.96Å; I35-I43 HydrophobicContact CD1-CB 4.34Å; I35-I43 HydrophobicContact CD1-CD1 4.25Å; I35-I43 HydrophobicContact CG1-CB 3.78Å; I35-I43 HydrophobicContact CG1-CD1 4.4Å; I35-I43 HydrophobicContact CG1-CG2 4.38Å; I35-I43 PolarHBondContact N-O 2.77Å; I35-I43 PolarHBondContact O-N 3.46Å; A37-I43 HydrophobicContact CB-CD1 4.12Å
44	T	83.8	Confident	77.6	Confident	99 Å²	99	90.5 Å²	90.5	61%	0.607	51%	0.51	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.4	128.7	171.8	-54.9	0	0	0	0	108.9	G33 V34	G33-T44 WeakPolarHBondContact O-CA 3.47Å; V34-T44 HydrophobicContact CG2-CG2 4.33Å
45	F	81.1	Confident	75.9	Confident	80 Å²	80	92.8 Å²	92.8	35%	0.351	52%	0.515	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.5	150.3	175.9	59.7	-92.4	0	0	0	111.2	W32 G33 I35 I47	W32-F45 CarbonylContact C-O 3.6Å; W32-F45 WeakPolarHBondContact CA-O 3.31Å; G33-F45 PolarHBondContact N-O 3.24Å; G33-F45 PolarHBondContact O-N 2.91Å; I35-F45 HydrophobicContact CD1-CE1 4.46Å; I35-F45 HydrophobicContact CG1-CD1 4.47Å; I35-F45 HydrophobicContact CG1-CE1 4.22Å; I35-F45 HydrophobicContact CG2-CE1 3.88Å; F45-I47 HydrophobicContact CD2-CD1 4.08Å; F45-I47 HydrophobicContact CD2-CG1 3.84Å; F45-I47 HydrophobicContact CE2-CD1 3.7Å; F45-I47 HydrophobicContact CE2-CG1 3.98Å
46	L	78.8	Confident	73.8	Confident	102 Å²	102	96.1 Å²	96.1	53%	0.534	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.6	125.6	177.1	-169.6	76	0	0	0	108.4	I30 W32	I30-L46 HydrophobicContact CG2-CD1 3.41Å; I30-L46 VanDerWaalsContact CG2-CD1 3.41Å; I30-L46 HydrophobicContact CG2-CG 4.1Å; W32-L46 HydrophobicContact CB-CD1 4.26Å
47	I	73.7	Confident	71.5	Confident	85 Å²	85	96.8 Å²	96.8	44%	0.436	54%	0.542	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	113.2	171	-56	178.3	0	0	0	107.3	S31 F45 V49	S31-I47 PolarHBondContact N-O 3.13Å; S31-I47 PolarHBondContact O-N 3.48Å; S31-I47 VanDerWaalsContact O-O 3.13Å; F45-I47 HydrophobicContact CD2-CD1 4.08Å; F45-I47 HydrophobicContact CD2-CG1 3.84Å; F45-I47 HydrophobicContact CE2-CD1 3.7Å; F45-I47 HydrophobicContact CE2-CG1 3.98Å; I47-V49 HydrophobicContact CG2-CG2 4.32Å
48	A	70.2	Confident	69.5	Low	37 Å²	37	105.7 Å²	105.7	31%	0.306	57%	0.573	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.4	125.4	164.9	0	0	0	0	0	108.3	W22 L23 P27	W22-A48 HydrophobicContact CH2-CB 4.33Å; W22-A48 HydrophobicContact CZ3-CB 4Å; L23-A48 HydrophobicContact CD2-CB 3.92Å; P27-A48 HydrophobicContact CB-CB 4.41Å
49	V	63.2	Low	67.1	Low	78 Å²	78	107.2 Å²	107.2	47%	0.473	57%	0.568	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-94.4	120.3	170.8	-177.8	0	0	0	0	107.9	I29 I47	I29-V49 HydrophobicContact CB-CB 4.33Å; I29-V49 PolarHBondContact O-N 3.47Å; I47-V49 HydrophobicContact CG2-CG2 4.32Å
50	L	58.5	Low	64.6	Low	85 Å²	85	105 Å²	105	45%	0.445	57%	0.573	S	S	.	*	P	Polyproline II helix	trans	-88.5	117.6	173.3	169.4	56.8	0	0	0	108.8	W22 I52	W22-L50 HydrophobicContact CH2-CB 3.57Å; W22-L50 HydrophobicContact CH2-CD1 4.25Å; W22-L50 HydrophobicContact CH2-CG 4.27Å; W22-L50 HydrophobicContact CZ2-CB 3.46Å; W22-L50 VanDerWaalsContact CZ2-CB 3.46Å; W22-L50 HydrophobicContact CZ2-CD1 3.22Å; W22-L50 HydrophobicContact CZ2-CD2 4Å; W22-L50 HydrophobicContact CZ2-CG 3.65Å; L50-I52 HydrophobicContact CD1-CG1 4.15Å; L50-I52 HydrophobicContact CD2-CD1 3.79Å; L50-I52 HydrophobicContact CD2-CG1 3.52Å; L50-I52 HydrophobicContact CG-CD1 4.25Å; L50-I52 HydrophobicContact CG-CG1 3.47Å; L50-I52 VanDerWaalsContact CG-CG1 3.47Å; L50-I52 PolarHBondContact O-N 3.34Å
51	D	57	Low	62.2	Low	79 Å²	79	104.8 Å²	104.8	42%	0.422	58%	0.576	S	S	.	*			trans	-82.8	102.8	163	-167.3	-8.6	0	0	0	108.7	D28 K53	D28-D51 WeakPolarHBondContact OD2-CB 3.47Å; D51-K53 PolarHBondContact O-N 3.36Å; D51-K53 WeakPolarHBondContact OD1-CG 3.42Å; D51-K53 WeakPolarHBondContact OD2-CE 3.45Å; D51-K53 IonicContact OD2-NZ 3.63Å
52	I	58.4	Low	59.8	Low	88 Å²	88	106.8 Å²	106.8	45%	0.451	59%	0.59	S	S	.	*			trans	-82.2	74.4	175.4	-50.3	-179	0	0	0	108.6	L50 G54 Q55	L50-I52 HydrophobicContact CD1-CG1 4.15Å; L50-I52 HydrophobicContact CD2-CD1 3.79Å; L50-I52 HydrophobicContact CD2-CG1 3.52Å; L50-I52 HydrophobicContact CG-CD1 4.25Å; L50-I52 HydrophobicContact CG-CG1 3.47Å; L50-I52 VanDerWaalsContact CG-CG1 3.47Å; L50-I52 PolarHBondContact O-N 3.34Å; I52-G54 PolarHBondContact O-N 3.4Å; I52-G54 VanDerWaalsContact O-N 3.14Å; I52-Q55 HydrophobicContact CG2-CB 3.93Å; I52-Q55 HydrophobicContact CG2-CG 3.47Å; I52-Q55 VanDerWaalsContact CG2-CG 3.47Å
53	K	50.4	Low	57.2	Low	172 Å²	172	110.7 Å²	110.7	75%	0.748	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72	106.4	167.9	-62.7	-172.7	-169.7	173.4	0	108.9	D51	D51-K53 PolarHBondContact O-N 3.36Å; D51-K53 WeakPolarHBondContact OD1-CG 3.42Å; D51-K53 WeakPolarHBondContact OD2-CE 3.45Å; D51-K53 IonicContact OD2-NZ 3.63Å
54	G	50.2	Low	55	Low	65 Å²	65	119.5 Å²	119.5	67%	0.67	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	107	35.1	160.8	0	0	0	0	0	118.1	I52 N56	I52-G54 PolarHBondContact O-N 3.4Å; I52-G54 VanDerWaalsContact O-N 3.14Å; G54-N56 PolarHBondContact O-N 2.85Å
55	Q	50.3	Low	53.6	Low	136 Å²	136	120.5 Å²	120.5	64%	0.636	64%	0.638	S	S	*	*	G	3₁₀ helix	trans	-71	30.9	171.7	-103.8	-171.8	35.2	0	0	115.5	I52 N57	I52-Q55 HydrophobicContact CG2-CB 3.93Å; I52-Q55 HydrophobicContact CG2-CG 3.47Å; I52-Q55 VanDerWaalsContact CG2-CG 3.47Å; Q55-N57 VanDerWaalsContact C-N 3.32Å
56	N	47.3	Very low	52.1	Low	158 Å²	158	122.6 Å²	122.6	85%	0.845	65%	0.653	S	S	*	*	G	3₁₀ helix	trans	-84.2	0.5	173	-80.8	-16.2	0	0	0	114.2	G54	G54-N56 PolarHBondContact O-N 2.85Å
57	N	44.4	Very low	50.7	Low	148 Å²	148	123.8 Å²	123.8	79%	0.791	66%	0.66	S	S	*	*	G	3₁₀ helix	trans	-122.5	32.1	-178.9	-74.3	2.2	0	0	0	114.1	Q55 E59	Q55-N57 VanDerWaalsContact C-N 3.32Å; N57-E59 PolarHBondContact O-N 3.19Å
58	Y	46.3	Very low	49.3	Very low	203 Å²	203	126.1 Å²	126.1	80%	0.796	67%	0.673	S	S	*	*			trans	-84.4	77.4	157.8	-127.3	-97.4	0	0	0	107.6	G60	Y58-G60 VanDerWaalsContact C-N 3.29Å; Y58-G60 PolarHBondContact O-N 2.97Å
59	E	42.7	Very low	48	Very low	172 Å²	172	131.6 Å²	131.6	80%	0.804	70%	0.696	S	S	*	*			trans	-57.4	103	160.2	-75.7	-174.7	163.5	0	0	106.4	N57 T61	N57-E59 PolarHBondContact O-N 3.19Å; E59-T61 VanDerWaalsContact C-N 3.27Å; E59-T61 PolarHBondContact O-N 2.9Å
60	G	42.8	Very low	47	Very low	68 Å²	68	135.2 Å²	135.2	70%	0.701	71%	0.711	S	S	*	*			trans	-65.1	89.5	174.7	0	0	0	0	0	109.3	Y58 S62	Y58-G60 VanDerWaalsContact C-N 3.29Å; Y58-G60 PolarHBondContact O-N 2.97Å; G60-S62 PolarHBondContact O-N 2.84Å
61	T	40.2	Very low	46.2	Very low	117 Å²	117	138.8 Å²	138.8	72%	0.718	73%	0.73	S	S	*	*			trans	-73.3	85.4	155	41.7	0	0	0	0	107.4	E59 H63	E59-T61 VanDerWaalsContact C-N 3.27Å; E59-T61 PolarHBondContact O-N 2.9Å; T61-H63 VanDerWaalsContact C-N 3.3Å; T61-H63 PolarHBondContact O-N 2.93Å
62	S	41.7	Very low	45.3	Very low	92 Å²	92	143.4 Å²	143.4	64%	0.643	75%	0.754	S	S	*	*			trans	-58.3	92.6	163.1	169.6	0	0	0	0	108.8	G60	G60-S62 PolarHBondContact O-N 2.84Å
63	H	31.5	Very low	44.3	Very low	180 Å²	180	148 Å²	148	83%	0.833	78%	0.779	S	S	*	*			trans	-95.6	75.4	156.6	-75.2	-67.7	0	0	0	108.1	T61	T61-H63 VanDerWaalsContact C-N 3.3Å; T61-H63 PolarHBondContact O-N 2.93Å
64	F	43.3	Very low	43.7	Very low	265 Å²	265	145.8 Å²	145.8	100%	1.162	78%	0.782	S	S	*	*			trans	-88.8	0	146.6	-81.6	-78.5	0	0	0	107.8

Retrieved 64 of 64 residues in 16.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).