G4VSU7_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession G4VSU7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 31 aa.

>G4VSU7_SCHMA|G4VSU7
MTEQYHKSYHEILYIIYQNQKKRKLNFLNKI
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

 

Download Structure   PDB   PAE   Table  
Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1M65.8Low78.4Confident192 Ų192132.9 Ų132.995%0.94662%0.624SS**  0-51.50-69.6-172.5-8600111.7E3 Q4 Y5M1-E3 PolarHBondContact O-N 3.47Å; M1-Q4 PolarHBondContact O-N 2.98Å; M1-Y5 HydrophobicContact CB-CE2 4.46Å; M1-Y5 WeakPolarHBondContact O-CD2 3.4Å; M1-Y5 PolarHBondContact O-N 3.23Å
2T73.9Confident79.9Confident100 Ų100129.8 Ų129.861%0.61361%0.613SS**Hα-helixtrans-55.9-41.6-178.8-44.30000114.9Q4 Y5 H6T2-Q4 PolarHBondContact O-N 3.29Å; T2-Y5 PolarHBondContact O-N 3.24Å; T2-H6 PolarHBondContact O-N 3.32Å; T2-H6 VanDerWaalsContact O-N 3.17Å
3E69.1Low81.1Confident164 Ų164125.2 Ų125.277%0.76659%0.594SS**Hα-helixtrans-67-34.8-180-168.9177.6173.600113.4M1 H6 K7M1-E3 PolarHBondContact O-N 3.47Å; E3-H6 PolarHBondContact O-N 3.23Å; E3-K7 PolarHBondContact O-N 2.98Å
4Q72.4Confident82.3Confident146 Ų146126 Ų12668%0.68259%0.59SS**Hα-helixtrans-67-39.9177.9-174.3175-9.700111.3M1 T2 K7 S8M1-Q4 PolarHBondContact O-N 2.98Å; T2-Q4 PolarHBondContact O-N 3.29Å; Q4-K7 PolarHBondContact O-N 2.92Å; Q4-S8 WeakPolarHBondContact O-CB 3.47Å; Q4-S8 PolarHBondContact O-N 3.42Å; Q4-S8 PolarHBondContact O-OG 2.92Å
5Y73.7Confident83.3Confident174 Ų174123.7 Ų123.768%0.68258%0.582SS**Hα-helixtrans-64.2-39.6173.4-70.5-71.5000112M1 T2 S8 Y9M1-Y5 HydrophobicContact CB-CE2 4.46Å; M1-Y5 WeakPolarHBondContact O-CD2 3.4Å; M1-Y5 PolarHBondContact O-N 3.23Å; T2-Y5 PolarHBondContact O-N 3.24Å; Y5-S8 PolarHBondContact O-N 3.25Å; Y5-Y9 WeakPolarHBondContact O-CB 3.36Å; Y5-Y9 PolarHBondContact O-N 2.88Å
6H72.6Confident84.2Confident108 Ų108120.8 Ų120.850%0.557%0.57SS.*Hα-helixtrans-62.9-43.6174.9-66.8158.4000111.9T2 E3 Y9 H10T2-H6 PolarHBondContact O-N 3.32Å; T2-H6 VanDerWaalsContact O-N 3.17Å; E3-H6 PolarHBondContact O-N 3.23Å; H6-Y9 PolarHBondContact O-N 3.41Å; H6-H10 PolarHBondContact O-CD2 2.96Å; H6-H10 PolarHBondContact O-N 3.19Å
7K78.4Confident85Confident156 Ų156121.4 Ų121.468%0.67857%0.567SS**Hα-helixtrans-62-49.1175.6-168.1173.2-176.7176.30111.3E3 Q4 Y9 H10 E11E3-K7 PolarHBondContact O-N 2.98Å; Q4-K7 PolarHBondContact O-N 2.92Å; K7-Y9 VanDerWaalsContact C-N 3.31Å; K7-Y9 PolarHBondContact O-N 2.93Å; K7-H10 PolarHBondContact O-N 3.3Å; K7-E11 WeakPolarHBondContact O-CG 3.3Å; K7-E11 PolarHBondContact O-N 3.37Å; K7-E11 VanDerWaalsContact O-N 3.12Å
8S83.7Confident85.7Confident57 Ų57118.7 Ų118.740%0.39956%0.555SS.*Hα-helixtrans-61.9-37.2176.2-63.70000112.9Q4 Y5 E11 I12Q4-S8 WeakPolarHBondContact O-CB 3.47Å; Q4-S8 PolarHBondContact O-N 3.42Å; Q4-S8 PolarHBondContact O-OG 2.92Å; Y5-S8 PolarHBondContact O-N 3.25Å; S8-E11 PolarHBondContact O-N 3.46Å; S8-I12 VanDerWaalsContact O-CG1 3.29Å; S8-I12 WeakPolarHBondContact O-CG1 3.42Å; S8-I12 PolarHBondContact O-N 3.38Å
9Y90.6Very high86.4Confident133 Ų133117.1 Ų117.152%0.52255%0.55SS.*Hα-helixtrans-65.3-45.1177.5175.3-107.2000111.7Y5 H6 K7 E11 I12 L13Y5-Y9 WeakPolarHBondContact O-CB 3.36Å; Y5-Y9 PolarHBondContact O-N 2.88Å; H6-Y9 PolarHBondContact O-N 3.41Å; K7-Y9 VanDerWaalsContact C-N 3.31Å; K7-Y9 PolarHBondContact O-N 2.93Å; Y9-E11 VanDerWaalsContact C-N 3.31Å; Y9-E11 PolarHBondContact O-N 3.31Å; Y9-I12 PolarHBondContact O-N 2.86Å; Y9-L13 HydrophobicContact CD1-CD1 3.81Å; Y9-L13 HydrophobicContact CD1-CG 4.28Å; Y9-L13 HydrophobicContact CD2-CG 4.38Å; Y9-L13 HydrophobicContact CE1-CD1 3.2Å; Y9-L13 HydrophobicContact CE1-CG 3.89Å; Y9-L13 HydrophobicContact CE2-CD1 4.17Å; Y9-L13 HydrophobicContact CE2-CD2 4.11Å; Y9-L13 HydrophobicContact CE2-CG 3.97Å; Y9-L13 VanDerWaalsContact CZ-CD1 3.41Å; Y9-L13 WeakPolarHBondContact O-CB 3.45Å; Y9-L13 WeakPolarHBondContact O-CG 3.39Å; Y9-L13 PolarHBondContact O-N 2.87Å
10H90.8Very high86.9Confident121 Ų121115.8 Ų115.856%0.5654%0.544SS*.Hα-helixtrans-60.6-40.2174.7-78.8-62.4000112.4H6 K7 L13 Y14H6-H10 PolarHBondContact O-CD2 2.96Å; H6-H10 PolarHBondContact O-N 3.19Å; K7-H10 PolarHBondContact O-N 3.3Å; H10-L13 PolarHBondContact O-N 3.2Å; H10-Y14 VanDerWaalsContact O-CB 3.3Å; H10-Y14 WeakPolarHBondContact O-CB 3.46Å; H10-Y14 PolarHBondContact O-N 3.43Å
11E91.8Very high87.4Confident111 Ų111115.2 Ų115.252%0.51954%0.54SS..Hα-helixtrans-62.8-44.9175.5-66.9-67.910700111.6K7 S8 Y9 Y14 I15K7-E11 WeakPolarHBondContact O-CG 3.3Å; K7-E11 PolarHBondContact O-N 3.37Å; K7-E11 VanDerWaalsContact O-N 3.12Å; S8-E11 PolarHBondContact O-N 3.46Å; Y9-E11 VanDerWaalsContact C-N 3.31Å; Y9-E11 PolarHBondContact O-N 3.31Å; E11-Y14 PolarHBondContact O-N 2.94Å; E11-I15 VanDerWaalsContact O-CG1 3.3Å; E11-I15 WeakPolarHBondContact O-CG1 3.4Å; E11-I15 PolarHBondContact O-N 3.3Å
12I95.5Very high88.9Confident96 Ų96112.4 Ų112.449%0.49252%0.522SS..Hα-helixtrans-62.7-46.5176.9-68.5165.1000110.7S8 Y9 Y14 I15 I16S8-I12 VanDerWaalsContact O-CG1 3.29Å; S8-I12 WeakPolarHBondContact O-CG1 3.42Å; S8-I12 PolarHBondContact O-N 3.38Å; Y9-I12 PolarHBondContact O-N 2.86Å; I12-Y14 VanDerWaalsContact C-N 3.31Å; I12-Y14 PolarHBondContact O-N 3.06Å; I12-I15 PolarHBondContact O-N 2.9Å; I12-I16 HydrophobicContact CG2-CD1 3.79Å; I12-I16 HydrophobicContact CG2-CG1 4.46Å; I12-I16 VanDerWaalsContact O-CG1 3.29Å; I12-I16 WeakPolarHBondContact O-CG1 3.47Å; I12-I16 PolarHBondContact O-N 3.37Å
13L96.2Very high90.1Very high70 Ų70115.8 Ų115.837%0.36652%0.524SS..Hα-helixtrans-59.3-43.2176.4-76.6-176.2000111.8Y9 H10 I16 Y17Y9-L13 HydrophobicContact CD1-CD1 3.81Å; Y9-L13 HydrophobicContact CD1-CG 4.28Å; Y9-L13 HydrophobicContact CD2-CG 4.38Å; Y9-L13 HydrophobicContact CE1-CD1 3.2Å; Y9-L13 HydrophobicContact CE1-CG 3.89Å; Y9-L13 HydrophobicContact CE2-CD1 4.17Å; Y9-L13 HydrophobicContact CE2-CD2 4.11Å; Y9-L13 HydrophobicContact CE2-CG 3.97Å; Y9-L13 VanDerWaalsContact CZ-CD1 3.41Å; Y9-L13 WeakPolarHBondContact O-CB 3.45Å; Y9-L13 WeakPolarHBondContact O-CG 3.39Å; Y9-L13 PolarHBondContact O-N 2.87Å; H10-L13 PolarHBondContact O-N 3.2Å; L13-I16 PolarHBondContact O-N 2.9Å; L13-Y17 WeakPolarHBondContact O-CB 3.43Å; L13-Y17 PolarHBondContact O-N 3.23Å
14Y97Very high91.4Very high136 Ų136114.8 Ų114.853%0.53352%0.517SS..Hα-helixtrans-62-46.2177.6178.3-106.3000111.3H10 E11 I12 I16 Y17 Q18H10-Y14 VanDerWaalsContact O-CB 3.3Å; H10-Y14 WeakPolarHBondContact O-CB 3.46Å; H10-Y14 PolarHBondContact O-N 3.43Å; E11-Y14 PolarHBondContact O-N 2.94Å; I12-Y14 VanDerWaalsContact C-N 3.31Å; I12-Y14 PolarHBondContact O-N 3.06Å; Y14-I16 VanDerWaalsContact C-N 3.35Å; Y14-I16 PolarHBondContact O-N 3.4Å; Y14-Y17 PolarHBondContact O-N 2.87Å; Y14-Q18 HydrophobicContact CD1-CG 4.26Å; Y14-Q18 HydrophobicContact CD2-CG 4.26Å; Y14-Q18 HydrophobicContact CE1-CG 3.89Å; Y14-Q18 HydrophobicContact CE2-CG 3.88Å; Y14-Q18 HydrophobicContact CG-CG 4.44Å; Y14-Q18 VanDerWaalsContact O-CG 3.26Å; Y14-Q18 WeakPolarHBondContact O-CG 3.35Å; Y14-Q18 PolarHBondContact O-N 3.43Å; Y14-Q18 PolarHBondContact OH-NE2 2.94Å
15I97.2Very high92.6Very high91 Ų91111.8 Ų111.847%0.46751%0.505SS..Hα-helixtrans-58.7-46.3175.4-68.7164.8000110.9E11 I12 Y17 Q18 N19E11-I15 VanDerWaalsContact O-CG1 3.3Å; E11-I15 WeakPolarHBondContact O-CG1 3.4Å; E11-I15 PolarHBondContact O-N 3.3Å; I12-I15 PolarHBondContact O-N 2.9Å; I15-Y17 VanDerWaalsContact C-N 3.34Å; I15-Y17 PolarHBondContact O-N 3.46Å; I15-Q18 PolarHBondContact O-N 3.33Å; I15-N19 WeakPolarHBondContact O-CB 3.29Å; I15-N19 PolarHBondContact O-N 3.34Å; I15-N19 PolarHBondContact O-ND2 2.87Å
16I98.1Very high93.6Very high78 Ų78107.4 Ų107.440%0.449%0.493SS..Hα-helixtrans-59.7-46.4177.5-68.9167.5000110.5I12 L13 Y14 N19 Q20I12-I16 HydrophobicContact CG2-CD1 3.79Å; I12-I16 HydrophobicContact CG2-CG1 4.46Å; I12-I16 VanDerWaalsContact O-CG1 3.29Å; I12-I16 WeakPolarHBondContact O-CG1 3.47Å; I12-I16 PolarHBondContact O-N 3.37Å; L13-I16 PolarHBondContact O-N 2.9Å; Y14-I16 VanDerWaalsContact C-N 3.35Å; Y14-I16 PolarHBondContact O-N 3.4Å; I16-N19 PolarHBondContact O-N 2.78Å; I16-Q20 HydrophobicContact CG2-CG 4.41Å; I16-Q20 WeakPolarHBondContact O-CG 3.37Å; I16-Q20 PolarHBondContact O-N 3.31Å
17Y98.2Very high94.8Very high130 Ų130108.8 Ų108.851%0.5150%0.498SS..Hα-helixtrans-60.3-48.3178.8172.7-101.2000112L13 Y14 I15 N19 Q20 K21L13-Y17 WeakPolarHBondContact O-CB 3.43Å; L13-Y17 PolarHBondContact O-N 3.23Å; Y14-Y17 PolarHBondContact O-N 2.87Å; I15-Y17 VanDerWaalsContact C-N 3.34Å; I15-Y17 PolarHBondContact O-N 3.46Å; Y17-N19 VanDerWaalsContact C-N 3.29Å; Y17-N19 PolarHBondContact O-N 3.4Å; Y17-Q20 PolarHBondContact O-N 3.41Å; Y17-K21 WeakPolarHBondContact O-CB 3.26Å; Y17-K21 PolarHBondContact O-N 2.88Å
18Q97.6Very high95.6Very high74 Ų74106.3 Ų106.335%0.34649%0.491SS..Hα-helixtrans-60.4-41.3177.6-67-66.989.600111.3Y14 I15 K21 K22Y14-Q18 HydrophobicContact CD1-CG 4.26Å; Y14-Q18 HydrophobicContact CD2-CG 4.26Å; Y14-Q18 HydrophobicContact CE1-CG 3.89Å; Y14-Q18 HydrophobicContact CE2-CG 3.88Å; Y14-Q18 HydrophobicContact CG-CG 4.44Å; Y14-Q18 VanDerWaalsContact O-CG 3.26Å; Y14-Q18 WeakPolarHBondContact O-CG 3.35Å; Y14-Q18 PolarHBondContact O-N 3.43Å; Y14-Q18 PolarHBondContact OH-NE2 2.94Å; I15-Q18 PolarHBondContact O-N 3.33Å; Q18-K21 PolarHBondContact O-N 3.43Å; Q18-K22 WeakPolarHBondContact O-CB 3.36Å; Q18-K22 PolarHBondContact O-N 3.12Å
19N98.3Very high96Very high88 Ų88109.7 Ų109.747%0.47151%0.505SS..Hα-helixtrans-66.6-39.3176.3-71.8-25.6000112.6I15 I16 Y17 R23I15-N19 WeakPolarHBondContact O-CB 3.29Å; I15-N19 PolarHBondContact O-N 3.34Å; I15-N19 PolarHBondContact O-ND2 2.87Å; I16-N19 PolarHBondContact O-N 2.78Å; Y17-N19 VanDerWaalsContact C-N 3.29Å; Y17-N19 PolarHBondContact O-N 3.4Å; N19-R23 WeakPolarHBondContact O-CG 3.13Å; N19-R23 PolarHBondContact O-N 3.38Å
20Q97.9Very high95.8Very high90 Ų90112.4 Ų112.442%0.42152%0.52SS..Hα-helixtrans-63.5-45.3172.9-73.3-179.96.800111.5I16 Y17 R23 K24I16-Q20 HydrophobicContact CG2-CG 4.41Å; I16-Q20 WeakPolarHBondContact O-CG 3.37Å; I16-Q20 PolarHBondContact O-N 3.31Å; Y17-Q20 PolarHBondContact O-N 3.41Å; Q20-R23 PolarHBondContact O-N 3.35Å; Q20-K24 WeakPolarHBondContact O-CG 3.3Å; Q20-K24 PolarHBondContact O-N 2.99Å
21K97.3Very high95.3Very high105 Ų105114.9 Ų114.946%0.45754%0.535SS..Hα-helixtrans-60.5-46.1177.3-176.4175.4178.2179.90111.5Y17 Q18 R23 K24 L25Y17-K21 WeakPolarHBondContact O-CB 3.26Å; Y17-K21 PolarHBondContact O-N 2.88Å; Q18-K21 PolarHBondContact O-N 3.43Å; K21-R23 PolarHBondContact O-N 2.97Å; K21-K24 PolarHBondContact O-N 3.12Å; K21-L25 HydrophobicContact CG-CD1 4.17Å; K21-L25 WeakPolarHBondContact O-CG 3.3Å; K21-L25 PolarHBondContact O-N 3.39Å
22K97.4Very high95.5Very high133 Ų133115.1 Ų115.158%0.57854%0.536SS*.Hα-helixtrans-60.6-43.3176.9-170.5176.3-177.1177.20112Q18 L25 N26Q18-K22 WeakPolarHBondContact O-CB 3.36Å; Q18-K22 PolarHBondContact O-N 3.12Å; K22-L25 PolarHBondContact O-N 3.17Å; K22-N26 WeakPolarHBondContact O-CB 3.4Å; K22-N26 VanDerWaalsContact O-CG 3.24Å; K22-N26 PolarHBondContact O-N 3.36Å
23R97.4Very high95.5Very high171 Ų171116.1 Ų116.165%0.64554%0.538SS*.Hα-helixtrans-61.1-44.2174.9-75.6-173.1-67.2172.4-0.5112.2N19 Q20 K21 N26 F27N19-R23 WeakPolarHBondContact O-CG 3.13Å; N19-R23 PolarHBondContact O-N 3.38Å; Q20-R23 PolarHBondContact O-N 3.35Å; K21-R23 PolarHBondContact O-N 2.97Å; R23-N26 PolarHBondContact O-N 3.26Å; R23-F27 WeakPolarHBondContact O-CB 3.17Å; R23-F27 PolarHBondContact O-N 3.48Å
24K96.7Very high95.4Very high143 Ų143118.6 Ų118.662%0.62255%0.548SS*.Hα-helixtrans-62.2-45.3176.8-73.4-176.9177.8-1760112Q20 K21 F27 L28Q20-K24 WeakPolarHBondContact O-CG 3.3Å; Q20-K24 PolarHBondContact O-N 2.99Å; K21-K24 PolarHBondContact O-N 3.12Å; K24-F27 WeakPolarHBondContact O-CB 3.47Å; K24-F27 PolarHBondContact O-N 3.46Å; K24-L28 WeakPolarHBondContact O-CG 3.47Å; K24-L28 PolarHBondContact O-N 3.16Å
25L97.7Very high95.4Very high83 Ų83117.6 Ų117.644%0.43555%0.549SS..Hα-helixtrans-62.7-44.8176.7-70.8171.5000111.8K21 K22 F27 L28 N29K21-L25 HydrophobicContact CG-CD1 4.17Å; K21-L25 WeakPolarHBondContact O-CG 3.3Å; K21-L25 PolarHBondContact O-N 3.39Å; K22-L25 PolarHBondContact O-N 3.17Å; L25-F27 VanDerWaalsContact C-N 3.27Å; L25-F27 PolarHBondContact O-N 3.44Å; L25-L28 PolarHBondContact O-N 2.92Å; L25-N29 WeakPolarHBondContact O-CB 3.29Å; L25-N29 VanDerWaalsContact O-CG 3.26Å; L25-N29 PolarHBondContact O-N 2.97Å
26N95.4Very high95.2Very high82 Ų82119.3 Ų119.344%0.43955%0.554SS.*Hα-helixtrans-64.6-31.8176.4-72.1-9.2000112.8K22 R23 K30K22-N26 WeakPolarHBondContact O-CB 3.4Å; K22-N26 VanDerWaalsContact O-CG 3.24Å; K22-N26 PolarHBondContact O-N 3.36Å; R23-N26 PolarHBondContact O-N 3.26Å; N26-K30 VanDerWaalsContact O-CG 3.3Å; N26-K30 WeakPolarHBondContact O-CG 3.35Å; N26-K30 PolarHBondContact O-N 3.27Å
27F96.7Very high95Very high136 Ų136122 Ų12260%0.59656%0.564SS**Hα-helixtrans-67.2-45.9173175-95.7000111R23 K24 L25 K30 I31R23-F27 WeakPolarHBondContact O-CB 3.17Å; R23-F27 PolarHBondContact O-N 3.48Å; K24-F27 WeakPolarHBondContact O-CB 3.47Å; K24-F27 PolarHBondContact O-N 3.46Å; L25-F27 VanDerWaalsContact C-N 3.27Å; L25-F27 PolarHBondContact O-N 3.44Å; F27-K30 PolarHBondContact O-N 3.42Å; F27-I31 HydrophobicContact CD1-CD1 4.43Å; F27-I31 HydrophobicContact CE1-CD1 3.83Å; F27-I31 HydrophobicContact CZ-CD1 4.03Å
28L95.6Very high94.8Very high104 Ų104121.4 Ų121.455%0.54557%0.568SS.*Hα-helixtrans-64.9-40.8177.5-67.6171.8000112.6K24 L25 K30 I31K24-L28 WeakPolarHBondContact O-CG 3.47Å; K24-L28 PolarHBondContact O-N 3.16Å; L25-L28 PolarHBondContact O-N 2.92Å; L28-K30 PolarHBondContact O-N 3.24Å; L28-I31 PolarHBondContact O-N 3.33Å
29N92.3Very high94.6Very high129 Ų129125.1 Ų125.169%0.6959%0.585SS**THydrogen-bonded Turntrans-69.5-12.8179.1-70.4-14.7000114.1L25L25-N29 WeakPolarHBondContact O-CB 3.29Å; L25-N29 VanDerWaalsContact O-CG 3.26Å; L25-N29 PolarHBondContact O-N 2.97Å
30K87.2Confident94.3Very high189 Ų189128.2 Ų128.282%0.82260%0.595SS**THydrogen-bonded Turntrans-93.5-14.3178-79-177.2179.5-1660113.1N26 F27 L28N26-K30 VanDerWaalsContact O-CG 3.3Å; N26-K30 WeakPolarHBondContact O-CG 3.35Å; N26-K30 PolarHBondContact O-N 3.27Å; F27-K30 PolarHBondContact O-N 3.42Å; L28-K30 PolarHBondContact O-N 3.24Å
31I80Confident94Very high173 Ų173131.6 Ų131.689%0.88761%0.61SS**  trans-86.50169.1-61.4175.2000107F27 L28F27-I31 HydrophobicContact CD1-CD1 4.43Å; F27-I31 HydrophobicContact CE1-CD1 3.83Å; F27-I31 HydrophobicContact CZ-CD1 4.03Å; L28-I31 PolarHBondContact O-N 3.33Å

Retrieved 31 of 31 residues in 8.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).