G4VT69_SCHMA Loading...

Secreted protein

AlphaFold DB , UniProt , Accession G4VT69, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 85 aa.

						>G4VT69_SCHMA|G4VT69
MKYNCLQNTSLLAVIMVLMVMINVSYSHAIHANHYDDNDLVTDSLDDNEYEDENGAGDYDENEDTYENEGVLNDPQFYRRGHYNE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.5	Low	61.3	Low	230 Å²	230	131.5 Å²	131.5	100%	1.133	67%	0.672	S	S	*	*				0	82.7	0	-74.9	169.8	161.6	0	0	110.1
2	K	58	Low	62.9	Low	188 Å²	188	129.1 Å²	129.1	82%	0.817	66%	0.66	S	S	*	*			trans	-119.2	-3.1	178.2	-72.4	-175	177.4	-179.1	0	113.9
3	Y	57.1	Low	64.5	Low	189 Å²	189	122.9 Å²	122.9	74%	0.741	64%	0.641	S	S	*	*	H	α-helix	trans	-86.3	-19.3	-172.6	-63.5	-75.7	0	0	0	114.3	C5	Y3-C5 PolarHBondContact O-N 3.25Å
4	N	58.7	Low	65.8	Low	113 Å²	113	119.7 Å²	119.7	60%	0.604	63%	0.629	S	S	*	*	H	α-helix	trans	-73.7	-29.4	-175.4	-66.1	0.8	0	0	0	113.5	N8	N4-N8 PolarHBondContact O-ND2 3.05Å
5	C	56.2	Low	67.2	Low	94 Å²	94	116.6 Å²	116.6	64%	0.635	61%	0.612	S	S	*	*	H	α-helix	trans	-73.7	-35	-179.5	-164	0	0	0	0	111.8	Y3 N8 T9	Y3-C5 PolarHBondContact O-N 3.25Å; C5-N8 PolarHBondContact O-N 3.47Å; C5-T9 PolarHBondContact O-N 3.44Å
6	L	55.2	Low	68.3	Low	135 Å²	135	117 Å²	117	71%	0.707	61%	0.611	S	S	*	*	H	α-helix	trans	-72.9	-29.3	-178.3	-126	78.4	0	0	0	113.3	T9 S10	L6-T9 PolarHBondContact O-OG1 3.46Å; L6-S10 PolarHBondContact O-N 3.5Å
7	Q	56.4	Low	69.2	Low	135 Å²	135	115.3 Å²	115.3	63%	0.631	61%	0.607	S	S	*	*	H	α-helix	trans	-72.6	-34.7	175.5	-72.8	-178.3	-55.6	0	0	111.8	S10 L11	Q7-S10 PolarHBondContact O-N 3.4Å; Q7-L11 PolarHBondContact O-N 3.02Å
8	N	61.2	Low	70	Confident	98 Å²	98	114.3 Å²	114.3	52%	0.524	60%	0.601	S	S	.	*	H	α-helix	trans	-69.6	-35.1	179.4	-68.7	-22.1	0	0	0	112.5	N4 C5 L11 L12	N4-N8 PolarHBondContact O-ND2 3.05Å; C5-N8 PolarHBondContact O-N 3.47Å; N8-L11 PolarHBondContact O-N 2.95Å; N8-L12 WeakPolarHBondContact O-CB 3.29Å; N8-L12 VanDerWaalsContact O-CG 3.29Å; N8-L12 WeakPolarHBondContact O-CG 3.49Å; N8-L12 PolarHBondContact O-N 3.43Å
9	T	68.2	Low	70.5	Confident	83 Å²	83	113.8 Å²	113.8	51%	0.509	60%	0.597	S	S	.	*	H	α-helix	trans	-68.7	-39.4	175.8	49	0	0	0	0	112.1	C5 L6 L12 A13	C5-T9 PolarHBondContact O-N 3.44Å; L6-T9 PolarHBondContact O-OG1 3.46Å; T9-L12 PolarHBondContact O-N 3.35Å; T9-A13 PolarHBondContact O-N 3.05Å; T9-A13 VanDerWaalsContact O-N 3.08Å
10	S	74.6	Confident	70.9	Confident	78 Å²	78	112.7 Å²	112.7	55%	0.545	60%	0.595	S	S	.	*	H	α-helix	trans	-64	-41.5	174.5	177.3	0	0	0	0	111.9	L6 Q7 A13 V14	L6-S10 PolarHBondContact O-N 3.5Å; Q7-S10 PolarHBondContact O-N 3.4Å; S10-A13 PolarHBondContact O-N 3.25Å; S10-V14 WeakPolarHBondContact O-CG2 3.46Å; S10-V14 PolarHBondContact O-N 3.44Å
11	L	77.8	Confident	71.2	Confident	103 Å²	103	113.1 Å²	113.1	54%	0.539	60%	0.595	S	S	.	*	H	α-helix	trans	-63.9	-44	176.6	-176	67.1	0	0	0	112	Q7 N8 A13 V14 I15	Q7-L11 PolarHBondContact O-N 3.02Å; N8-L11 PolarHBondContact O-N 2.95Å; L11-A13 VanDerWaalsContact C-N 3.33Å; L11-A13 PolarHBondContact O-N 3.21Å; L11-V14 PolarHBondContact O-N 3.08Å; L11-I15 HydrophobicContact CG-CD1 4.07Å; L11-I15 WeakPolarHBondContact O-CG1 3.37Å; L11-I15 PolarHBondContact O-N 3.4Å
12	L	80.5	Confident	72.2	Confident	103 Å²	103	105.9 Å²	105.9	54%	0.539	56%	0.56	S	S	.	*	H	α-helix	trans	-61.7	-39.9	177.5	-75.2	170.2	0	0	0	112.4	N8 T9 V14 I15 M16	N8-L12 WeakPolarHBondContact O-CB 3.29Å; N8-L12 VanDerWaalsContact O-CG 3.29Å; N8-L12 WeakPolarHBondContact O-CG 3.49Å; N8-L12 PolarHBondContact O-N 3.43Å; T9-L12 PolarHBondContact O-N 3.35Å; L12-V14 VanDerWaalsContact C-N 3.35Å; L12-V14 PolarHBondContact O-N 3.49Å; L12-I15 PolarHBondContact O-N 3.03Å; L12-M16 WeakPolarHBondContact O-CG 3.41Å; L12-M16 PolarHBondContact O-N 3.44Å
13	A	82.9	Confident	72.3	Confident	49 Å²	49	101.9 Å²	101.9	41%	0.405	55%	0.548	S	S	.	.	H	α-helix	trans	-61.5	-42.8	175.9	0	0	0	0	0	112	T9 S10 L11 M16 V17	T9-A13 PolarHBondContact O-N 3.05Å; T9-A13 VanDerWaalsContact O-N 3.08Å; S10-A13 PolarHBondContact O-N 3.25Å; L11-A13 VanDerWaalsContact C-N 3.33Å; L11-A13 PolarHBondContact O-N 3.21Å; A13-M16 PolarHBondContact O-N 3.48Å; A13-V17 WeakPolarHBondContact O-CG2 3.38Å; A13-V17 PolarHBondContact O-N 3.18Å
14	V	83.5	Confident	72.5	Confident	78 Å²	78	96.5 Å²	96.5	47%	0.473	54%	0.535	S	S	.	.	H	α-helix	trans	-63.7	-43.6	177.1	174.7	0	0	0	0	111.3	S10 L11 L12 M16 V17 L18	S10-V14 WeakPolarHBondContact O-CG2 3.46Å; S10-V14 PolarHBondContact O-N 3.44Å; L11-V14 PolarHBondContact O-N 3.08Å; L12-V14 VanDerWaalsContact C-N 3.35Å; L12-V14 PolarHBondContact O-N 3.49Å; V14-M16 VanDerWaalsContact C-N 3.34Å; V14-M16 PolarHBondContact O-N 3.34Å; V14-V17 PolarHBondContact O-N 3.08Å; V14-L18 HydrophobicContact CG1-CD1 4.11Å; V14-L18 WeakPolarHBondContact O-CG 3.49Å; V14-L18 PolarHBondContact O-N 3.45Å; V14-L18 VanDerWaalsContact O-N 3.08Å
15	I	86	Confident	72.4	Confident	73 Å²	73	95 Å²	95	37%	0.374	53%	0.532	S	S	.	.	H	α-helix	trans	-61.6	-42.4	178.1	-66.9	165.9	0	0	0	111.2	L11 L12 V17 L18 M19	L11-I15 HydrophobicContact CG-CD1 4.07Å; L11-I15 WeakPolarHBondContact O-CG1 3.37Å; L11-I15 PolarHBondContact O-N 3.4Å; L12-I15 PolarHBondContact O-N 3.03Å; I15-V17 PolarHBondContact O-N 3.39Å; I15-L18 PolarHBondContact O-N 3.03Å; I15-M19 HydrophobicContact CG2-CG 4.48Å; I15-M19 WeakPolarHBondContact O-CG 3.42Å; I15-M19 PolarHBondContact O-N 3.31Å
16	M	84.4	Confident	72.5	Confident	123 Å²	123	97.6 Å²	97.6	61%	0.606	53%	0.53	S	S	*	.	H	α-helix	trans	-62.4	-42.4	178.4	-76.3	-170.4	-86.8	0	0	112.4	L12 A13 V14 M19 V20	L12-M16 WeakPolarHBondContact O-CG 3.41Å; L12-M16 PolarHBondContact O-N 3.44Å; A13-M16 PolarHBondContact O-N 3.48Å; V14-M16 VanDerWaalsContact C-N 3.34Å; V14-M16 PolarHBondContact O-N 3.34Å; M16-M19 PolarHBondContact O-N 2.99Å; M16-V20 PolarHBondContact O-N 3.23Å
17	V	83.6	Confident	72.3	Confident	88 Å²	88	94.5 Å²	94.5	53%	0.533	52%	0.52	S	S	.	.	H	α-helix	trans	-63.6	-42.2	176.7	173.7	0	0	0	0	111.3	A13 V14 I15 M19 V20 M21	A13-V17 WeakPolarHBondContact O-CG2 3.38Å; A13-V17 PolarHBondContact O-N 3.18Å; V14-V17 PolarHBondContact O-N 3.08Å; I15-V17 PolarHBondContact O-N 3.39Å; V17-M19 PolarHBondContact O-N 3.46Å; V17-V20 PolarHBondContact O-N 3.47Å; V17-M21 WeakPolarHBondContact O-CG 3.44Å; V17-M21 PolarHBondContact O-N 2.94Å
18	L	83.4	Confident	72	Confident	97 Å²	97	94.1 Å²	94.1	51%	0.508	52%	0.518	S	S	.	.	H	α-helix	trans	-61.9	-42	177.1	-70.9	170.6	0	0	0	112.1	V14 I15 V20 M21 I22	V14-L18 HydrophobicContact CG1-CD1 4.11Å; V14-L18 WeakPolarHBondContact O-CG 3.49Å; V14-L18 PolarHBondContact O-N 3.45Å; V14-L18 VanDerWaalsContact O-N 3.08Å; I15-L18 PolarHBondContact O-N 3.03Å; L18-V20 VanDerWaalsContact C-N 3.35Å; L18-V20 PolarHBondContact O-N 3.36Å; L18-M21 PolarHBondContact O-N 3.01Å; L18-I22 WeakPolarHBondContact O-CB 3.29Å; L18-I22 WeakPolarHBondContact O-CD1 3.42Å; L18-I22 VanDerWaalsContact O-CG1 3.24Å; L18-I22 WeakPolarHBondContact O-CG1 3.45Å; L18-I22 PolarHBondContact O-N 3.42Å
19	M	79.5	Confident	71.6	Confident	106 Å²	106	91.5 Å²	91.5	52%	0.522	51%	0.509	S	S	.	.	H	α-helix	trans	-62.4	-39.2	178.3	-71.9	-70.2	171.7	0	0	112.7	I15 M16 V17 I22 N23	I15-M19 HydrophobicContact CG2-CG 4.48Å; I15-M19 WeakPolarHBondContact O-CG 3.42Å; I15-M19 PolarHBondContact O-N 3.31Å; M16-M19 PolarHBondContact O-N 2.99Å; V17-M19 PolarHBondContact O-N 3.46Å; M19-I22 PolarHBondContact O-N 3.44Å; M19-N23 WeakPolarHBondContact O-CB 3.39Å; M19-N23 VanDerWaalsContact O-CG 3.3Å; M19-N23 PolarHBondContact O-N 3.35Å; M19-N23 PolarHBondContact O-ND2 3.39Å
20	V	79.4	Confident	70.9	Confident	91 Å²	91	92.5 Å²	92.5	55%	0.552	51%	0.511	S	S	*	.	H	α-helix	trans	-64	-45.3	175.7	174.2	0	0	0	0	110.9	M16 V17 L18 I22 N23 V24	M16-V20 PolarHBondContact O-N 3.23Å; V17-V20 PolarHBondContact O-N 3.47Å; L18-V20 VanDerWaalsContact C-N 3.35Å; L18-V20 PolarHBondContact O-N 3.36Å; V20-I22 PolarHBondContact O-N 3.17Å; V20-N23 PolarHBondContact O-N 3.45Å; V20-V24 WeakPolarHBondContact O-CG2 3.34Å; V20-V24 PolarHBondContact O-N 3.03Å
21	M	76.3	Confident	69.8	Low	121 Å²	121	95 Å²	95	60%	0.596	51%	0.513	S	S	*	.	H	α-helix	trans	-61.4	-44	178.1	-66.7	-67	-178.8	0	0	111.8	V17 L18 V24 S25	V17-M21 WeakPolarHBondContact O-CG 3.44Å; V17-M21 PolarHBondContact O-N 2.94Å; L18-M21 PolarHBondContact O-N 3.01Å; M21-V24 PolarHBondContact O-N 3.03Å; M21-S25 PolarHBondContact O-N 2.97Å; M21-S25 PolarHBondContact O-OG 3.27Å
22	I	73.2	Confident	68.4	Low	78 Å²	78	92.5 Å²	92.5	40%	0.4	51%	0.508	S	S	.	.	H	α-helix	trans	-62.5	-45	178.3	-69.7	166.4	0	0	0	111	L18 M19 V20 V24 S25 Y26	L18-I22 WeakPolarHBondContact O-CB 3.29Å; L18-I22 WeakPolarHBondContact O-CD1 3.42Å; L18-I22 VanDerWaalsContact O-CG1 3.24Å; L18-I22 WeakPolarHBondContact O-CG1 3.45Å; L18-I22 PolarHBondContact O-N 3.42Å; M19-I22 PolarHBondContact O-N 3.44Å; V20-I22 PolarHBondContact O-N 3.17Å; I22-V24 PolarHBondContact O-N 3.37Å; I22-S25 PolarHBondContact O-N 3.23Å; I22-Y26 HydrophobicContact CG2-CD2 3.52Å; I22-Y26 HydrophobicContact CG2-CE2 3.27Å; I22-Y26 WeakPolarHBondContact O-CD2 3.19Å; I22-Y26 PolarHBondContact O-N 3.31Å
23	N	59.8	Low	67	Low	105 Å²	105	93.6 Å²	93.6	56%	0.561	51%	0.514	S	S	*	.	H	α-helix	trans	-64.8	-38.3	178.9	-74.5	-18.2	0	0	0	112.6	M19 V20 S25 Y26 S27	M19-N23 WeakPolarHBondContact O-CB 3.39Å; M19-N23 VanDerWaalsContact O-CG 3.3Å; M19-N23 PolarHBondContact O-N 3.35Å; M19-N23 PolarHBondContact O-ND2 3.39Å; V20-N23 PolarHBondContact O-N 3.45Å; N23-S25 VanDerWaalsContact C-N 3.32Å; N23-Y26 PolarHBondContact O-N 3.05Å; N23-S27 PolarHBondContact O-N 3.47Å
24	V	60.7	Low	65.4	Low	76 Å²	76	97.5 Å²	97.5	46%	0.461	52%	0.524	S	S	.	.	H	α-helix	trans	-64.1	-39.2	174	172.5	0	0	0	0	110.9	V20 M21 I22 S27 H28	V20-V24 WeakPolarHBondContact O-CG2 3.34Å; V20-V24 PolarHBondContact O-N 3.03Å; M21-V24 PolarHBondContact O-N 3.03Å; I22-V24 PolarHBondContact O-N 3.37Å; V24-S27 PolarHBondContact O-N 3.04Å; V24-H28 PolarHBondContact O-N 3.43Å; V24-H28 PolarHBondContact O-ND1 3.35Å
25	S	57.9	Low	63.9	Low	80 Å²	80	102.7 Å²	102.7	56%	0.559	54%	0.536	S	S	*	.	H	α-helix	trans	-67.4	-39.2	175.3	-62.1	0	0	0	0	112.9	M21 I22 N23 H28 A29	M21-S25 PolarHBondContact O-N 2.97Å; M21-S25 PolarHBondContact O-OG 3.27Å; I22-S25 PolarHBondContact O-N 3.23Å; N23-S25 VanDerWaalsContact C-N 3.32Å; S25-H28 PolarHBondContact O-N 3Å; S25-A29 WeakPolarHBondContact O-CB 3.49Å; S25-A29 PolarHBondContact O-N 2.92Å
26	Y	57.9	Low	62.2	Low	149 Å²	149	106 Å²	106	58%	0.584	56%	0.555	S	S	*	*	H	α-helix	trans	-64.8	-38.3	174.9	-82.1	-66.8	0	0	0	112.5	I22 N23 H28 A29 I30	I22-Y26 HydrophobicContact CG2-CD2 3.52Å; I22-Y26 HydrophobicContact CG2-CE2 3.27Å; I22-Y26 WeakPolarHBondContact O-CD2 3.19Å; I22-Y26 PolarHBondContact O-N 3.31Å; N23-Y26 PolarHBondContact O-N 3.05Å; Y26-H28 VanDerWaalsContact C-N 3.31Å; Y26-H28 PolarHBondContact O-N 3.19Å; Y26-A29 PolarHBondContact O-N 3.47Å; Y26-I30 VanDerWaalsContact O-CG1 3.3Å; Y26-I30 WeakPolarHBondContact O-CG1 3.48Å; Y26-I30 PolarHBondContact O-N 3.17Å
27	S	51.9	Low	60.6	Low	70 Å²	70	107.4 Å²	107.4	49%	0.49	57%	0.565	S	S	.	*	H	α-helix	trans	-62.1	-38.1	176	-170.9	0	0	0	0	112.5	N23 V24 H31	N23-S27 PolarHBondContact O-N 3.47Å; V24-S27 PolarHBondContact O-N 3.04Å; S27-H31 PolarHBondContact O-N 3.02Å
28	H	50	Low	58.7	Low	128 Å²	128	107.9 Å²	107.9	59%	0.593	56%	0.564	S	S	*	*	H	α-helix	trans	-74.9	-35.8	177.4	-72.8	101.8	0	0	0	112.4	V24 S25 Y26 H31 A32	V24-H28 PolarHBondContact O-N 3.43Å; V24-H28 PolarHBondContact O-ND1 3.35Å; S25-H28 PolarHBondContact O-N 3Å; Y26-H28 VanDerWaalsContact C-N 3.31Å; Y26-H28 PolarHBondContact O-N 3.19Å; H28-H31 PolarHBondContact O-N 3.42Å; H28-A32 WeakPolarHBondContact O-CB 3.24Å; H28-A32 PolarHBondContact O-N 3.34Å
29	A	52.7	Low	56.9	Low	42 Å²	42	111.2 Å²	111.2	35%	0.347	58%	0.582	S	S	.	*	H	α-helix	trans	-71	-34.8	179.3	0	0	0	0	0	113	S25 Y26 A32 N33	S25-A29 WeakPolarHBondContact O-CB 3.49Å; S25-A29 PolarHBondContact O-N 2.92Å; Y26-A29 PolarHBondContact O-N 3.47Å; A29-A32 PolarHBondContact O-N 3.32Å; A29-N33 VanDerWaalsContact O-CB 3.31Å; A29-N33 WeakPolarHBondContact O-CB 3.32Å; A29-N33 PolarHBondContact O-N 3.47Å
30	I	52.7	Low	55.4	Low	105 Å²	105	111.4 Å²	111.4	54%	0.538	59%	0.585	S	S	.	*	H	α-helix	trans	-70.2	-35.5	176.2	-66.1	166.3	0	0	0	110.8	Y26 H34	Y26-I30 VanDerWaalsContact O-CG1 3.3Å; Y26-I30 WeakPolarHBondContact O-CG1 3.48Å; Y26-I30 PolarHBondContact O-N 3.17Å; I30-H34 PolarHBondContact O-N 2.86Å
31	H	50.7	Low	53.8	Low	129 Å²	129	112.7 Å²	112.7	60%	0.597	59%	0.593	S	S	*	*	H	α-helix	trans	-68.2	-46.7	170.8	-84	176.5	0	0	0	111.8	S27 H28 N33 H34 Y35	S27-H31 PolarHBondContact O-N 3.02Å; H28-H31 PolarHBondContact O-N 3.42Å; H31-N33 PolarHBondContact O-N 3.02Å; H31-H34 PolarHBondContact O-N 2.94Å; H31-Y35 WeakPolarHBondContact O-CD2 3.3Å
32	A	49.2	Very low	52.4	Low	52 Å²	52	113.1 Å²	113.1	43%	0.43	60%	0.602	S	S	.	*	H	α-helix	trans	-65	-40.9	-178.4	0	0	0	0	0	113.2	H28 A29 H34 Y35	H28-A32 WeakPolarHBondContact O-CB 3.24Å; H28-A32 PolarHBondContact O-N 3.34Å; A29-A32 PolarHBondContact O-N 3.32Å; A32-H34 PolarHBondContact O-N 3.47Å; A32-Y35 PolarHBondContact O-N 3.29Å
33	N	50.7	Low	50.9	Low	125 Å²	125	116 Å²	116	67%	0.668	62%	0.619	S	S	*	*	H	α-helix	trans	-74.2	-9.7	179.7	-72	-7.9	0	0	0	113.8	A29 H31	A29-N33 VanDerWaalsContact O-CB 3.31Å; A29-N33 WeakPolarHBondContact O-CB 3.32Å; A29-N33 PolarHBondContact O-N 3.47Å; H31-N33 PolarHBondContact O-N 3.02Å
34	H	49.1	Very low	50.1	Low	131 Å²	131	115.3 Å²	115.3	61%	0.606	62%	0.622	S	S	*	*	H	α-helix	trans	-86.7	-13.9	173.1	-111.4	-57.7	0	0	0	113.4	I30 H31 A32	I30-H34 PolarHBondContact O-N 2.86Å; H31-H34 PolarHBondContact O-N 2.94Å; A32-H34 PolarHBondContact O-N 3.47Å
35	Y	51.9	Low	49.5	Very low	188 Å²	188	119.9 Å²	119.9	74%	0.737	64%	0.643	S	S	*	*	H	α-helix	trans	-102.8	-13.7	-176.6	-75.6	-70.3	0	0	0	114.8	H31 A32	H31-Y35 WeakPolarHBondContact O-CD2 3.3Å; A32-Y35 PolarHBondContact O-N 3.29Å
36	D	51.5	Low	48.8	Very low	142 Å²	142	122.2 Å²	122.2	76%	0.759	65%	0.649	S	S	*	*	S	Bend	trans	-95.2	-15.6	-174.5	-92.4	-21.9	0	0	0	115.3
37	D	49.6	Very low	48.3	Very low	152 Å²	152	123 Å²	123	81%	0.813	66%	0.664	S	S	*	*	S	Bend	trans	-121.7	9.4	-175.1	-85.4	-20	0	0	0	114.8
38	N	44.7	Very low	47.9	Very low	98 Å²	98	125.9 Å²	125.9	52%	0.524	67%	0.673	S	S	.	*			trans	-115.3	92.8	173.6	-98.4	0.9	0	0	0	110.3	L40	N38-L40 HydrophobicContact CB-CB 3.66Å; N38-L40 PolarHBondContact O-N 3.46Å
39	D	44.6	Very low	47.7	Very low	167 Å²	167	127.4 Å²	127.4	89%	0.893	68%	0.681	S	S	*	*			trans	-52.9	64.7	133.9	-174	28.4	0	0	0	109
40	L	49.7	Very low	47.3	Very low	110 Å²	110	136 Å²	136	58%	0.576	71%	0.706	S	S	*	*			trans	-118.7	94.8	174.3	-171.8	71.5	0	0	0	105.6	N38 T42	N38-L40 HydrophobicContact CB-CB 3.66Å; N38-L40 PolarHBondContact O-N 3.46Å; L40-T42 VanDerWaalsContact C-N 3.27Å; L40-T42 PolarHBondContact O-N 2.93Å
41	V	45.7	Very low	47	Very low	119 Å²	119	138 Å²	138	72%	0.721	71%	0.713	S	S	*	*			trans	-10.8	84.3	145.6	-172.6	0	0	0	0	112.3	D43	V41-D43 VanDerWaalsContact C-N 3.28Å; V41-D43 HydrophobicContact CG1-CB 4.15Å
42	T	47	Very low	46.6	Very low	129 Å²	129	139.6 Å²	139.6	79%	0.791	73%	0.726	S	S	*	*			trans	-104.7	58	148.9	51.6	0	0	0	0	106.2	L40	L40-T42 VanDerWaalsContact C-N 3.27Å; L40-T42 PolarHBondContact O-N 2.93Å
43	D	41.6	Very low	46.3	Very low	140 Å²	140	144.3 Å²	144.3	75%	0.749	74%	0.739	S	S	*	*			trans	-72.9	134.9	146.6	-167.2	12.4	0	0	0	105.4	V41	V41-D43 VanDerWaalsContact C-N 3.28Å; V41-D43 HydrophobicContact CG1-CB 4.15Å
44	S	43.1	Very low	46.1	Very low	89 Å²	89	145.6 Å²	145.6	62%	0.622	75%	0.746	S	S	*	*	S	Bend	trans	79.9	109.3	-170.8	80.5	0	0	0	0	116.2
45	L	48.4	Very low	45.8	Very low	173 Å²	173	143 Å²	143	91%	0.906	75%	0.754	S	S	*	*	S	Bend	trans	153.5	8.4	133.3	-82.7	149.7	0	0	0	114.6
46	D	42.7	Very low	45.4	Very low	128 Å²	128	138.7 Å²	138.7	68%	0.684	76%	0.757	S	S	*	*			trans	-133.2	66.7	170.4	-149.3	4.3	0	0	0	110.7	N48	D46-N48 PolarHBondContact OD1-ND2 3.27Å
47	D	47.4	Very low	45.1	Very low	166 Å²	166	135.1 Å²	135.1	89%	0.888	76%	0.755	S	S	*	*			trans	-123.8	103.3	146.1	-97.3	-24.7	0	0	0	107.9	E49	D47-E49 PolarHBondContact O-N 3.48Å; D47-E49 VanDerWaalsContact O-N 3.09Å
48	N	43.4	Very low	44.9	Very low	130 Å²	130	135 Å²	135	70%	0.695	75%	0.754	S	S	*	*			trans	-60.1	98.1	171	-66	-82.5	0	0	0	109.4	D46	D46-N48 PolarHBondContact OD1-ND2 3.27Å
49	E	45.8	Very low	45.2	Very low	160 Å²	160	141.6 Å²	141.6	75%	0.748	77%	0.773	S	S	*	*			trans	-139.6	90	162.4	-154.7	154.6	-142.5	0	0	109.7	D47 E51	D47-E49 PolarHBondContact O-N 3.48Å; D47-E49 VanDerWaalsContact O-N 3.09Å; E49-E51 VanDerWaalsContact C-N 3.29Å; E49-E51 HydrophobicContact CG-CG 4.14Å; E49-E51 PolarHBondContact O-N 3.46Å
50	Y	44.1	Very low	45.3	Very low	224 Å²	224	140.5 Å²	140.5	88%	0.878	77%	0.767	S	S	*	*			trans	-66.3	89.7	163.5	-76.9	-93.9	0	0	0	108.4
51	E	46.6	Very low	45.3	Very low	147 Å²	147	142.5 Å²	142.5	69%	0.687	77%	0.774	S	S	*	*			trans	-128.6	80.6	162	-68.3	-155.6	177.5	0	0	109.8	E49 E53	E49-E51 VanDerWaalsContact C-N 3.29Å; E49-E51 HydrophobicContact CG-CG 4.14Å; E49-E51 PolarHBondContact O-N 3.46Å; E51-E53 PolarHBondContact O-N 3.28Å; E51-E53 VanDerWaalsContact O-N 3.15Å
52	D	42.8	Very low	45.5	Very low	161 Å²	161	143.2 Å²	143.2	86%	0.861	77%	0.773	S	S	*	*			trans	-67	90.1	148.1	161.5	21	0	0	0	107
53	E	41.9	Very low	45.2	Very low	151 Å²	151	145.4 Å²	145.4	71%	0.706	78%	0.775	S	S	*	*			trans	-146.3	104.5	157.2	-70.5	-159.8	178.9	0	0	109.9	E51	E51-E53 PolarHBondContact O-N 3.28Å; E51-E53 VanDerWaalsContact O-N 3.15Å
54	N	46.7	Very low	45.6	Very low	153 Å²	153	145.3 Å²	145.3	82%	0.818	77%	0.774	S	S	*	*			trans	82.9	105.4	158.6	-52.1	-43.4	0	0	0	118.6
55	G	42.3	Very low	45.9	Very low	76 Å²	76	147.2 Å²	147.2	78%	0.784	78%	0.782	S	S	*	*				117.6	119	114.7	0	0	0	0	0	116.4
56	A	44.9	Very low	46.1	Very low	97 Å²	97	149 Å²	149	80%	0.802	78%	0.778	S	S	*	*			trans	74.2	100.9	167.5	0	0	0	0	0	114.3
57	G	44.6	Very low	46.1	Very low	68 Å²	68	151.8 Å²	151.8	70%	0.701	79%	0.787	S	S	*	*			cis	70.6	102.2	37.7	0	0	0	0	0	109.3
58	D	44.8	Very low	46.3	Very low	149 Å²	149	150.2 Å²	150.2	80%	0.797	78%	0.779	S	S	*	*			trans	83.1	94.8	175.8	-62	-21.7	0	0	0	118.4
59	Y	51	Low	46.5	Very low	237 Å²	237	153.9 Å²	153.9	93%	0.929	79%	0.792	S	S	*	*			trans	-124.8	107.4	136.8	-65.4	-76.1	0	0	0	108.5
60	D	47.8	Very low	46.6	Very low	144 Å²	144	149.3 Å²	149.3	77%	0.77	79%	0.787	S	S	*	*			trans	-73.3	165.1	169.1	-159.4	-5.4	0	0	0	110.1
61	E	49.3	Very low	47	Very low	152 Å²	152	141.1 Å²	141.1	71%	0.71	76%	0.76	S	S	*	*			trans	94.5	119.7	158.7	-56.3	-176.3	-179.9	0	0	121.1
62	N	49	Very low	47.5	Very low	134 Å²	134	141.7 Å²	141.7	72%	0.717	77%	0.767	S	S	*	*			trans	84.9	96.5	149.7	-56.6	-28.2	0	0	0	116.3
63	E	40.5	Very low	48.1	Very low	175 Å²	175	141.7 Å²	141.7	82%	0.818	77%	0.767	S	S	*	*				60.9	124.8	72.7	-154.8	169.9	-138.8	0	0	111.5
64	D	50.8	Low	48.5	Very low	138 Å²	138	138 Å²	138	74%	0.738	75%	0.752	S	S	*	*			trans	84.4	92.5	-177.8	-61.7	-23.8	0	0	0	117.5
65	T	49.8	Very low	49	Very low	128 Å²	128	135.7 Å²	135.7	79%	0.785	75%	0.746	S	S	*	*				169.7	111	101.9	27.7	0	0	0	0	113.3
66	Y	52	Low	49.6	Very low	211 Å²	211	139.3 Å²	139.3	83%	0.827	74%	0.742	S	S	*	*			trans	29.6	106	144.2	-64.9	-86.2	0	0	0	120.9
67	E	42.2	Very low	50.1	Low	187 Å²	187	141.2 Å²	141.2	87%	0.874	73%	0.733	S	S	*	*				5.4	111.5	126.7	-58	176.7	-178.2	0	0	116.8
68	N	51.8	Low	50.5	Low	132 Å²	132	147.7 Å²	147.7	71%	0.706	74%	0.737	S	S	*	*			trans	-160.2	71.6	132.5	-143.6	-18.4	0	0	0	112.3	G70	N68-G70 VanDerWaalsContact C-N 3.33Å; N68-G70 PolarHBondContact O-N 3.25Å
69	E	48.1	Very low	50.8	Low	208 Å²	208	151.6 Å²	151.6	97%	0.972	74%	0.741	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.8	91.5	159.8	-66.6	-162.4	178.9	0	0	108.8
70	G	48.4	Very low	50.5	Low	63 Å²	63	151.4 Å²	151.4	65%	0.649	74%	0.739	S	S	*	*	T	Hydrogen-bonded Turn	trans	-175	-11.2	179.9	0	0	0	0	0	119.4	N68	N68-G70 VanDerWaalsContact C-N 3.33Å; N68-G70 PolarHBondContact O-N 3.25Å
71	V	51.8	Low	50.3	Low	52 Å²	52	147.6 Å²	147.6	32%	0.315	73%	0.733	S	S	.	*			trans	-130.4	40.5	-165.9	-154	0	0	0	0	113.9	N73 D74 F77	V71-N73 VanDerWaalsContact C-N 3.35Å; V71-D74 HydrophobicContact CG1-CB 3.76Å; V71-F77 HydrophobicContact CB-CD2 4.14Å; V71-F77 HydrophobicContact CB-CE2 4.13Å; V71-F77 HydrophobicContact CG1-CB 4.34Å; V71-F77 HydrophobicContact CG1-CD2 3.38Å; V71-F77 HydrophobicContact CG1-CE2 3.8Å; V71-F77 HydrophobicContact CG1-CG 3.98Å; V71-F77 HydrophobicContact CG2-CE2 4.37Å
72	L	57.5	Low	50.3	Low	159 Å²	159	149.4 Å²	149.4	83%	0.832	74%	0.741	S	S	*	*	S	Bend	trans	-82.9	-8.2	171.2	-90.1	145.7	0	0	0	113.8
73	N	54.2	Low	49.9	Very low	162 Å²	162	153.9 Å²	153.9	87%	0.866	75%	0.75	S	S	*	*	S	Bend	trans	-120.6	10.1	-174.4	-79.4	-27.3	0	0	0	115.2	V71 P75	V71-N73 VanDerWaalsContact C-N 3.35Å; N73-P75 VanDerWaalsContact O-CD 3.29Å; N73-P75 WeakPolarHBondContact O-CD 3.47Å
74	D	51.1	Low	50	Low	72 Å²	72	153.5 Å²	153.5	39%	0.385	75%	0.754	S	S	.	*			trans	-98.1	108.6	176.1	-162.7	-23.6	0	0	0	111.2	V71 Q76 F77	V71-D74 HydrophobicContact CG1-CB 3.76Å; D74-Q76 PolarHBondContact O-N 2.78Å; D74-Q76 WeakPolarHBondContact OD1-CB 3.31Å; D74-Q76 WeakPolarHBondContact OD1-CG 3.41Å; D74-Q76 PolarHBondContact OD1-N 2.76Å; D74-F77 WeakPolarHBondContact O-CB 3.11Å; D74-F77 PolarHBondContact O-N 2.97Å
75	P	58	Low	49.4	Very low	106 Å²	106	159.8 Å²	159.8	69%	0.688	78%	0.779	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.6	-7.3	177.5	22.8	-29.9	0	0	0	113.9	N73	N73-P75 VanDerWaalsContact O-CD 3.29Å; N73-P75 WeakPolarHBondContact O-CD 3.47Å
76	Q	55.1	Low	49.3	Very low	151 Å²	151	161.4 Å²	161.4	71%	0.706	78%	0.778	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.5	-18.3	173.2	-57.9	-166	-6.9	0	0	113.7	D74 Y78 R79	D74-Q76 PolarHBondContact O-N 2.78Å; D74-Q76 WeakPolarHBondContact OD1-CB 3.31Å; D74-Q76 WeakPolarHBondContact OD1-CG 3.41Å; D74-Q76 PolarHBondContact OD1-N 2.76Å; Q76-Y78 VanDerWaalsContact C-N 3.31Å; Q76-Y78 PolarHBondContact O-N 3.09Å; Q76-R79 PolarHBondContact O-N 3.01Å
77	F	54.6	Low	49.2	Very low	138 Å²	138	158.8 Å²	158.8	61%	0.605	78%	0.776	S	S	*	*	G	3₁₀ helix	trans	-67.3	-33.7	178.9	-139.5	-99.2	0	0	0	111.8	V71 D74 R79	V71-F77 HydrophobicContact CB-CD2 4.14Å; V71-F77 HydrophobicContact CB-CE2 4.13Å; V71-F77 HydrophobicContact CG1-CB 4.34Å; V71-F77 HydrophobicContact CG1-CD2 3.38Å; V71-F77 HydrophobicContact CG1-CE2 3.8Å; V71-F77 HydrophobicContact CG1-CG 3.98Å; V71-F77 HydrophobicContact CG2-CE2 4.37Å; D74-F77 WeakPolarHBondContact O-CB 3.11Å; D74-F77 PolarHBondContact O-N 2.97Å; F77-R79 PolarHBondContact O-N 3.15Å
78	Y	52.2	Low	49.6	Very low	203 Å²	203	157.2 Å²	157.2	80%	0.796	77%	0.77	S	S	*	*	G	3₁₀ helix	trans	-74.2	-4	178.2	-72.7	-81	0	0	0	115.1	Q76	Q76-Y78 VanDerWaalsContact C-N 3.31Å; Q76-Y78 PolarHBondContact O-N 3.09Å
79	R	50.8	Low	49.5	Very low	232 Å²	232	158.7 Å²	158.7	88%	0.875	77%	0.774	S	S	*	*	G	3₁₀ helix	trans	-103.9	1.3	-177.4	-92.8	-170.7	178.4	-138.5	0.4	115.1	Q76 F77	Q76-R79 PolarHBondContact O-N 3.01Å; F77-R79 PolarHBondContact O-N 3.15Å
80	R	46.5	Very low	49.6	Very low	232 Å²	232	155.6 Å²	155.6	88%	0.875	76%	0.762	S	S	*	*	S	Bend	trans	-136.3	102.1	-178.2	-99.7	174.4	150.3	176.9	-8.2	111.2
81	G	43.6	Very low	49.6	Very low	64 Å²	64	161.8 Å²	161.8	66%	0.66	77%	0.769	S	S	*	*			trans	112	52.3	136.3	0	0	0	0	0	119.2
82	H	48.5	Very low	49.5	Very low	190 Å²	190	169.6 Å²	169.6	88%	0.88	80%	0.802	S	S	*	*			trans	-137.4	56.3	156.4	-68.6	-89.7	0	0	0	111.1
83	Y	41.1	Very low	48.9	Very low	228 Å²	228	170.5 Å²	170.5	89%	0.894	80%	0.799	S	S	*	*			trans	-127.2	98.5	156.6	-67.1	-76.4	0	0	0	106.3
84	N	42.5	Very low	48.4	Very low	168 Å²	168	171.2 Å²	171.2	90%	0.898	79%	0.794	S	S	*	*			trans	-132.2	123	152.5	-85.3	-20.1	0	0	0	105.6
85	E	37	Very low	48.2	Very low	270 Å²	270	180.2 Å²	180.2	100%	1.262	83%	0.831	S	S	*	*			trans	-54.4	0	164.3	-67.5	174.1	152.8	0	0	112.1

Retrieved 85 of 85 residues in 15.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).