G4VTJ9_SCHMA Loading...

DUF4806 domain-containing protein

AlphaFold DB , UniProt , Accession G4VTJ9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 104 aa.

						>G4VTJ9_SCHMA|G4VTJ9
MFRRRDNMTTELITDIELTKPSQKFPKSRSNYRLGYTTISLDYKLLISLLNFRKYYQKLHLCIINVSVVRGNLVDVAQLCNWKSGQLVDTGSKVQHGKVQRSIN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.5	Very low	46.4	Very low	249 Å²	249	169.2 Å²	169.2	100%	1.227	79%	0.79	S	S	*	*				0	139.2	0	-163.4	173.5	-167	0	0	108.5
2	F	41.5	Very low	45.6	Very low	196 Å²	196	167.6 Å²	167.6	86%	0.86	79%	0.789	S	S	*	*			trans	-73.9	161.9	-169.7	-81.4	-97.6	0	0	0	114.7
3	R	51.7	Low	45.2	Very low	197 Å²	197	166 Å²	166	74%	0.743	79%	0.787	S	S	*	*			trans	105.8	134	151.9	-58.6	-175.1	-176.6	-179.2	2.1	114.2
4	R	51.5	Low	44.9	Very low	175 Å²	175	162.7 Å²	162.7	66%	0.66	78%	0.783	S	S	*	*			cis	-162.3	144.1	-0.8	-112.1	168.3	-170.2	169.5	-1.8	105.7	D6	R4-D6 PolarHBondContact O-N 3.34Å
5	R	41.6	Very low	45.2	Very low	243 Å²	243	160.4 Å²	160.4	92%	0.917	78%	0.776	S	S	*	*			trans	-72.1	111.1	158.9	-76.4	178	-179.6	163.8	-0.6	106.4
6	D	52.2	Low	45.6	Very low	124 Å²	124	160.7 Å²	160.7	66%	0.663	78%	0.781	S	S	*	*			trans	-119	99.7	161	-64.8	-41.2	0	0	0	104.5	R4	R4-D6 PolarHBondContact O-N 3.34Å
7	N	45.9	Very low	46.1	Very low	120 Å²	120	160.2 Å²	160.2	64%	0.642	78%	0.777	S	S	*	*				75.2	117.9	91.9	-91	-10	0	0	0	112.2
8	M	46	Very low	46.4	Very low	151 Å²	151	160.6 Å²	160.6	74%	0.744	78%	0.782	S	S	*	*			trans	56.3	126.3	138.7	-69.8	-176.6	-87.8	0	0	115.3
9	T	48.6	Very low	46.9	Very low	114 Å²	114	158.1 Å²	158.1	70%	0.699	78%	0.777	S	S	*	*				168.2	148.9	54.2	1.6	0	0	0	0	106.7
10	T	39.2	Very low	47.1	Very low	114 Å²	114	160.2 Å²	160.2	70%	0.699	78%	0.782	S	S	*	*			trans	29.8	125.6	144.6	50	0	0	0	0	120.9
11	E	44.3	Very low	47.1	Very low	178 Å²	178	158.5 Å²	158.5	83%	0.832	78%	0.783	S	S	*	*				160.7	103.3	129.3	-86.4	166	-159.2	0	0	108.7
12	L	37.5	Very low	47.1	Very low	150 Å²	150	152 Å²	152	79%	0.785	76%	0.762	S	S	*	*				59.9	100.7	94.8	-97.7	132.9	0	0	0	114.7
13	I	40.6	Very low	47.7	Very low	147 Å²	147	151.9 Å²	151.9	75%	0.754	76%	0.764	S	S	*	*			trans	56.3	103.3	140.5	-50.4	175.9	0	0	0	117.7
14	T	41.2	Very low	47.6	Very low	120 Å²	120	152 Å²	152	74%	0.736	77%	0.771	S	S	*	*			trans	-178.8	135.9	151.5	37.4	0	0	0	0	105
15	D	48.6	Very low	47.8	Very low	128 Å²	128	153.2 Å²	153.2	68%	0.684	78%	0.781	S	S	*	*			cis	-155.7	136.6	14.3	-81.2	-46.4	0	0	0	107.7	E17	D15-E17 VanDerWaalsContact C-N 3.29Å; D15-E17 HydrophobicContact CB-CG 4.32Å; D15-E17 PolarHBondContact O-N 3.3Å; D15-E17 VanDerWaalsContact O-N 3.08Å
16	I	51.7	Low	48.6	Very low	165 Å²	165	147.4 Å²	147.4	85%	0.846	77%	0.774	S	S	*	*			trans	-78.6	85.3	165.1	-61.7	168.9	0	0	0	106.4	L18	I16-L18 PolarHBondContact O-N 3.47Å
17	E	54.8	Low	48.3	Very low	153 Å²	153	151.8 Å²	151.8	72%	0.715	79%	0.788	S	S	*	*			trans	-76.8	99.6	171.9	-82	-167.6	151.7	0	0	110.5	D15 T19	D15-E17 VanDerWaalsContact C-N 3.29Å; D15-E17 HydrophobicContact CB-CG 4.32Å; D15-E17 PolarHBondContact O-N 3.3Å; D15-E17 VanDerWaalsContact O-N 3.08Å; E17-T19 VanDerWaalsContact C-N 3.35Å; E17-T19 PolarHBondContact O-N 2.9Å; E17-T19 VanDerWaalsContact O-N 3.11Å
18	L	51.2	Low	48.5	Very low	166 Å²	166	150.3 Å²	150.3	87%	0.869	79%	0.787	S	S	*	*			trans	-72.2	85.6	162	-80.7	159.5	0	0	0	109.6	I16	I16-L18 PolarHBondContact O-N 3.47Å
19	T	56.2	Low	48.6	Very low	113 Å²	113	155.7 Å²	155.7	69%	0.693	80%	0.799	S	S	*	*			trans	-119.4	100	172.6	42.1	0	0	0	0	111	E17	E17-T19 VanDerWaalsContact C-N 3.35Å; E17-T19 PolarHBondContact O-N 2.9Å; E17-T19 VanDerWaalsContact O-N 3.11Å
20	K	50.3	Low	48.9	Very low	201 Å²	201	153.3 Å²	153.3	87%	0.874	79%	0.787	S	S	*	*			trans	-79.1	161.1	148.8	-71.1	-179.1	178.8	175.3	0	107.1
21	P	47.3	Very low	49.1	Very low	124 Å²	124	155.9 Å²	155.9	81%	0.805	80%	0.796	S	S	*	*			cis	-142.6	-177	11.3	34.8	-11.9	0	0	0	114.6
22	S	46.5	Very low	49.4	Very low	113 Å²	113	157.2 Å²	157.2	79%	0.79	80%	0.795	S	S	*	*			trans	138.3	85	141.8	-168.9	0	0	0	0	112.4
23	Q	55	Low	50	Low	193 Å²	193	160.1 Å²	160.1	90%	0.902	80%	0.796	S	S	*	*			trans	-139.8	123.1	159.1	-118.3	176.6	1.7	0	0	109.7
24	K	49.9	Very low	50.5	Low	200 Å²	200	162.3 Å²	162.3	87%	0.87	81%	0.808	S	S	*	*	P	Polyproline II helix	trans	-60.5	131.3	-173.8	-63.7	172.3	178.2	178.1	0	110.6	P26	K24-P26 WeakPolarHBondContact O-CD 3.45Å
25	F	54.8	Low	50.9	Low	201 Å²	201	158.4 Å²	158.4	88%	0.882	79%	0.792	S	S	*	*	P	Polyproline II helix	trans	-65.8	125.5	172.2	-73.8	-85.5	0	0	0	111.1	K27	F25-K27 PolarHBondContact O-N 3.22Å
26	P	59.3	Low	51	Low	120 Å²	120	160.4 Å²	160.4	78%	0.779	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-74.9	117	162	28.5	-28.2	0	0	0	109.3	K24 S28	K24-P26 WeakPolarHBondContact O-CD 3.45Å; P26-S28 PolarHBondContact O-N 3.49Å; P26-S28 VanDerWaalsContact O-N 3.12Å
27	K	45.1	Very low	51.1	Low	217 Å²	217	158 Å²	158	94%	0.943	78%	0.784	S	S	*	*			trans	-68.4	99.2	162.9	-76.5	179.4	177.2	177.3	0	108.3	F25	F25-K27 PolarHBondContact O-N 3.22Å
28	S	49.5	Very low	51.1	Low	88 Å²	88	155.7 Å²	155.7	62%	0.615	78%	0.78	S	S	*	*			trans	-151	87.4	165.1	176.4	0	0	0	0	109.5	P26 S30	P26-S28 PolarHBondContact O-N 3.49Å; P26-S28 VanDerWaalsContact O-N 3.12Å; S28-S30 VanDerWaalsContact C-N 3.32Å; S28-S30 PolarHBondContact O-N 2.69Å; S28-S30 VanDerWaalsContact O-N 3.15Å; S28-S30 PolarHBondContact OG-OG 3.26Å
29	R	49.6	Very low	51.3	Low	265 Å²	265	152.9 Å²	152.9	100%	1	77%	0.765	S	S	*	*			trans	-79.1	86.7	165	-100.2	-177.8	166.7	-177.6	-3.7	107.7
30	S	53.7	Low	51.4	Low	64 Å²	64	149.4 Å²	149.4	45%	0.448	75%	0.746	S	S	.	*			trans	-112.5	132.7	167.2	47.3	0	0	0	0	109.2	S28 Y32	S28-S30 VanDerWaalsContact C-N 3.32Å; S28-S30 PolarHBondContact O-N 2.69Å; S28-S30 VanDerWaalsContact O-N 3.15Å; S28-S30 PolarHBondContact OG-OG 3.26Å; S30-Y32 PolarHBondContact O-N 3.16Å; S30-Y32 VanDerWaalsContact O-N 3.1Å
31	N	43.6	Very low	51.8	Low	168 Å²	168	145.3 Å²	145.3	90%	0.898	73%	0.732	S	S	*	*			trans	-57.1	104.6	-179.6	-66	-42.4	0	0	0	111.5
32	Y	51.9	Low	53	Low	205 Å²	205	144.4 Å²	144.4	80%	0.804	72%	0.721	S	S	*	*			trans	-119.6	88	168.5	-79.3	-81.8	0	0	0	110.8	S30	S30-Y32 PolarHBondContact O-N 3.16Å; S30-Y32 VanDerWaalsContact O-N 3.1Å
33	R	50.1	Low	54.7	Low	212 Å²	212	144.5 Å²	144.5	80%	0.8	71%	0.705	S	S	*	*			trans	19.3	109	137.4	-128.6	172.8	-176.5	-176.9	0.6	116.4	G35	R33-G35 PolarHBondContact O-N 3.09Å
34	L	50.8	Low	55.9	Low	192 Å²	192	141.1 Å²	141.1	100%	1.005	69%	0.687	S	S	*	*	S	Bend	trans	-63	94.6	156.4	-78.9	153.9	0	0	0	108.7
35	G	50	Low	57.4	Low	39 Å²	39	136.6 Å²	136.6	40%	0.402	67%	0.672	S	S	.	*			trans	-167	136.6	175.7	0	0	0	0	0	111.1	R33	R33-G35 PolarHBondContact O-N 3.09Å
36	Y	49.3	Very low	58.8	Low	170 Å²	170	132.2 Å²	132.2	67%	0.667	66%	0.657	S	S	*	*	S	Bend	trans	93.9	0.9	164.8	-47.5	-71.3	0	0	0	120.8	I39	Y36-I39 HydrophobicContact CD1-CD1 4.41Å
37	T	55.2	Low	60	Low	113 Å²	113	130.8 Å²	130.8	69%	0.693	64%	0.642	S	S	*	*	S	Bend	trans	-86.2	-36.3	175.4	49.7	0	0	0	0	114.2	S40	T37-S40 PolarHBondContact O-N 3.31Å; T37-S40 PolarHBondContact O-OG 3.4Å
38	T	54	Low	61.8	Low	105 Å²	105	124 Å²	124	64%	0.644	62%	0.622	S	S	*	*	S	Bend	trans	-72.2	-43	-179.3	46.9	0	0	0	0	113.4	S40 L41	T38-S40 PolarHBondContact O-N 3.33Å; T38-L41 PolarHBondContact O-N 3.48Å
39	I	56.4	Low	63.6	Low	107 Å²	107	125.3 Å²	125.3	55%	0.549	62%	0.621	S	S	.	*	H	α-helix	trans	-58	-27.1	177.4	-58.6	166.8	0	0	0	111.1	Y36 L41 Y43	Y36-I39 HydrophobicContact CD1-CD1 4.41Å; I39-L41 PolarHBondContact O-N 3.38Å; I39-Y43 WeakPolarHBondContact O-CD1 3.39Å
40	S	56.9	Low	65.5	Low	41 Å²	41	117.8 Å²	117.8	29%	0.287	60%	0.6	S	S	.	*	H	α-helix	trans	-74.3	-23.2	-174.8	80.4	0	0	0	0	115.2	T37 T38 Y43 K44	T37-S40 PolarHBondContact O-N 3.31Å; T37-S40 PolarHBondContact O-OG 3.4Å; T38-S40 PolarHBondContact O-N 3.33Å; S40-Y43 WeakPolarHBondContact O-CD1 3.48Å; S40-Y43 WeakPolarHBondContact O-CE1 3.46Å; S40-K44 WeakPolarHBondContact O-CG 3.2Å
41	L	59.5	Low	67	Low	114 Å²	114	119.1 Å²	119.1	60%	0.597	60%	0.602	S	S	*	*	H	α-helix	trans	-83.6	-38.7	178.1	-104.2	147.1	0	0	0	111.2	T38 I39 Y43 K44 L45	T38-L41 PolarHBondContact O-N 3.48Å; I39-L41 PolarHBondContact O-N 3.38Å; L41-Y43 PolarHBondContact O-N 3.21Å; L41-K44 PolarHBondContact O-N 3.49Å; L41-L45 PolarHBondContact O-N 3.35Å
42	D	72.4	Confident	69.1	Low	105 Å²	105	117.5 Å²	117.5	56%	0.561	59%	0.587	S	S	*	*	H	α-helix	trans	-65.8	-40.4	-178.3	-68.6	-24.2	0	0	0	112.7	K44 L45 L46	D42-K44 PolarHBondContact O-N 2.85Å; D42-L45 PolarHBondContact O-N 2.99Å; D42-L46 WeakPolarHBondContact O-CG 3.22Å; D42-L46 PolarHBondContact O-N 3.38Å; D42-L46 VanDerWaalsContact O-N 3.14Å
43	Y	81.3	Confident	70.7	Confident	115 Å²	115	116 Å²	116	45%	0.451	58%	0.58	S	S	.	*	H	α-helix	trans	-69.9	-31.6	178.9	82.9	-106.7	0	0	0	112.7	I39 S40 L41 L45 L46 I47	I39-Y43 WeakPolarHBondContact O-CD1 3.39Å; S40-Y43 WeakPolarHBondContact O-CD1 3.48Å; S40-Y43 WeakPolarHBondContact O-CE1 3.46Å; L41-Y43 PolarHBondContact O-N 3.21Å; Y43-L45 VanDerWaalsContact C-N 3.34Å; Y43-L46 PolarHBondContact O-N 2.75Å; Y43-I47 HydrophobicContact CD2-CD1 3.79Å; Y43-I47 HydrophobicContact CE2-CD1 4.25Å; Y43-I47 WeakPolarHBondContact O-CG1 3.45Å; Y43-I47 PolarHBondContact O-N 3.38Å
44	K	80.4	Confident	72.4	Confident	123 Å²	123	112.2 Å²	112.2	54%	0.535	57%	0.57	S	S	.	*	H	α-helix	trans	-65.4	-39.6	177.9	-74.2	178.7	-179.2	177.9	0	111.3	S40 L41 D42 S48	S40-K44 WeakPolarHBondContact O-CG 3.2Å; L41-K44 PolarHBondContact O-N 3.49Å; D42-K44 PolarHBondContact O-N 2.85Å; K44-S48 WeakPolarHBondContact O-CB 3.37Å; K44-S48 PolarHBondContact O-N 2.97Å
45	L	82.2	Confident	74	Confident	105 Å²	105	110.3 Å²	110.3	55%	0.55	55%	0.55	S	S	.	*	H	α-helix	trans	-65.4	-43.9	174.3	-71.1	169.3	0	0	0	111.3	L41 D42 Y43 I47 S48 L49	L41-L45 PolarHBondContact O-N 3.35Å; D42-L45 PolarHBondContact O-N 2.99Å; Y43-L45 VanDerWaalsContact C-N 3.34Å; L45-I47 PolarHBondContact O-N 3.12Å; L45-S48 WeakPolarHBondContact O-CB 3.49Å; L45-S48 PolarHBondContact O-N 3.21Å; L45-L49 WeakPolarHBondContact O-CG 3.46Å; L45-L49 PolarHBondContact O-N 3.46Å
46	L	84.5	Confident	75.7	Confident	108 Å²	108	115 Å²	115	57%	0.565	56%	0.557	S	S	*	*	H	α-helix	trans	-59.2	-45.8	176	-75	167.3	0	0	0	112.3	D42 Y43 S48 L49 L50	D42-L46 WeakPolarHBondContact O-CG 3.22Å; D42-L46 PolarHBondContact O-N 3.38Å; D42-L46 VanDerWaalsContact O-N 3.14Å; Y43-L46 PolarHBondContact O-N 2.75Å; L46-S48 VanDerWaalsContact C-N 3.33Å; L46-S48 PolarHBondContact O-N 3.07Å; L46-L49 PolarHBondContact O-N 3.45Å; L46-L50 WeakPolarHBondContact O-CG 3.38Å; L46-L50 PolarHBondContact O-N 3.23Å
47	I	83.5	Confident	77.4	Confident	91 Å²	91	111.9 Å²	111.9	47%	0.467	55%	0.549	S	S	.	.	H	α-helix	trans	-62	-42	176.2	-67.7	171.9	0	0	0	110.9	Y43 L45 L50 N51	Y43-I47 HydrophobicContact CD2-CD1 3.79Å; Y43-I47 HydrophobicContact CE2-CD1 4.25Å; Y43-I47 WeakPolarHBondContact O-CG1 3.45Å; Y43-I47 PolarHBondContact O-N 3.38Å; L45-I47 PolarHBondContact O-N 3.12Å; I47-L50 PolarHBondContact O-N 3.43Å; I47-N51 PolarHBondContact O-N 3.03Å; I47-N51 PolarHBondContact O-ND2 3.45Å
48	S	83.7	Confident	78.7	Confident	74 Å²	74	114 Å²	114	52%	0.517	55%	0.548	S	S	.	.	H	α-helix	trans	-61.1	-46.5	176.7	-171.5	0	0	0	0	112.1	K44 L45 L46 L50 N51 F52	K44-S48 WeakPolarHBondContact O-CB 3.37Å; K44-S48 PolarHBondContact O-N 2.97Å; L45-S48 WeakPolarHBondContact O-CB 3.49Å; L45-S48 PolarHBondContact O-N 3.21Å; L46-S48 VanDerWaalsContact C-N 3.33Å; L46-S48 PolarHBondContact O-N 3.07Å; S48-L50 PolarHBondContact O-N 3.5Å; S48-N51 PolarHBondContact O-N 3.35Å; S48-F52 WeakPolarHBondContact O-CB 3.39Å; S48-F52 PolarHBondContact O-N 2.9Å
49	L	87.7	Confident	80	Confident	115 Å²	115	112.3 Å²	112.3	60%	0.602	54%	0.535	S	S	*	.	H	α-helix	trans	-62.6	-40.4	177.4	-72.3	170	0	0	0	112.5	L45 L46 F52 R53	L45-L49 WeakPolarHBondContact O-CG 3.46Å; L45-L49 PolarHBondContact O-N 3.46Å; L46-L49 PolarHBondContact O-N 3.45Å; L49-F52 PolarHBondContact O-N 3.34Å; L49-R53 PolarHBondContact O-N 3.17Å
50	L	88.7	Confident	81.2	Confident	107 Å²	107	111.7 Å²	111.7	56%	0.56	53%	0.529	S	S	*	.	H	α-helix	trans	-64.8	-41	175.9	-72.3	173.7	0	0	0	112.1	L46 I47 S48 R53 K54	L46-L50 WeakPolarHBondContact O-CG 3.38Å; L46-L50 PolarHBondContact O-N 3.23Å; I47-L50 PolarHBondContact O-N 3.43Å; S48-L50 PolarHBondContact O-N 3.5Å; L50-R53 PolarHBondContact O-N 3.1Å; L50-K54 PolarHBondContact O-N 3.46Å; L50-K54 VanDerWaalsContact O-N 3.11Å
51	N	86	Confident	82	Confident	93 Å²	93	114.8 Å²	114.8	50%	0.497	54%	0.542	S	S	.	.	H	α-helix	trans	-66.4	-40.3	175.6	-76.7	-24	0	0	0	111.8	I47 S48 R53 K54 Y55	I47-N51 PolarHBondContact O-N 3.03Å; I47-N51 PolarHBondContact O-ND2 3.45Å; S48-N51 PolarHBondContact O-N 3.35Å; N51-R53 VanDerWaalsContact C-N 3.34Å; N51-R53 PolarHBondContact O-N 3.43Å; N51-K54 PolarHBondContact O-N 2.88Å; N51-Y55 WeakPolarHBondContact O-CB 3.47Å; N51-Y55 PolarHBondContact O-N 2.99Å
52	F	86	Confident	83	Confident	133 Å²	133	112.9 Å²	112.9	58%	0.583	54%	0.537	S	S	*	.	H	α-helix	trans	-59.5	-43.7	174.2	-176.4	-99.2	0	0	0	111.7	S48 L49 K54 Y55 Y56	S48-F52 WeakPolarHBondContact O-CB 3.39Å; S48-F52 PolarHBondContact O-N 2.9Å; L49-F52 PolarHBondContact O-N 3.34Å; F52-K54 PolarHBondContact O-N 2.96Å; F52-Y55 PolarHBondContact O-N 3.21Å; F52-Y56 WeakPolarHBondContact O-CB 3.41Å; F52-Y56 PolarHBondContact O-N 3.24Å
53	R	85.8	Confident	83.2	Confident	173 Å²	173	112.5 Å²	112.5	65%	0.653	53%	0.534	S	S	*	.	H	α-helix	trans	-61.6	-43.5	176.1	-173	174.4	178.8	168.4	0.5	112.5	L49 L50 N51 Y55 Y56 Q57	L49-R53 PolarHBondContact O-N 3.17Å; L50-R53 PolarHBondContact O-N 3.1Å; N51-R53 VanDerWaalsContact C-N 3.34Å; N51-R53 PolarHBondContact O-N 3.43Å; R53-Y55 VanDerWaalsContact C-N 3.35Å; R53-Y56 PolarHBondContact O-N 3.42Å; R53-Q57 WeakPolarHBondContact O-CG 3.4Å; R53-Q57 PolarHBondContact O-N 3.17Å; R53-Q57 VanDerWaalsContact O-N 3.08Å
54	K	85.7	Confident	82.9	Confident	133 Å²	133	110.5 Å²	110.5	58%	0.578	53%	0.531	S	S	*	.	H	α-helix	trans	-62.8	-41.1	175.4	-73.1	-179.4	-178.9	178.3	0	112	L50 N51 F52 K58	L50-K54 PolarHBondContact O-N 3.46Å; L50-K54 VanDerWaalsContact O-N 3.11Å; N51-K54 PolarHBondContact O-N 2.88Å; F52-K54 PolarHBondContact O-N 2.96Å; K54-K58 PolarHBondContact O-N 3.42Å
55	Y	85.7	Confident	82.4	Confident	152 Å²	152	109.4 Å²	109.4	60%	0.596	53%	0.531	S	S	*	.	H	α-helix	trans	-64	-46	176.8	-178.3	-96	0	0	0	111.5	N51 F52 R53 Q57 K58 L59	N51-Y55 WeakPolarHBondContact O-CB 3.47Å; N51-Y55 PolarHBondContact O-N 2.99Å; F52-Y55 PolarHBondContact O-N 3.21Å; R53-Y55 VanDerWaalsContact C-N 3.35Å; Y55-Q57 VanDerWaalsContact C-N 3.33Å; Y55-Q57 PolarHBondContact O-N 3.08Å; Y55-K58 PolarHBondContact O-N 2.86Å; Y55-L59 HydrophobicContact CE1-CD1 4.17Å; Y55-L59 PolarHBondContact O-N 3.35Å
56	Y	84.6	Confident	81.7	Confident	137 Å²	137	108.1 Å²	108.1	54%	0.537	53%	0.527	S	S	.	.	H	α-helix	trans	-61.5	-39.4	179.2	-166.3	-94	0	0	0	112.5	F52 R53 L59 H60	F52-Y56 WeakPolarHBondContact O-CB 3.41Å; F52-Y56 PolarHBondContact O-N 3.24Å; R53-Y56 PolarHBondContact O-N 3.42Å; Y56-L59 PolarHBondContact O-N 2.95Å; Y56-H60 WeakPolarHBondContact O-CB 3.44Å; Y56-H60 PolarHBondContact O-N 2.99Å
57	Q	85.7	Confident	80.5	Confident	106 Å²	106	106.4 Å²	106.4	50%	0.495	52%	0.524	S	S	.	.	H	α-helix	trans	-63.7	-42.9	175.3	-74.6	176.2	-25.2	0	0	112.6	R53 Y55 L59 H60 L61	R53-Q57 WeakPolarHBondContact O-CG 3.4Å; R53-Q57 PolarHBondContact O-N 3.17Å; R53-Q57 VanDerWaalsContact O-N 3.08Å; Y55-Q57 VanDerWaalsContact C-N 3.33Å; Y55-Q57 PolarHBondContact O-N 3.08Å; Q57-L59 VanDerWaalsContact C-N 3.34Å; Q57-H60 PolarHBondContact O-N 3.39Å; Q57-L61 WeakPolarHBondContact O-CG 3.47Å; Q57-L61 PolarHBondContact O-N 3.46Å; Q57-L61 VanDerWaalsContact O-N 3.12Å
58	K	81.3	Confident	79.4	Confident	157 Å²	157	106.5 Å²	106.5	68%	0.683	53%	0.529	S	S	*	.	H	α-helix	trans	-64.7	-39.7	175.7	-71.5	-177.8	178.3	-173.9	0	111.8	K54 Y55 L61 C62	K54-K58 PolarHBondContact O-N 3.42Å; Y55-K58 PolarHBondContact O-N 2.86Å; K58-L61 PolarHBondContact O-N 3.36Å; K58-C62 WeakPolarHBondContact O-CB 3.36Å; K58-C62 PolarHBondContact O-N 2.93Å
59	L	81.3	Confident	78.3	Confident	70 Å²	70	109 Å²	109	37%	0.366	54%	0.541	S	S	.	.	H	α-helix	trans	-63.7	-44.4	176.6	-168.3	110.7	0	0	0	111.4	Y55 Y56 Q57 L61 C62 I63	Y55-L59 HydrophobicContact CE1-CD1 4.17Å; Y55-L59 PolarHBondContact O-N 3.35Å; Y56-L59 PolarHBondContact O-N 2.95Å; Q57-L59 VanDerWaalsContact C-N 3.34Å; L59-L61 PolarHBondContact O-N 3.11Å; L59-C62 WeakPolarHBondContact O-CB 3.33Å; L59-C62 PolarHBondContact O-N 3.28Å; L59-I63 HydrophobicContact CD2-CD1 3.87Å; L59-I63 HydrophobicContact CG-CD1 4.27Å; L59-I63 WeakPolarHBondContact O-CG1 3.49Å; L59-I63 PolarHBondContact O-N 3.39Å
60	H	81.8	Confident	76.8	Confident	93 Å²	93	114.4 Å²	114.4	43%	0.431	55%	0.553	S	S	.	*	H	α-helix	trans	-61.3	-42.1	177.4	-169.9	-87.4	0	0	0	112.2	Y56 Q57 I63 I64	Y56-H60 WeakPolarHBondContact O-CB 3.44Å; Y56-H60 PolarHBondContact O-N 2.99Å; Q57-H60 PolarHBondContact O-N 3.39Å; H60-I63 PolarHBondContact O-N 3.4Å; H60-I64 WeakPolarHBondContact ND1-CD1 3.45Å; H60-I64 WeakPolarHBondContact O-CG1 3.44Å; H60-I64 PolarHBondContact O-N 3.46Å; H60-I64 VanDerWaalsContact O-N 3.1Å
61	L	75.1	Confident	74.8	Confident	107 Å²	107	110.9 Å²	110.9	56%	0.56	54%	0.542	S	S	*	.	H	α-helix	trans	-65.6	-36.6	174.2	-73.1	167.3	0	0	0	112.5	Q57 K58 L59 I64 N65	Q57-L61 WeakPolarHBondContact O-CG 3.47Å; Q57-L61 PolarHBondContact O-N 3.46Å; Q57-L61 VanDerWaalsContact O-N 3.12Å; K58-L61 PolarHBondContact O-N 3.36Å; L59-L61 PolarHBondContact O-N 3.11Å; L61-I64 PolarHBondContact O-N 3.47Å; L61-N65 WeakPolarHBondContact O-CB 3.2Å; L61-N65 PolarHBondContact O-N 3.27Å
62	C	79.3	Confident	73.1	Confident	73 Å²	73	113.6 Å²	113.6	49%	0.493	56%	0.557	S	S	.	*	H	α-helix	trans	-64.2	-45.6	175.3	-173	0	0	0	0	111.6	K58 L59 I64 N65 V66	K58-C62 WeakPolarHBondContact O-CB 3.36Å; K58-C62 PolarHBondContact O-N 2.93Å; L59-C62 WeakPolarHBondContact O-CB 3.33Å; L59-C62 PolarHBondContact O-N 3.28Å; C62-I64 VanDerWaalsContact C-N 3.35Å; C62-I64 PolarHBondContact O-N 3.46Å; C62-N65 PolarHBondContact O-N 3.03Å; C62-V66 WeakPolarHBondContact O-CG2 3.35Å; C62-V66 PolarHBondContact O-N 2.91Å
63	I	76.2	Confident	71.5	Confident	97 Å²	97	113.7 Å²	113.7	50%	0.497	56%	0.563	S	S	.	*	H	α-helix	trans	-60.6	-45.7	177.8	-66.8	165.6	0	0	0	110.3	L59 H60 N65 V66 S67	L59-I63 HydrophobicContact CD2-CD1 3.87Å; L59-I63 HydrophobicContact CG-CD1 4.27Å; L59-I63 WeakPolarHBondContact O-CG1 3.49Å; L59-I63 PolarHBondContact O-N 3.39Å; H60-I63 PolarHBondContact O-N 3.4Å; I63-N65 PolarHBondContact O-N 3.25Å; I63-V66 PolarHBondContact O-N 2.89Å; I63-S67 WeakPolarHBondContact O-CB 3.37Å; I63-S67 PolarHBondContact O-N 3Å; I63-S67 PolarHBondContact O-OG 3.33Å; I63-S67 VanDerWaalsContact O-OG 3.07Å
64	I	76.5	Confident	69.7	Low	74 Å²	74	111.6 Å²	111.6	38%	0.379	57%	0.569	S	S	.	*	H	α-helix	trans	-59.1	-47.1	175.5	-67.7	167.3	0	0	0	110.8	H60 L61 C62 V66 S67 V68	H60-I64 WeakPolarHBondContact ND1-CD1 3.45Å; H60-I64 WeakPolarHBondContact O-CG1 3.44Å; H60-I64 PolarHBondContact O-N 3.46Å; H60-I64 VanDerWaalsContact O-N 3.1Å; L61-I64 PolarHBondContact O-N 3.47Å; C62-I64 VanDerWaalsContact C-N 3.35Å; C62-I64 PolarHBondContact O-N 3.46Å; I64-V66 PolarHBondContact O-N 3.38Å; I64-S67 WeakPolarHBondContact O-CB 3.35Å; I64-S67 PolarHBondContact O-N 2.9Å; I64-V68 HydrophobicContact CG2-CG2 4.18Å; I64-V68 WeakPolarHBondContact O-CB 3.44Å; I64-V68 WeakPolarHBondContact O-CG2 3.43Å; I64-V68 PolarHBondContact O-N 2.96Å
65	N	69.9	Low	68.2	Low	100 Å²	100	109.3 Å²	109.3	54%	0.535	56%	0.563	S	S	.	*	H	α-helix	trans	-63.2	-40	-179.6	-76.4	-9.6	0	0	0	112.4	L61 C62 I63 V68 V69	L61-N65 WeakPolarHBondContact O-CB 3.2Å; L61-N65 PolarHBondContact O-N 3.27Å; C62-N65 PolarHBondContact O-N 3.03Å; I63-N65 PolarHBondContact O-N 3.25Å; N65-V68 PolarHBondContact O-N 3.47Å; N65-V69 VanDerWaalsContact O-CG2 3.22Å; N65-V69 WeakPolarHBondContact O-CG2 3.39Å; N65-V69 PolarHBondContact O-N 3.46Å
66	V	66.6	Low	66.6	Low	77 Å²	77	106.6 Å²	106.6	47%	0.467	56%	0.562	S	S	.	*	H	α-helix	trans	-67.5	-40.1	175.7	174	0	0	0	0	111.1	C62 I63 I64 V68 V69 R70	C62-V66 WeakPolarHBondContact O-CG2 3.35Å; C62-V66 PolarHBondContact O-N 2.91Å; I63-V66 PolarHBondContact O-N 2.89Å; I64-V66 PolarHBondContact O-N 3.38Å; V66-V68 VanDerWaalsContact C-N 3.33Å; V66-V68 PolarHBondContact O-N 3.46Å; V66-V69 PolarHBondContact O-N 3.34Å; V66-R70 PolarHBondContact O-N 3.5Å
67	S	60.4	Low	65.1	Low	72 Å²	72	103.6 Å²	103.6	50%	0.503	57%	0.565	S	S	.	*	H	α-helix	trans	-62.2	-39.1	174	-68	0	0	0	0	112.2	I63 I64	I63-S67 WeakPolarHBondContact O-CB 3.37Å; I63-S67 PolarHBondContact O-N 3Å; I63-S67 PolarHBondContact O-OG 3.33Å; I63-S67 VanDerWaalsContact O-OG 3.07Å; I64-S67 WeakPolarHBondContact O-CB 3.35Å; I64-S67 PolarHBondContact O-N 2.9Å
68	V	58.5	Low	63.7	Low	94 Å²	94	104.1 Å²	104.1	57%	0.57	57%	0.568	S	S	*	*	H	α-helix	trans	-70	-34	177.8	170.6	0	0	0	0	112.1	I64 N65 V66	I64-V68 HydrophobicContact CG2-CG2 4.18Å; I64-V68 WeakPolarHBondContact O-CB 3.44Å; I64-V68 WeakPolarHBondContact O-CG2 3.43Å; I64-V68 PolarHBondContact O-N 2.96Å; N65-V68 PolarHBondContact O-N 3.47Å; V66-V68 VanDerWaalsContact C-N 3.33Å; V66-V68 PolarHBondContact O-N 3.46Å
69	V	61.1	Low	62.1	Low	126 Å²	126	102.5 Å²	102.5	76%	0.764	57%	0.566	S	S	*	*	H	α-helix	trans	-79.2	-26.8	-178.7	173	0	0	0	0	113	N65 V66	N65-V69 VanDerWaalsContact O-CG2 3.22Å; N65-V69 WeakPolarHBondContact O-CG2 3.39Å; N65-V69 PolarHBondContact O-N 3.46Å; V66-V69 PolarHBondContact O-N 3.34Å
70	R	55.9	Low	60.7	Low	229 Å²	229	103.2 Å²	103.2	86%	0.864	58%	0.576	S	S	*	*	H	α-helix	trans	-94.6	-6.2	-176.1	-88.1	-171.8	172	-174.9	-1.4	116.4	V66	V66-R70 PolarHBondContact O-N 3.5Å
71	G	46.9	Very low	59.2	Low	32 Å²	32	104.3 Å²	104.3	33%	0.33	59%	0.585	S	S	.	*			trans	-160.8	117.6	175.4	0	0	0	0	0	109.6
72	N	51.4	Low	57.9	Low	150 Å²	150	110.1 Å²	110.1	80%	0.802	60%	0.599	S	S	*	*				10.1	98.6	80.8	-163.6	22.2	0	0	0	111.5
73	L	52.7	Low	56.7	Low	136 Å²	136	115.6 Å²	115.6	71%	0.712	62%	0.615	S	S	*	*			trans	-177.7	138.5	136.1	-88.8	144.6	0	0	0	106	D75	L73-D75 PolarHBondContact O-N 3.14Å
74	V	47.7	Very low	55.3	Low	128 Å²	128	113.6 Å²	113.6	78%	0.776	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.3	17.8	-170.3	165.6	0	0	0	0	113.9
75	D	53.1	Low	53.7	Low	86 Å²	86	114.2 Å²	114.2	46%	0.46	63%	0.634	S	S	.	*	T	Hydrogen-bonded Turn	trans	-104.8	-19.1	-161.4	-97.1	-18.3	0	0	0	116.7	L73 A77 Q78 L79	L73-D75 PolarHBondContact O-N 3.14Å; D75-A77 VanDerWaalsContact C-N 3.29Å; D75-A77 PolarHBondContact O-N 3.2Å; D75-Q78 PolarHBondContact O-N 3.04Å; D75-Q78 VanDerWaalsContact O-N 3.09Å; D75-Q78 PolarHBondContact OD1-OE1 3.06Å; D75-L79 PolarHBondContact O-N 3.46Å
76	V	53.1	Low	52.4	Low	95 Å²	95	117.3 Å²	117.3	58%	0.576	65%	0.646	S	S	*	*	H	α-helix	trans	-71.2	-27.9	-177.6	-178.1	0	0	0	0	111.9	Q78 L79 C80	V76-Q78 VanDerWaalsContact C-N 3.33Å; V76-L79 PolarHBondContact O-N 3.43Å; V76-C80 PolarHBondContact O-N 3.36Å
77	A	53.3	Low	51.2	Low	73 Å²	73	121 Å²	121	60%	0.603	66%	0.661	S	S	*	*	H	α-helix	trans	-67.8	-32.9	170.5	0	0	0	0	0	112.1	D75	D75-A77 VanDerWaalsContact C-N 3.29Å; D75-A77 PolarHBondContact O-N 3.2Å
78	Q	55.1	Low	50.5	Low	118 Å²	118	123.9 Å²	123.9	55%	0.551	68%	0.676	S	S	*	*	H	α-helix	trans	-74.3	-32.6	174.5	-63.9	-169.1	-10.4	0	0	111.8	D75 V76 N81 W82	D75-Q78 PolarHBondContact O-N 3.04Å; D75-Q78 VanDerWaalsContact O-N 3.09Å; D75-Q78 PolarHBondContact OD1-OE1 3.06Å; V76-Q78 VanDerWaalsContact C-N 3.33Å; Q78-N81 PolarHBondContact O-N 3.47Å; Q78-W82 PolarHBondContact O-N 3.23Å
79	L	48.9	Very low	49.8	Very low	122 Å²	122	126.4 Å²	126.4	64%	0.639	69%	0.686	S	S	*	*	H	α-helix	trans	-72.1	-32	179	-134.5	89	0	0	0	113.7	D75 V76 N81 W82	D75-L79 PolarHBondContact O-N 3.46Å; V76-L79 PolarHBondContact O-N 3.43Å; L79-N81 VanDerWaalsContact C-N 3.35Å; L79-W82 PolarHBondContact O-N 2.99Å
80	C	51.2	Low	49.5	Very low	86 Å²	86	126 Å²	126	58%	0.581	68%	0.684	S	S	*	*	H	α-helix	trans	-70.7	-30.6	172.7	-84.9	0	0	0	0	112.7	V76 W82 K83	V76-C80 PolarHBondContact O-N 3.36Å; C80-W82 PolarHBondContact O-N 2.76Å; C80-K83 PolarHBondContact O-N 3.1Å
81	N	50.6	Low	49	Very low	116 Å²	116	118.5 Å²	118.5	62%	0.62	68%	0.678	S	S	*	*	H	α-helix	trans	-71.8	-12.2	175	-76.8	-7.5	0	0	0	113.6	Q78 L79 S84	Q78-N81 PolarHBondContact O-N 3.47Å; L79-N81 VanDerWaalsContact C-N 3.35Å; N81-S84 VanDerWaalsContact O-O 3.13Å
82	W	48.3	Very low	49.1	Very low	228 Å²	228	121 Å²	121	86%	0.864	69%	0.69	S	S	*	*	H	α-helix	trans	-85.9	-22	172.4	-93.5	20.2	0	0	0	114.1	Q78 L79 C80	Q78-W82 PolarHBondContact O-N 3.23Å; L79-W82 PolarHBondContact O-N 2.99Å; C80-W82 PolarHBondContact O-N 2.76Å
83	K	53.1	Low	49	Very low	189 Å²	189	123.6 Å²	123.6	82%	0.822	69%	0.694	S	S	*	*	H	α-helix	trans	-85.7	-15.6	178.4	-81.6	-165.1	176.2	-176.7	0	114	C80	C80-K83 PolarHBondContact O-N 3.1Å
84	S	46	Very low	48.9	Very low	55 Å²	55	121.4 Å²	121.4	39%	0.385	69%	0.687	S	S	.	*	S	Bend	trans	-103	103.2	166.4	47.7	0	0	0	0	106.5	N81 Q86	N81-S84 VanDerWaalsContact O-O 3.13Å; S84-Q86 PolarHBondContact O-N 3.37Å
85	G	44.5	Very low	49	Very low	87 Å²	87	122.9 Å²	122.9	90%	0.897	69%	0.685	S	S	*	*			trans	-67.1	51.9	178.7	0	0	0	0	0	113.1
86	Q	41.9	Very low	48.8	Very low	165 Å²	165	127.3 Å²	127.3	77%	0.771	70%	0.703	S	S	*	*			trans	-116.1	106.9	-174	-146	169	10.8	0	0	107.7	S84 V88	S84-Q86 PolarHBondContact O-N 3.37Å; Q86-V88 PolarHBondContact O-N 3.15Å
87	L	41.4	Very low	48.9	Very low	153 Å²	153	126.5 Å²	126.5	80%	0.801	71%	0.713	S	S	*	*			trans	-28.6	126.3	173.8	-79.1	85.8	0	0	0	114
88	V	46.1	Very low	49.4	Very low	133 Å²	133	130.9 Å²	130.9	81%	0.806	72%	0.719	S	S	*	*			trans	-136.7	99.2	131.6	-173.7	0	0	0	0	108.6	Q86 T90	Q86-V88 PolarHBondContact O-N 3.15Å; V88-T90 PolarHBondContact O-N 3.12Å
89	D	43	Very low	49.5	Very low	148 Å²	148	130.3 Å²	130.3	79%	0.791	72%	0.723	S	S	*	*			trans	-50.2	111.8	162.7	-139.9	-11.8	0	0	0	109.5
90	T	55.8	Low	49.6	Very low	117 Å²	117	132.6 Å²	132.6	72%	0.718	73%	0.73	S	S	*	*			trans	-177.7	78.7	157.9	27	0	0	0	0	111.6	V88 S92	V88-T90 PolarHBondContact O-N 3.12Å; T90-S92 PolarHBondContact O-N 3.39Å
91	G	45.9	Very low	49.9	Very low	71 Å²	71	138.5 Å²	138.5	73%	0.732	74%	0.741	S	S	*	*				56.7	19.9	122.9	0	0	0	0	0	122.4
92	S	48.5	Very low	50.4	Low	84 Å²	84	137.5 Å²	137.5	59%	0.587	74%	0.743	S	S	*	*			trans	-128.6	102.5	178.3	-58.9	0	0	0	0	112.9	T90	T90-S92 PolarHBondContact O-N 3.39Å
93	K	48.4	Very low	51.2	Low	205 Å²	205	133.9 Å²	133.9	89%	0.891	74%	0.738	S	S	*	*			trans	-86.1	114	166	-76.4	-176.6	179.6	176.7	0	108.9	Q95	K93-Q95 PolarHBondContact O-N 3.11Å
94	V	51.4	Low	50.7	Low	91 Å²	91	135.7 Å²	135.7	55%	0.552	76%	0.757	S	S	*	*			trans	-87.3	106.2	170	-178	0	0	0	0	108.1	V99	V94-V99 HydrophobicContact CG2-CG2 4.3Å
95	Q	48.6	Very low	51	Low	159 Å²	159	139.7 Å²	139.7	74%	0.743	78%	0.776	S	S	*	*	B	Isolated β-bridge	trans	-108.5	120.8	169.3	-120.8	-179.4	-3.5	0	0	108.3	K93	K93-Q95 PolarHBondContact O-N 3.11Å
96	H	50.2	Low	51.3	Low	179 Å²	179	142.5 Å²	142.5	83%	0.829	77%	0.769	S	S	*	*	T	Hydrogen-bonded Turn	trans	63.6	46.9	167.1	-63.8	47.4	0	0	0	116.4	K98	H96-K98 VanDerWaalsContact C-N 3.26Å; H96-K98 PolarHBondContact O-N 3.18Å; H96-K98 VanDerWaalsContact O-N 3.16Å
97	G	54.8	Low	51.8	Low	77 Å²	77	141.2 Å²	141.2	79%	0.794	77%	0.769	S	S	*	*	T	Hydrogen-bonded Turn	trans	71.9	12.2	164.3	0	0	0	0	0	115.9
98	K	64.8	Low	52.4	Low	166 Å²	166	140.5 Å²	140.5	72%	0.722	77%	0.767	S	S	*	*	B	Isolated β-bridge	trans	-122.2	120.6	166.7	-73.9	-176.9	178.4	178.5	0	109.5	H96 Q100	H96-K98 VanDerWaalsContact C-N 3.26Å; H96-K98 PolarHBondContact O-N 3.18Å; H96-K98 VanDerWaalsContact O-N 3.16Å; K98-Q100 PolarHBondContact O-N 3.08Å
99	V	56.4	Low	52.8	Low	106 Å²	106	141 Å²	141	64%	0.642	77%	0.765	S	S	*	*			trans	-75.7	102.8	169.4	178.8	0	0	0	0	107.5	V94 R101	V94-V99 HydrophobicContact CG2-CG2 4.3Å; V99-R101 HydrophobicContact CG1-CG 4.47Å
100	Q	51.1	Low	53.5	Low	169 Å²	169	140.5 Å²	140.5	79%	0.79	76%	0.763	S	S	*	*			trans	-84.3	114.5	165.1	-80.3	-178.3	-13.2	0	0	108.4	K98	K98-Q100 PolarHBondContact O-N 3.08Å
101	R	57.7	Low	53.3	Low	211 Å²	211	142.2 Å²	142.2	80%	0.796	77%	0.766	S	S	*	*			trans	-83.4	109.4	163.7	-69.4	-178.5	176.5	174.7	-1.3	107	V99 I103	V99-R101 HydrophobicContact CG1-CG 4.47Å; R101-I103 PolarHBondContact O-N 3.38Å
102	S	60	Low	53.9	Low	95 Å²	95	147.7 Å²	147.7	66%	0.664	77%	0.769	S	S	*	*			trans	-72.5	112.6	161.5	50.5	0	0	0	0	107.4
103	I	65	Low	54.3	Low	151 Å²	151	153 Å²	153	77%	0.774	78%	0.784	S	S	*	*			trans	-95.9	117	165.9	-62.8	171.9	0	0	0	105	R101	R101-I103 PolarHBondContact O-N 3.38Å
104	N	43.8	Very low	54.9	Low	227 Å²	227	148.3 Å²	148.3	100%	1.214	78%	0.775	S	S	*	*			trans	78.3	0	-169.3	-71.8	-9.9	0	0	0	116.9

Retrieved 104 of 104 residues in 46.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).