G7MDT1_MACMU Loading...

Protein JTB

Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Increases AURKB activity. Inhibits apoptosis induced by TGFB1. Overexpression induces swelling of mitochondria and reduces mitochondrial membrane potential.

AlphaFold DB , UniProt , Accession G7MDT1, Species MACMU (Macaca mulatta, Rhesus macaque), Gene JTB, Length 146 aa.

						>G7MDT1_MACMU|G7MDT1|JTB
MPAGSGRHGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVTTECSPCSNFQAKTTPECGPTGYVEKITCSSSKRIEFKSCRSALMEQHLFWKFEGAVVFVALIFACLVIIRQRQLDRKALEKVRKQIESI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40	Very low	43.8	Very low	247 Å²	247	137.2 Å²	137.2	100%	1.217	84%	0.837	S	S	*	*				0	108.9	0	-66.7	-179.1	172.1	0	0	108.4
2	P	46.1	Very low	44.9	Very low	136 Å²	136	139.8 Å²	139.8	88%	0.883	83%	0.833	S	S	*	*			trans	-109.3	147.1	171	23.7	-6	0	0	0	113
3	A	40.4	Very low	45.9	Very low	100 Å²	100	131.7 Å²	131.7	83%	0.826	80%	0.796	S	S	*	*			trans	-58.7	134.8	-174.7	0	0	0	0	0	114.6	S5	A3-S5 PolarHBondContact O-N 3.5Å
4	G	37.7	Very low	47.3	Very low	82 Å²	82	137.4 Å²	137.4	85%	0.845	80%	0.797	S	S	*	*			trans	-79.4	112.1	162.7	0	0	0	0	0	110.2
5	S	41.4	Very low	48.4	Very low	117 Å²	117	136.1 Å²	136.1	82%	0.818	78%	0.78	S	S	*	*			trans	-90.7	109.2	172.9	-166	0	0	0	0	109.6	A3 R7	A3-S5 PolarHBondContact O-N 3.5Å; S5-R7 PolarHBondContact O-N 3.45Å
6	G	41.9	Very low	49.8	Very low	64 Å²	64	133 Å²	133	66%	0.66	76%	0.759	S	S	*	*			trans	-67.5	118.7	177.3	0	0	0	0	0	111.6	H8	G6-H8 PolarHBondContact O-N 3.35Å; G6-H8 VanDerWaalsContact O-N 3.16Å
7	R	45.6	Very low	50.9	Low	253 Å²	253	129.4 Å²	129.4	96%	0.955	74%	0.743	S	S	*	*			trans	-80.4	90.3	170.1	-82.5	-177	166.4	-174	-4.3	110.1	S5 G9	S5-R7 PolarHBondContact O-N 3.45Å; R7-G9 PolarHBondContact O-N 3.36Å
8	H	43	Very low	52.3	Low	193 Å²	193	132.2 Å²	132.2	89%	0.894	74%	0.74	S	S	*	*			trans	-71.9	98.9	161.1	-86.9	-94.9	0	0	0	109.6	G6	G6-H8 PolarHBondContact O-N 3.35Å; G6-H8 VanDerWaalsContact O-N 3.16Å
9	G	44.9	Very low	53.4	Low	64 Å²	64	129.7 Å²	129.7	66%	0.66	72%	0.724	S	S	*	*			trans	-137.7	53.1	176.4	0	0	0	0	0	111.8	R7	R7-G9 PolarHBondContact O-N 3.36Å
10	L	49.3	Very low	54.3	Low	150 Å²	150	125.4 Å²	125.4	79%	0.785	70%	0.699	S	S	*	*			trans	-147.9	29.7	178.6	-140.4	92.5	0	0	0	118.4
11	P	51.9	Low	55	Low	103 Å²	103	122.2 Å²	122.2	67%	0.669	69%	0.685	S	S	*	*	S	Bend	trans	-95.9	-27.5	172.2	32.7	-31.2	0	0	0	114.5
12	Q	56.2	Low	56.5	Low	169 Å²	169	112.3 Å²	112.3	79%	0.79	64%	0.642	S	S	*	*	H	α-helix	trans	-79.1	-35.7	-164.6	-150.3	166.6	7.7	0	0	114.2	H15 L16	Q12-H15 PolarHBondContact O-N 3.38Å; Q12-L16 PolarHBondContact O-N 3.21Å; Q12-L16 VanDerWaalsContact O-N 3.08Å
13	G	58.7	Low	57.7	Low	34 Å²	34	112.2 Å²	112.2	35%	0.351	63%	0.628	S	S	.	*	H	α-helix	trans	-73.4	-28.2	-179.2	0	0	0	0	0	114.3	C17	G13-C17 WeakPolarHBondContact O-CB 3.48Å; G13-C17 PolarHBondContact O-N 3.4Å; G13-C17 VanDerWaalsContact O-N 3.12Å
14	R	64.6	Low	58.9	Low	212 Å²	212	110 Å²	110	80%	0.8	61%	0.605	S	S	*	*	H	α-helix	trans	-73	-37.9	176.2	-156.1	171.1	84.6	176.6	6.4	110.5	W18	R14-W18 VanDerWaalsContact O-CB 3.26Å; R14-W18 WeakPolarHBondContact O-CB 3.34Å; R14-W18 PolarHBondContact O-N 3.22Å
15	H	65.1	Low	60.2	Low	117 Å²	117	112 Å²	112	54%	0.542	60%	0.595	S	S	.	*	H	α-helix	trans	-67.4	-42.9	175.2	-155	-93.5	0	0	0	111.7	Q12 W18 L19	Q12-H15 PolarHBondContact O-N 3.38Å; H15-W18 PolarHBondContact O-N 2.87Å; H15-L19 WeakPolarHBondContact ND1-CD1 3.46Å; H15-L19 WeakPolarHBondContact O-CB 3.38Å; H15-L19 WeakPolarHBondContact O-CG 3.41Å; H15-L19 PolarHBondContact O-N 3.16Å
16	L	69.9	Low	61.4	Low	87 Å²	87	114.3 Å²	114.3	46%	0.455	59%	0.59	S	S	.	*	H	α-helix	trans	-64.1	-42.4	177.6	-150.5	80.6	0	0	0	112.1	Q12 L19 L20 L123	Q12-L16 PolarHBondContact O-N 3.21Å; Q12-L16 VanDerWaalsContact O-N 3.08Å; L16-L19 PolarHBondContact O-N 3.14Å; L16-L20 HydrophobicContact CG-CD1 4.36Å; L16-L20 WeakPolarHBondContact O-CB 3.42Å; L16-L20 WeakPolarHBondContact O-CD1 3.36Å; L16-L20 WeakPolarHBondContact O-CG 3.37Å; L16-L20 PolarHBondContact O-N 3.36Å; L16-L123 HydrophobicContact CD2-CD1 4.28Å; L16-L123 HydrophobicContact CD2-CD2 4.29Å
17	C	69.5	Low	62.3	Low	72 Å²	72	116.1 Å²	116.1	49%	0.486	59%	0.585	S	S	.	*	H	α-helix	trans	-62.8	-44.6	174.6	-169.4	0	0	0	0	111.4	G13 L19 L20 C21	G13-C17 WeakPolarHBondContact O-CB 3.48Å; G13-C17 PolarHBondContact O-N 3.4Å; G13-C17 VanDerWaalsContact O-N 3.12Å; C17-L19 PolarHBondContact O-N 3.37Å; C17-L20 PolarHBondContact O-N 3.06Å; C17-C21 WeakPolarHBondContact O-CB 3.46Å; C17-C21 PolarHBondContact O-N 3.31Å; C17-C21 PolarHBondContact O-SG 3.49Å; C17-C21 VanDerWaalsContact O-SG 3.35Å
18	W	75.7	Confident	62.7	Low	180 Å²	180	109.2 Å²	109.2	68%	0.682	57%	0.574	S	S	*	*	H	α-helix	trans	-64.3	-41.4	178.4	-158.8	83.9	0	0	0	112.3	R14 H15 C21 A22	R14-W18 VanDerWaalsContact O-CB 3.26Å; R14-W18 WeakPolarHBondContact O-CB 3.34Å; R14-W18 PolarHBondContact O-N 3.22Å; H15-W18 PolarHBondContact O-N 2.87Å; W18-C21 PolarHBondContact O-N 3.13Å; W18-A22 VanDerWaalsContact O-CB 3.31Å; W18-A22 WeakPolarHBondContact O-CB 3.41Å; W18-A22 PolarHBondContact O-N 3.31Å
19	L	73.3	Confident	63	Low	85 Å²	85	108 Å²	108	45%	0.445	57%	0.568	S	S	.	*	H	α-helix	trans	-62.8	-42.9	174.7	-73.5	172.1	0	0	0	111.9	H15 L16 C17 A22 F23	H15-L19 WeakPolarHBondContact ND1-CD1 3.46Å; H15-L19 WeakPolarHBondContact O-CB 3.38Å; H15-L19 WeakPolarHBondContact O-CG 3.41Å; H15-L19 PolarHBondContact O-N 3.16Å; L16-L19 PolarHBondContact O-N 3.14Å; C17-L19 PolarHBondContact O-N 3.37Å; L19-A22 PolarHBondContact O-N 3.17Å; L19-F23 VanDerWaalsContact O-CB 3.31Å; L19-F23 WeakPolarHBondContact O-CB 3.38Å; L19-F23 PolarHBondContact O-N 2.95Å
20	L	70	Confident	63.1	Low	43 Å²	43	108.8 Å²	108.8	23%	0.225	57%	0.569	C	S	.	*	H	α-helix	trans	-68.5	-38.3	178.6	-73.9	166.2	0	0	0	112.3	L16 C17 T24 F120 L123	L16-L20 HydrophobicContact CG-CD1 4.36Å; L16-L20 WeakPolarHBondContact O-CB 3.42Å; L16-L20 WeakPolarHBondContact O-CD1 3.36Å; L16-L20 WeakPolarHBondContact O-CG 3.37Å; L16-L20 PolarHBondContact O-N 3.36Å; C17-L20 PolarHBondContact O-N 3.06Å; L20-T24 WeakPolarHBondContact O-CG2 3.46Å; L20-T24 PolarHBondContact O-N 3.44Å; L20-T24 VanDerWaalsContact O-N 3.1Å; L20-T24 PolarHBondContact O-OG1 2.95Å; L20-F120 HydrophobicContact CB-CE1 3.52Å; L20-F120 HydrophobicContact CB-CZ 3.55Å; L20-F120 HydrophobicContact CD1-CD1 4.12Å; L20-F120 HydrophobicContact CD1-CE1 3.59Å; L20-F120 HydrophobicContact CD1-CZ 4.27Å; L20-F120 HydrophobicContact CD2-CE1 4.33Å; L20-F120 HydrophobicContact CD2-CZ 4.21Å; L20-F120 HydrophobicContact CG-CE1 4.01Å; L20-F120 HydrophobicContact CG-CZ 4.22Å; L20-L123 HydrophobicContact CD1-CD1 3.68Å
21	C	69.7	Low	62.6	Low	59 Å²	59	109.1 Å²	109.1	40%	0.399	57%	0.566	S	S	.	*	H	α-helix	trans	-67	-40.8	172.5	-71.8	0	0	0	0	112.4	C17 W18 F23 T24 L25	C17-C21 WeakPolarHBondContact O-CB 3.46Å; C17-C21 PolarHBondContact O-N 3.31Å; C17-C21 PolarHBondContact O-SG 3.49Å; C17-C21 VanDerWaalsContact O-SG 3.35Å; W18-C21 PolarHBondContact O-N 3.13Å; C21-F23 VanDerWaalsContact C-N 3.34Å; C21-T24 WeakPolarHBondContact CA-OG1 3.46Å; C21-T24 PolarHBondContact O-OG1 3.17Å; C21-L25 WeakPolarHBondContact O-CB 3.38Å; C21-L25 WeakPolarHBondContact O-CG 3.29Å; C21-L25 PolarHBondContact O-N 3.24Å; C21-L25 VanDerWaalsContact O-N 3.12Å
22	A	72	Confident	62.1	Low	38 Å²	38	108 Å²	108	31%	0.314	57%	0.566	S	S	.	*	H	α-helix	trans	-65.9	-38.4	176.6	0	0	0	0	0	111.9	W18 L19 K26	W18-A22 VanDerWaalsContact O-CB 3.31Å; W18-A22 WeakPolarHBondContact O-CB 3.41Å; W18-A22 PolarHBondContact O-N 3.31Å; L19-A22 PolarHBondContact O-N 3.17Å; A22-K26 PolarHBondContact O-N 2.91Å; A22-K26 VanDerWaalsContact O-N 3.14Å
23	F	70.5	Confident	61.2	Low	135 Å²	135	105.8 Å²	105.8	59%	0.592	57%	0.566	S	S	*	*	H	α-helix	trans	-68.5	-41.4	179.2	-166.6	-103.8	0	0	0	112.4	L19 C21 K26 L27	L19-F23 VanDerWaalsContact O-CB 3.31Å; L19-F23 WeakPolarHBondContact O-CB 3.38Å; L19-F23 PolarHBondContact O-N 2.95Å; C21-F23 VanDerWaalsContact C-N 3.34Å; F23-K26 PolarHBondContact O-N 3.29Å; F23-L27 HydrophobicContact CD1-CD1 3.73Å; F23-L27 HydrophobicContact CE1-CD1 3.53Å; F23-L27 HydrophobicContact CE1-CG 4.42Å; F23-L27 HydrophobicContact CZ-CD1 4.29Å; F23-L27 PolarHBondContact O-N 3.4Å; F23-L27 VanDerWaalsContact O-N 3.15Å
24	T	66.1	Low	60.2	Low	54 Å²	54	109.9 Å²	109.9	33%	0.331	58%	0.584	S	S	.	*	H	α-helix	trans	-65.9	-41	175.8	46.4	0	0	0	0	112.5	L20 C21 K26 L27 C28 V116 F120	L20-T24 WeakPolarHBondContact O-CG2 3.46Å; L20-T24 PolarHBondContact O-N 3.44Å; L20-T24 VanDerWaalsContact O-N 3.1Å; L20-T24 PolarHBondContact O-OG1 2.95Å; C21-T24 WeakPolarHBondContact CA-OG1 3.46Å; C21-T24 PolarHBondContact O-OG1 3.17Å; T24-K26 VanDerWaalsContact C-N 3.28Å; T24-K26 PolarHBondContact O-N 3.15Å; T24-L27 PolarHBondContact O-N 3.11Å; T24-C28 PolarHBondContact O-N 3.3Å; T24-V116 HydrophobicContact CG2-CG1 4.18Å; T24-F120 HydrophobicContact CG2-CE2 4.31Å; T24-F120 HydrophobicContact CG2-CZ 4.46Å
25	L	65.4	Low	58.7	Low	124 Å²	124	107.9 Å²	107.9	65%	0.649	58%	0.584	S	S	*	*	H	α-helix	trans	-62.2	-34.2	173.6	-82.3	162.3	0	0	0	112.9	C21	C21-L25 WeakPolarHBondContact O-CB 3.38Å; C21-L25 WeakPolarHBondContact O-CG 3.29Å; C21-L25 PolarHBondContact O-N 3.24Å; C21-L25 VanDerWaalsContact O-N 3.12Å
26	K	67	Low	57.6	Low	164 Å²	164	111.3 Å²	111.3	71%	0.713	60%	0.6	S	S	*	*	H	α-helix	trans	-72.5	-35.6	177.8	-83	-72.1	-179.9	-176.6	0	113.3	A22 F23 T24 C28 Q29	A22-K26 PolarHBondContact O-N 2.91Å; A22-K26 VanDerWaalsContact O-N 3.14Å; F23-K26 PolarHBondContact O-N 3.29Å; T24-K26 VanDerWaalsContact C-N 3.28Å; T24-K26 PolarHBondContact O-N 3.15Å; K26-C28 VanDerWaalsContact C-N 3.31Å; K26-Q29 PolarHBondContact O-N 3.04Å
27	L	59.2	Low	56.3	Low	103 Å²	103	115.2 Å²	115.2	54%	0.539	62%	0.616	S	S	.	*	H	α-helix	trans	-68.5	-30.2	176.3	-77.2	160.6	0	0	0	112.6	F23 T24 Q29 A30	F23-L27 HydrophobicContact CD1-CD1 3.73Å; F23-L27 HydrophobicContact CE1-CD1 3.53Å; F23-L27 HydrophobicContact CE1-CG 4.42Å; F23-L27 HydrophobicContact CZ-CD1 4.29Å; F23-L27 PolarHBondContact O-N 3.4Å; F23-L27 VanDerWaalsContact O-N 3.15Å; T24-L27 PolarHBondContact O-N 3.11Å; L27-Q29 VanDerWaalsContact C-N 3.29Å; L27-Q29 PolarHBondContact O-N 2.89Å; L27-A30 PolarHBondContact O-N 3.22Å
28	C	55.2	Low	55	Low	107 Å²	107	120.7 Å²	120.7	72%	0.723	63%	0.631	S	S	*	*	H	α-helix	trans	-74.7	-17.4	-179.6	-152	0	0	0	0	113.5	T24 K26 A30	T24-C28 PolarHBondContact O-N 3.3Å; K26-C28 VanDerWaalsContact C-N 3.31Å; C28-A30 VanDerWaalsContact C-N 3.31Å
29	Q	49.1	Very low	53.4	Low	167 Å²	167	119.1 Å²	119.1	78%	0.78	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.2	1.3	178.5	-71.5	-84.7	7.3	0	0	113.6	K26 L27	K26-Q29 PolarHBondContact O-N 3.04Å; L27-Q29 VanDerWaalsContact C-N 3.29Å; L27-Q29 PolarHBondContact O-N 2.89Å
30	A	46.1	Very low	52.3	Low	81 Å²	81	119.9 Å²	119.9	67%	0.669	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.1	-1.6	-177.3	0	0	0	0	0	114.3	L27 C28 A32	L27-A30 PolarHBondContact O-N 3.22Å; C28-A30 VanDerWaalsContact C-N 3.31Å; A30-A32 PolarHBondContact O-N 3Å
31	E	40	Very low	50.7	Low	158 Å²	158	121.8 Å²	121.8	74%	0.738	67%	0.67	S	S	*	*			trans	-82.8	95.2	175	-144.1	71.1	-153.8	0	0	109.1
32	A	41.7	Very low	49.3	Very low	80 Å²	80	123 Å²	123	66%	0.661	68%	0.679	S	S	*	*			trans	-65.1	140.7	177.1	0	0	0	0	0	110.7	A30 V34	A30-A32 PolarHBondContact O-N 3Å; A32-V34 PolarHBondContact O-N 3.46Å
33	P	37.3	Very low	48.3	Very low	121 Å²	121	127.1 Å²	127.1	79%	0.786	70%	0.701	S	S	*	*			trans	-65.6	129.7	-179.6	27.1	-33.4	0	0	0	110.7	Q35	P33-Q35 PolarHBondContact O-N 3.35Å
34	V	36.9	Very low	47.5	Very low	120 Å²	120	125 Å²	125	73%	0.727	70%	0.702	S	S	*	*			trans	-59.1	108.3	168.2	173.8	0	0	0	0	107.9	A32 E36	A32-V34 PolarHBondContact O-N 3.46Å; V34-E36 PolarHBondContact O-N 2.88Å
35	Q	33.3	Very low	47.5	Very low	171 Å²	171	129.3 Å²	129.3	80%	0.799	72%	0.724	S	S	*	*			trans	-72.8	113.5	170.1	-103.6	-175	6	0	0	108.8	P33 E37	P33-Q35 PolarHBondContact O-N 3.35Å; Q35-E37 PolarHBondContact O-N 3.43Å
36	E	42.5	Very low	48	Very low	189 Å²	189	126.6 Å²	126.6	88%	0.883	71%	0.709	S	S	*	*			trans	-75.3	95	163.9	-145.7	179.8	158.2	0	0	107.1	V34 K38	V34-E36 PolarHBondContact O-N 2.88Å; E36-K38 PolarHBondContact O-N 3.3Å; E36-K38 VanDerWaalsContact O-N 3.12Å
37	E	42	Very low	48.8	Very low	168 Å²	168	120.8 Å²	120.8	79%	0.785	69%	0.689	S	S	*	*			trans	-71.8	106.2	171.5	-89.2	-143	98.2	0	0	109.6	Q35 L39	Q35-E37 PolarHBondContact O-N 3.43Å; E37-L39 PolarHBondContact O-N 3.3Å
38	K	43	Very low	50.1	Low	187 Å²	187	116.8 Å²	116.8	81%	0.813	67%	0.669	S	S	*	*			trans	-66.4	96.5	171.7	-175.1	-178.3	-177.9	-174.1	0	109.6	E36 S40	E36-K38 PolarHBondContact O-N 3.3Å; E36-K38 VanDerWaalsContact O-N 3.12Å; K38-S40 PolarHBondContact O-N 2.96Å; K38-S40 VanDerWaalsContact O-N 3.16Å
39	L	42.4	Very low	51.5	Low	147 Å²	147	114.9 Å²	114.9	77%	0.77	65%	0.646	S	S	*	*			trans	-68.6	108.4	174.1	-168	70.4	0	0	0	110.1	E37	E37-L39 PolarHBondContact O-N 3.3Å
40	S	48.1	Very low	53.2	Low	101 Å²	101	111 Å²	111	71%	0.706	63%	0.631	S	S	*	*			trans	-135.3	93.3	168.6	-77.8	0	0	0	0	109.1	K38	K38-S40 PolarHBondContact O-N 2.96Å; K38-S40 VanDerWaalsContact O-N 3.16Å
41	A	38.3	Very low	55.1	Low	84 Å²	84	112.4 Å²	112.4	69%	0.694	63%	0.63	S	S	*	*			trans	-163.1	122.3	160.5	0	0	0	0	0	112.4
42	S	40.2	Very low	57.3	Low	84 Å²	84	107.3 Å²	107.3	59%	0.587	61%	0.607	S	S	*	*			trans	32.4	117.6	155.1	-167.3	0	0	0	0	120.6	S44 N45	S42-S44 PolarHBondContact O-N 2.9Å; S42-S44 PolarHBondContact OG-OG 3.12Å; S42-N45 PolarHBondContact O-N 3.5Å
43	T	50.6	Low	59.4	Low	125 Å²	125	111.3 Å²	111.3	77%	0.767	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.4	-2.9	176.4	-52.7	0	0	0	0	116.3	L46	T43-L46 HydrophobicContact CG2-CD1 3.85Å
44	S	54	Low	61.7	Low	90 Å²	90	108.9 Å²	108.9	63%	0.629	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.5	-11.8	-177.5	63.2	0	0	0	0	115.7	S42	S42-S44 PolarHBondContact O-N 2.9Å; S42-S44 PolarHBondContact OG-OG 3.12Å
45	N	65.7	Low	64.1	Low	145 Å²	145	107.1 Å²	107.1	78%	0.775	58%	0.578	S	S	*	*	S	Bend	trans	-125.4	27.5	178.1	-69.5	-70.4	0	0	0	112.3	S42	S42-N45 PolarHBondContact O-N 3.5Å
46	L	76.4	Confident	66.8	Low	66 Å²	66	102.2 Å²	102.2	35%	0.346	56%	0.56	S	S	.	*			trans	-65.2	136.8	179.1	-70	160.9	0	0	0	109.6	T43 L50 V51	T43-L46 HydrophobicContact CG2-CD1 3.85Å; L46-L50 HydrophobicContact CD2-CD2 3.74Å; L46-V51 HydrophobicContact CB-CG2 4.2Å
47	P	82.8	Confident	68.9	Low	43 Å²	43	96.9 Å²	96.9	28%	0.279	54%	0.54	S	S	.	.			trans	-68.6	147.9	-180	32.5	-37.6	0	0	0	110	W49 L50	P47-W49 VanDerWaalsContact CB-NE1 3.28Å; P47-W49 HydrophobicContact CG-CD2 4.49Å; P47-W49 HydrophobicContact CG-CZ2 3.99Å; P47-W49 PolarHBondContact O-N 2.84Å; P47-L50 HydrophobicContact CG-CD1 4.07Å; P47-L50 WeakPolarHBondContact O-CB 3.37Å; P47-L50 PolarHBondContact O-N 3.08Å
48	C	87.1	Confident	71	Confident	18 Å²	18	92 Å²	92	12%	0.122	52%	0.522	C	S	.	.	G	3₁₀ helix	trans	-61.3	-26.4	-165.6	64.2	0	0	0	0	114.2	L50 V51 E52 C85 E92	C48-L50 PolarHBondContact O-N 3.48Å; C48-V51 PolarHBondContact O-N 3.47Å; C48-V51 VanDerWaalsContact O-N 3.16Å; C48-E52 WeakPolarHBondContact O-CB 3.37Å; C48-E52 PolarHBondContact O-N 2.96Å; C48-C85 HydrophobicContact CB-CB 3.78Å; C48-C85 WeakPolarHBondContact CB-SG 3.31Å; C48-C85 WeakPolarHBondContact SG-CB 3.26Å; C48-C85 CovalentContact SG-SG 2.02Å; C48-C85 PolarHBondContact SG-SG 3.29Å; C48-E92 WeakPolarHBondContact SG-CG 3.2Å
49	W	83.3	Confident	73	Confident	68 Å²	68	91.1 Å²	91.1	26%	0.258	52%	0.52	S	S	.	.	G	3₁₀ helix	trans	-72.6	-9.7	177.7	61.9	-88.7	0	0	0	114.9	P47 F54 I83 C85 K94	P47-W49 VanDerWaalsContact CB-NE1 3.28Å; P47-W49 HydrophobicContact CG-CD2 4.49Å; P47-W49 HydrophobicContact CG-CZ2 3.99Å; P47-W49 PolarHBondContact O-N 2.84Å; W49-F54 HydrophobicContact CB-CB 4.2Å; W49-F54 HydrophobicContact CB-CD1 3.68Å; W49-F54 HydrophobicContact CB-CE1 4.26Å; W49-F54 HydrophobicContact CB-CG 3.97Å; W49-I83 HydrophobicContact CB-CD1 3.41Å; W49-I83 VanDerWaalsContact CB-CD1 3.41Å; W49-I83 HydrophobicContact CD2-CD1 4.38Å; W49-I83 HydrophobicContact CG-CD1 3.5Å; W49-I83 VanDerWaalsContact CG-CD1 3.5Å; W49-C85 PolarHBondContact N-SG 3.34Å; W49-K94 HydrophobicContact CD2-CD 4Å; W49-K94 HydrophobicContact CE3-CD 3.99Å; W49-K94 HydrophobicContact CH2-CD 3.98Å; W49-K94 HydrophobicContact CZ2-CD 3.96Å; W49-K94 HydrophobicContact CZ2-CG 4.2Å; W49-K94 HydrophobicContact CZ3-CD 3.99Å
50	L	85.6	Confident	75.2	Confident	86 Å²	86	85.7 Å²	85.7	45%	0.45	50%	0.495	S	S	.	.	G	3₁₀ helix	trans	-83.7	-21	170.4	-110.2	75.4	0	0	0	112.7	L46 P47 C48	L46-L50 HydrophobicContact CD2-CD2 3.74Å; P47-L50 HydrophobicContact CG-CD1 4.07Å; P47-L50 WeakPolarHBondContact O-CB 3.37Å; P47-L50 PolarHBondContact O-N 3.08Å; C48-L50 PolarHBondContact O-N 3.48Å
51	V	86.5	Confident	77	Confident	109 Å²	109	83 Å²	83	66%	0.661	48%	0.476	S	S	*	.	T	Hydrogen-bonded Turn	trans	-117.6	-29.4	-168.2	-167.9	0	0	0	0	111.5	L46 C48	L46-V51 HydrophobicContact CB-CG2 4.2Å; C48-V51 PolarHBondContact O-N 3.47Å; C48-V51 VanDerWaalsContact O-N 3.16Å
52	E	85.9	Confident	79.4	Confident	52 Å²	52	83.1 Å²	83.1	24%	0.243	47%	0.469	C	S	.	.	S	Bend	trans	-118.9	155.6	-177.9	-53.5	-173.9	154.2	0	0	111.1	C48 F54 C85 S87 S88	C48-E52 WeakPolarHBondContact O-CB 3.37Å; C48-E52 PolarHBondContact O-N 2.96Å; E52-F54 PolarHBondContact O-N 3.34Å; E52-C85 WeakPolarHBondContact OE2-CB 3.34Å; E52-S87 VanDerWaalsContact OE1-CB 3.24Å; E52-S87 WeakPolarHBondContact OE1-CB 3.45Å; E52-S87 PolarHBondContact OE1-OG 3.15Å; E52-S87 WeakPolarHBondContact OE2-CB 3.45Å; E52-S88 VanDerWaalsContact OE2-CB 3.32Å; E52-S88 WeakPolarHBondContact OE2-CB 3.32Å; E52-S88 PolarHBondContact OE2-N 3.31Å; E52-S88 PolarHBondContact OE2-OG 3.48Å
53	E	85.3	Confident	81.7	Confident	163 Å²	163	80.2 Å²	80.2	76%	0.762	45%	0.449	S	S	*	.			trans	-64.2	134.4	165.3	-170.9	170.4	-160.7	0	0	109.3	S86	E53-S86 VanDerWaalsContact O-CB 3.27Å; E53-S86 WeakPolarHBondContact O-CB 3.29Å; E53-S86 PolarHBondContact O-N 3.38Å; E53-S86 PolarHBondContact O-OG 2.99Å
54	F	86.1	Confident	83.5	Confident	71 Å²	71	76.9 Å²	76.9	31%	0.311	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.3	150.1	-177.5	67.8	-89.4	0	0	0	110.7	W49 E52 V56 I83	W49-F54 HydrophobicContact CB-CB 4.2Å; W49-F54 HydrophobicContact CB-CD1 3.68Å; W49-F54 HydrophobicContact CB-CE1 4.26Å; W49-F54 HydrophobicContact CB-CG 3.97Å; E52-F54 PolarHBondContact O-N 3.34Å; F54-V56 HydrophobicContact CD2-CG2 4.35Å; F54-V56 HydrophobicContact CE2-CG2 4Å; F54-I83 HydrophobicContact CB-CB 4.49Å; F54-I83 HydrophobicContact CD2-CB 3.96Å; F54-I83 HydrophobicContact CD2-CD1 4.3Å; F54-I83 HydrophobicContact CD2-CG2 3.75Å; F54-I83 HydrophobicContact CE2-CG2 4.09Å; F54-I83 HydrophobicContact CG-CD1 4.44Å
55	V	88.4	Confident	85.2	Confident	83 Å²	83	79.5 Å²	79.5	50%	0.503	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	126.1	174.6	-176.6	0	0	0	0	108.8	T57 I83 T84	V55-T57 PolarHBondContact O-N 2.96Å; V55-T57 PolarHBondContact O-OG1 3.23Å; V55-I83 WeakPolarHBondContact O-CA 3.44Å; V55-T84 PolarHBondContact N-O 3.46Å; V55-T84 PolarHBondContact O-N 2.89Å
56	V	87.9	Confident	86.3	Confident	67 Å²	67	79.8 Å²	79.8	41%	0.406	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.7	113.8	174.2	-176.1	0	0	0	0	108.3	F54 T58 I83	F54-V56 HydrophobicContact CD2-CG2 4.35Å; F54-V56 HydrophobicContact CE2-CG2 4Å; V56-T58 WeakPolarHBondContact CG1-O 3.4Å; V56-I83 HydrophobicContact CG2-CG2 4.12Å
57	T	87.1	Confident	86.7	Confident	78 Å²	78	79.5 Å²	79.5	48%	0.479	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.6	-28.7	-177	-50.9	0	0	0	0	111.4	V55 K82 T84	V55-T57 PolarHBondContact O-N 2.96Å; V55-T57 PolarHBondContact O-OG1 3.23Å; T57-K82 PolarHBondContact N-O 3.45Å; T57-T84 WeakPolarHBondContact OG1-CB 3.47Å; T57-T84 PolarHBondContact OG1-OG1 3.27Å
58	T	85.5	Confident	86.9	Confident	64 Å²	64	80.1 Å²	80.1	39%	0.393	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.9	128.7	174.5	-49.8	0	0	0	0	108.9	V56 K82	V56-T58 WeakPolarHBondContact CG1-O 3.4Å; T58-K82 PolarHBondContact N-O 3.27Å; T58-K82 VanDerWaalsContact N-O 3.1Å; T58-K82 PolarHBondContact O-N 3.48Å
59	E	85.7	Confident	86.9	Confident	169 Å²	169	87.8 Å²	87.8	79%	0.79	47%	0.469	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-60.3	157.2	177.1	-62.6	-176.4	176.2	0	0	111.8	S61	E59-S61 PolarHBondContact O-N 2.97Å; E59-S61 VanDerWaalsContact O-N 3.14Å
60	C	88.7	Confident	87.1	Confident	34 Å²	34	88.1 Å²	88.1	23%	0.23	48%	0.479	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-56	116.4	-178.2	-175.7	0	0	0	0	111.6	C96	C60-C96 WeakPolarHBondContact CA-SG 3.23Å; C60-C96 HydrophobicContact CB-CB 3.73Å; C60-C96 WeakPolarHBondContact CB-SG 3.27Å; C60-C96 WeakPolarHBondContact SG-CB 3.47Å; C60-C96 CovalentContact SG-SG 2.01Å; C60-C96 PolarHBondContact SG-SG 3.3Å
61	S	87	Confident	87	Confident	45 Å²	45	85 Å²	85	32%	0.315	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134	153.9	-173.2	64.1	0	0	0	0	111.7	E59 Y79 V80	E59-S61 PolarHBondContact O-N 2.97Å; E59-S61 VanDerWaalsContact O-N 3.14Å; S61-Y79 VanDerWaalsContact C-CD1 3.42Å; S61-Y79 WeakPolarHBondContact O-CA 3.11Å; S61-V80 PolarHBondContact N-O 2.88Å; S61-V80 PolarHBondContact O-N 3.34Å
62	P	88.4	Confident	87	Confident	85 Å²	85	84.9 Å²	84.9	55%	0.552	47%	0.465	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-66	137.3	-179.9	26.4	-33.6	0	0	0	110.6	S64 Y79	P62-S64 PolarHBondContact O-N 3.41Å; P62-Y79 HydrophobicContact CB-CD1 4.11Å; P62-Y79 HydrophobicContact CB-CE1 3.67Å; P62-Y79 HydrophobicContact CG-CE1 4.23Å
63	C	88.3	Confident	86.9	Confident	23 Å²	23	85.9 Å²	85.9	16%	0.155	47%	0.47	C	S	.	.	P	Polyproline II helix	trans	-62.7	134.4	176.8	-66.2	0	0	0	0	111.1	Q67 A68 C74 G78	C63-Q67 HydrophobicContact CB-CB 4.47Å; C63-A68 HydrophobicContact CB-CB 4.42Å; C63-C74 HydrophobicContact CB-CB 3.78Å; C63-C74 WeakPolarHBondContact CB-SG 3.35Å; C63-C74 VanDerWaalsContact SG-CA 3.58Å; C63-C74 WeakPolarHBondContact SG-CB 3.31Å; C63-C74 CovalentContact SG-SG 2.03Å; C63-C74 PolarHBondContact SG-SG 3.34Å; C63-G78 WeakPolarHBondContact CB-O 3.37Å; C63-G78 PolarHBondContact N-O 3.46Å; C63-G78 VanDerWaalsContact SG-C 3.59Å; C63-G78 PolarHBondContact SG-O 2.94Å; C63-G78 VanDerWaalsContact SG-O 3.41Å
64	S	88.8	Confident	87	Confident	56 Å²	56	78.4 Å²	78.4	39%	0.392	44%	0.435	S	S	.	.	P	Polyproline II helix	trans	-67.4	158.2	168.3	67.7	0	0	0	0	110.9	P62 F66 Q67 A68	P62-S64 PolarHBondContact O-N 3.41Å; S64-F66 PolarHBondContact O-N 3.31Å; S64-F66 VanDerWaalsContact O-N 3.08Å; S64-Q67 PolarHBondContact O-N 3.39Å; S64-Q67 WeakPolarHBondContact OG-CB 3.5Å; S64-Q67 WeakPolarHBondContact OG-CG 3.5Å; S64-Q67 PolarHBondContact OG-N 3.12Å; S64-A68 WeakPolarHBondContact O-CB 3.4Å; S64-A68 PolarHBondContact O-N 2.93Å
65	N	88	Confident	86.8	Confident	144 Å²	144	78.1 Å²	78.1	77%	0.77	45%	0.452	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.5	-31.5	178.7	-108.8	-86.6	0	0	0	113.3
66	F	89.6	Confident	86.4	Confident	151 Å²	151	78.5 Å²	78.5	66%	0.662	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.4	-49.6	175.8	-178.9	-103.3	0	0	0	111.4	S64 A68 K69 T70	S64-F66 PolarHBondContact O-N 3.31Å; S64-F66 VanDerWaalsContact O-N 3.08Å; F66-A68 VanDerWaalsContact C-N 3.29Å; F66-A68 PolarHBondContact O-N 2.93Å; F66-K69 PolarHBondContact O-N 3.1Å; F66-T70 HydrophobicContact CD1-CG2 4.26Å; F66-T70 HydrophobicContact CD2-CG2 4.2Å; F66-T70 HydrophobicContact CE1-CG2 3.84Å; F66-T70 HydrophobicContact CE2-CG2 3.77Å; F66-T70 HydrophobicContact CG-CG2 4.44Å; F66-T70 HydrophobicContact CZ-CG2 3.58Å; F66-T70 PolarHBondContact O-N 3.01Å; F66-T70 PolarHBondContact O-OG1 3.29Å
67	Q	84.6	Confident	86.1	Confident	60 Å²	60	78 Å²	78	28%	0.28	45%	0.454	S	S	.	.	H	α-helix	trans	-62.3	-35.4	179.3	-75.5	176.8	-4.4	0	0	112.7	C63 S64 K69 T70 T71	C63-Q67 HydrophobicContact CB-CB 4.47Å; S64-Q67 PolarHBondContact O-N 3.39Å; S64-Q67 WeakPolarHBondContact OG-CB 3.5Å; S64-Q67 WeakPolarHBondContact OG-CG 3.5Å; S64-Q67 PolarHBondContact OG-N 3.12Å; Q67-K69 PolarHBondContact O-N 3.07Å; Q67-K69 VanDerWaalsContact O-N 3.1Å; Q67-T70 WeakPolarHBondContact CA-OG1 3.37Å; Q67-T70 PolarHBondContact O-N 3.14Å; Q67-T71 WeakPolarHBondContact O-CA 3.45Å; Q67-T71 WeakPolarHBondContact O-CB 3.41Å; Q67-T71 PolarHBondContact O-N 2.93Å; Q67-T71 PolarHBondContact O-OG1 3.42Å
68	A	86.5	Confident	86	Confident	56 Å²	56	75.8 Å²	75.8	46%	0.463	45%	0.446	S	S	.	.	H	α-helix	trans	-58.2	-25	174.6	0	0	0	0	0	113.4	C63 S64 F66	C63-A68 HydrophobicContact CB-CB 4.42Å; S64-A68 WeakPolarHBondContact O-CB 3.4Å; S64-A68 PolarHBondContact O-N 2.93Å; F66-A68 VanDerWaalsContact C-N 3.29Å; F66-A68 PolarHBondContact O-N 2.93Å
69	K	87.6	Confident	86.1	Confident	180 Å²	180	75.2 Å²	75.2	78%	0.783	44%	0.437	S	S	*	.	H	α-helix	trans	-97.5	-30.3	178.1	-63.7	-175.1	-179.9	-172.1	0	113.3	F66 Q67	F66-K69 PolarHBondContact O-N 3.1Å; Q67-K69 PolarHBondContact O-N 3.07Å; Q67-K69 VanDerWaalsContact O-N 3.1Å
70	T	86.9	Confident	86.3	Confident	75 Å²	75	67.4 Å²	67.4	46%	0.46	40%	0.401	S	S	.	.	H	α-helix	trans	-99	-21	-173.5	56	0	0	0	0	113.6	F66 Q67	F66-T70 HydrophobicContact CD1-CG2 4.26Å; F66-T70 HydrophobicContact CD2-CG2 4.2Å; F66-T70 HydrophobicContact CE1-CG2 3.84Å; F66-T70 HydrophobicContact CE2-CG2 3.77Å; F66-T70 HydrophobicContact CG-CG2 4.44Å; F66-T70 HydrophobicContact CZ-CG2 3.58Å; F66-T70 PolarHBondContact O-N 3.01Å; F66-T70 PolarHBondContact O-OG1 3.29Å; Q67-T70 WeakPolarHBondContact CA-OG1 3.37Å; Q67-T70 PolarHBondContact O-N 3.14Å
71	T	85.1	Confident	86.4	Confident	21 Å²	21	67.3 Å²	67.3	13%	0.129	40%	0.397	C	S	.	.			trans	-113.6	109.2	-176.6	-49.1	0	0	0	0	108.8	Q67 E73 C74 F93	Q67-T71 WeakPolarHBondContact O-CA 3.45Å; Q67-T71 WeakPolarHBondContact O-CB 3.41Å; Q67-T71 PolarHBondContact O-N 2.93Å; Q67-T71 PolarHBondContact O-OG1 3.42Å; T71-E73 HydrophobicContact CG2-CB 4.03Å; T71-E73 HydrophobicContact CG2-CG 4.37Å; T71-E73 PolarHBondContact O-N 3.3Å; T71-C74 WeakPolarHBondContact O-CB 3.39Å; T71-C74 PolarHBondContact O-N 2.9Å; T71-C74 VanDerWaalsContact O-N 3.12Å; T71-F93 HydrophobicContact CG2-CB 4.13Å; T71-F93 HydrophobicContact CG2-CG 4.45Å
72	P	84.9	Confident	86.6	Confident	106 Å²	106	68.3 Å²	68.3	69%	0.688	40%	0.396	S	S	*	.	G	3₁₀ helix	trans	-63	-28.1	-177.4	25.7	-33.9	0	0	0	112.5	C74 G75	P72-C74 PolarHBondContact O-N 2.97Å; P72-C74 VanDerWaalsContact O-N 3.1Å; P72-G75 PolarHBondContact O-N 3.46Å
73	E	85.5	Confident	86.7	Confident	73 Å²	73	64.3 Å²	64.3	34%	0.341	37%	0.37	S	S	.	.	G	3₁₀ helix	trans	-61.6	-17.2	176.4	-54.7	-58.5	141.7	0	0	113.8	T71 V80 S95	T71-E73 HydrophobicContact CG2-CB 4.03Å; T71-E73 HydrophobicContact CG2-CG 4.37Å; T71-E73 PolarHBondContact O-N 3.3Å; E73-V80 HydrophobicContact CB-CG1 4.06Å; E73-S95 WeakPolarHBondContact O-CB 3.48Å
74	C	86.3	Confident	86.8	Confident	6 Å²	6	64.9 Å²	64.9	4%	0.041	37%	0.373	C	S	.	.	G	3₁₀ helix	trans	-78.3	-18.8	172.8	-75.1	0	0	0	0	113.4	C63 T71 P72 G78 V80	C63-C74 HydrophobicContact CB-CB 3.78Å; C63-C74 WeakPolarHBondContact CB-SG 3.35Å; C63-C74 VanDerWaalsContact SG-CA 3.58Å; C63-C74 WeakPolarHBondContact SG-CB 3.31Å; C63-C74 CovalentContact SG-SG 2.03Å; C63-C74 PolarHBondContact SG-SG 3.34Å; T71-C74 WeakPolarHBondContact O-CB 3.39Å; T71-C74 PolarHBondContact O-N 2.9Å; T71-C74 VanDerWaalsContact O-N 3.12Å; P72-C74 PolarHBondContact O-N 2.97Å; P72-C74 VanDerWaalsContact O-N 3.1Å; C74-G78 WeakPolarHBondContact O-CA 3.2Å; C74-G78 PolarHBondContact O-N 3.09Å; C74-V80 HydrophobicContact CB-CG1 4.43Å; C74-V80 WeakPolarHBondContact SG-CG1 3.48Å
75	G	81.4	Confident	86.9	Confident	65 Å²	65	62.2 Å²	62.2	67%	0.67	35%	0.354	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.4	-48.1	-175.9	0	0	0	0	0	115.8	P72	P72-G75 PolarHBondContact O-N 3.46Å
76	P	80.1	Confident	86.9	Confident	91 Å²	91	58.2 Å²	58.2	59%	0.591	34%	0.337	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.1	-39.7	-171.3	25.4	-33.7	0	0	0	114.1
77	T	82.2	Confident	86.7	Confident	56 Å²	56	55.4 Å²	55.4	34%	0.344	34%	0.336	S	S	.	.	T	Hydrogen-bonded Turn	trans	-116.6	-20.2	-175.7	65.5	0	0	0	0	113.8	Y79 C96	T77-Y79 WeakPolarHBondContact O-CD2 3.47Å; T77-Y79 PolarHBondContact O-N 2.87Å; T77-Y79 PolarHBondContact OG1-N 3.37Å; T77-Y79 PolarHBondContact OG1-O 3.18Å; T77-Y79 VanDerWaalsContact OG1-O 3.08Å; T77-C96 PolarHBondContact OG1-O 3.46Å; T77-C96 VanDerWaalsContact OG1-O 3.12Å
78	G	85.9	Confident	86.6	Confident	31 Å²	31	54.4 Å²	54.4	32%	0.32	34%	0.336	S	S	.	.	S	Bend	trans	76	6.8	-169.7	0	0	0	0	0	114.3	C63 C74	C63-G78 WeakPolarHBondContact CB-O 3.37Å; C63-G78 PolarHBondContact N-O 3.46Å; C63-G78 VanDerWaalsContact SG-C 3.59Å; C63-G78 PolarHBondContact SG-O 2.94Å; C63-G78 VanDerWaalsContact SG-O 3.41Å; C74-G78 WeakPolarHBondContact O-CA 3.2Å; C74-G78 PolarHBondContact O-N 3.09Å
79	Y	86	Confident	86.6	Confident	52 Å²	52	59.9 Å²	59.9	20%	0.204	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.6	142.1	-179.2	-71.6	-101.9	0	0	0	110.8	S61 P62 T77 C96 M101	S61-Y79 VanDerWaalsContact C-CD1 3.42Å; S61-Y79 WeakPolarHBondContact O-CA 3.11Å; P62-Y79 HydrophobicContact CB-CD1 4.11Å; P62-Y79 HydrophobicContact CB-CE1 3.67Å; P62-Y79 HydrophobicContact CG-CE1 4.23Å; T77-Y79 WeakPolarHBondContact O-CD2 3.47Å; T77-Y79 PolarHBondContact O-N 2.87Å; T77-Y79 PolarHBondContact OG1-N 3.37Å; T77-Y79 PolarHBondContact OG1-O 3.18Å; T77-Y79 VanDerWaalsContact OG1-O 3.08Å; Y79-C96 PolarHBondContact O-N 2.95Å; Y79-M101 HydrophobicContact CE2-CE 3.76Å; Y79-M101 HydrophobicContact CE2-CG 4.23Å; Y79-M101 HydrophobicContact CE2-SD 4.41Å; Y79-M101 WeakPolarHBondContact OH-CE 3.31Å; Y79-M101 PolarHBondContact OH-SD 3.12Å; Y79-M101 VanDerWaalsContact OH-SD 3.39Å
80	V	90.9	Very high	86.5	Confident	5 Å²	5	59.2 Å²	59.2	3%	0.03	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.6	146	178	-70.5	0	0	0	0	111.8	S61 E73 C74 K94	S61-V80 PolarHBondContact N-O 2.88Å; S61-V80 PolarHBondContact O-N 3.34Å; E73-V80 HydrophobicContact CB-CG1 4.06Å; C74-V80 HydrophobicContact CB-CG1 4.43Å; C74-V80 WeakPolarHBondContact SG-CG1 3.48Å; V80-K94 VanDerWaalsContact CA-O 3.31Å; V80-K94 WeakPolarHBondContact CA-O 3.27Å
81	E	90.4	Very high	86.5	Confident	33 Å²	33	59.9 Å²	59.9	15%	0.154	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	146.7	166.9	65.3	-175.5	-177.4	0	0	109.5	I83 K94 C96	E81-I83 HydrophobicContact CG-CG2 4.24Å; E81-K94 HydrophobicContact CG-CB 4.05Å; E81-K94 PolarHBondContact N-O 2.91Å; E81-K94 PolarHBondContact O-N 3.31Å; E81-K94 VanDerWaalsContact O-N 3.07Å; E81-K94 WeakPolarHBondContact OE1-CD 3.43Å; E81-K94 IonicContact OE1-NZ 3.15Å; E81-C96 HydrophobicContact CB-CB 4.06Å; E81-C96 HydrophobicContact CG-CB 3.96Å; E81-C96 PolarHBondContact N-SG 2.95Å
82	K	91	Very high	86.7	Confident	66 Å²	66	62.2 Å²	62.2	29%	0.287	35%	0.351	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.8	122.7	177.9	-167.9	-177.8	-171	179.6	0	108.6	T57 T58 I91 F93	T57-K82 PolarHBondContact N-O 3.45Å; T58-K82 PolarHBondContact N-O 3.27Å; T58-K82 VanDerWaalsContact N-O 3.1Å; T58-K82 PolarHBondContact O-N 3.48Å; K82-I91 HydrophobicContact CD-CG2 4.1Å; K82-I91 HydrophobicContact CG-CG2 3.79Å; K82-F93 HydrophobicContact CB-CD1 4.42Å; K82-F93 HydrophobicContact CB-CE1 4.24Å; K82-F93 HydrophobicContact CD-CE1 4.29Å; K82-F93 HydrophobicContact CG-CD1 4.39Å; K82-F93 HydrophobicContact CG-CE1 3.96Å; K82-F93 HydrophobicContact CG-CZ 4.46Å
83	I	91	Very high	86.8	Confident	0 Å²	0	60.5 Å²	60.5	0%	0	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	144.9	-179.1	61.6	-178.5	0	0	0	109.9	W49 F54 V55 V56 E81 I91 E92 K94	W49-I83 HydrophobicContact CB-CD1 3.41Å; W49-I83 VanDerWaalsContact CB-CD1 3.41Å; W49-I83 HydrophobicContact CD2-CD1 4.38Å; W49-I83 HydrophobicContact CG-CD1 3.5Å; W49-I83 VanDerWaalsContact CG-CD1 3.5Å; F54-I83 HydrophobicContact CB-CB 4.49Å; F54-I83 HydrophobicContact CD2-CB 3.96Å; F54-I83 HydrophobicContact CD2-CD1 4.3Å; F54-I83 HydrophobicContact CD2-CG2 3.75Å; F54-I83 HydrophobicContact CE2-CG2 4.09Å; F54-I83 HydrophobicContact CG-CD1 4.44Å; V55-I83 WeakPolarHBondContact O-CA 3.44Å; V56-I83 HydrophobicContact CG2-CG2 4.12Å; E81-I83 HydrophobicContact CG-CG2 4.24Å; I83-I91 WeakPolarHBondContact O-CA 3.31Å; I83-E92 HydrophobicContact CD1-CB 4.44Å; I83-E92 HydrophobicContact CG1-CB 4.06Å; I83-E92 WeakPolarHBondContact CG1-O 3.27Å; I83-E92 PolarHBondContact N-O 3.44Å; I83-E92 PolarHBondContact O-N 3.43Å; I83-K94 HydrophobicContact CD1-CB 4.28Å
84	T	91.2	Very high	86.9	Confident	36 Å²	36	59.4 Å²	59.4	22%	0.221	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	121.4	172.9	-55.9	0	0	0	0	107.9	V55 T57 R90	V55-T84 PolarHBondContact N-O 3.46Å; V55-T84 PolarHBondContact O-N 2.89Å; T57-T84 WeakPolarHBondContact OG1-CB 3.47Å; T57-T84 PolarHBondContact OG1-OG1 3.27Å; T84-R90 WeakPolarHBondContact CA-O 3.49Å
85	C	89.2	Confident	87	Confident	0 Å²	0	61 Å²	61	0%	0	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.3	132	178.5	-69.9	0	0	0	0	110.4	C48 W49 E52 S88 K89 R90	C48-C85 HydrophobicContact CB-CB 3.78Å; C48-C85 WeakPolarHBondContact CB-SG 3.31Å; C48-C85 WeakPolarHBondContact SG-CB 3.26Å; C48-C85 CovalentContact SG-SG 2.02Å; C48-C85 PolarHBondContact SG-SG 3.29Å; W49-C85 PolarHBondContact N-SG 3.34Å; E52-C85 WeakPolarHBondContact OE2-CB 3.34Å; C85-S88 WeakPolarHBondContact CB-OG 3.48Å; C85-K89 WeakPolarHBondContact O-CA 3.32Å; C85-K89 PolarHBondContact O-N 3.49Å; C85-R90 PolarHBondContact N-O 3.35Å
86	S	88.8	Confident	87.2	Confident	60 Å²	60	58.3 Å²	58.3	42%	0.42	31%	0.31	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.5	-36.7	-168.6	-64.4	0	0	0	0	113.2	E53	E53-S86 VanDerWaalsContact O-CB 3.27Å; E53-S86 WeakPolarHBondContact O-CB 3.29Å; E53-S86 PolarHBondContact O-N 3.38Å; E53-S86 PolarHBondContact O-OG 2.99Å
87	S	84.4	Confident	87.1	Confident	91 Å²	91	62.1 Å²	62.1	64%	0.636	31%	0.312	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.8	-49.7	-177.1	152.6	0	0	0	0	111.4	E52	E52-S87 VanDerWaalsContact OE1-CB 3.24Å; E52-S87 WeakPolarHBondContact OE1-CB 3.45Å; E52-S87 PolarHBondContact OE1-OG 3.15Å; E52-S87 WeakPolarHBondContact OE2-CB 3.45Å
88	S	83.4	Confident	86.6	Confident	40 Å²	40	60.7 Å²	60.7	28%	0.28	30%	0.304	S	S	.	.	T	Hydrogen-bonded Turn	trans	-84.2	-14.4	-178.8	58.4	0	0	0	0	114.9	E52 C85 R90	E52-S88 VanDerWaalsContact OE2-CB 3.32Å; E52-S88 WeakPolarHBondContact OE2-CB 3.32Å; E52-S88 PolarHBondContact OE2-N 3.31Å; E52-S88 PolarHBondContact OE2-OG 3.48Å; C85-S88 WeakPolarHBondContact CB-OG 3.48Å; S88-R90 PolarHBondContact O-N 3.05Å; S88-R90 VanDerWaalsContact O-N 3.07Å
89	K	86.4	Confident	85.9	Confident	171 Å²	171	62.1 Å²	62.1	74%	0.743	31%	0.313	S	S	*	.			trans	52.7	22.3	-171.8	-60.9	-171.8	179.9	-177.4	0	114	C85	C85-K89 WeakPolarHBondContact O-CA 3.32Å; C85-K89 PolarHBondContact O-N 3.49Å
90	R	85.8	Confident	85	Confident	166 Å²	166	64.9 Å²	64.9	63%	0.626	33%	0.331	S	S	*	.			trans	-81.6	141.1	177.6	-67.9	179.5	-176.8	-160.6	2	109.8	T84 C85 S88	T84-R90 WeakPolarHBondContact CA-O 3.49Å; C85-R90 PolarHBondContact N-O 3.35Å; S88-R90 PolarHBondContact O-N 3.05Å; S88-R90 VanDerWaalsContact O-N 3.07Å
91	I	87	Confident	83.8	Confident	88 Å²	88	68 Å²	68	45%	0.451	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.7	121.3	174.3	-64.6	175.8	0	0	0	107	K82 I83	K82-I91 HydrophobicContact CD-CG2 4.1Å; K82-I91 HydrophobicContact CG-CG2 3.79Å; I83-I91 WeakPolarHBondContact O-CA 3.31Å
92	E	87.9	Confident	82.8	Confident	71 Å²	71	70.6 Å²	70.6	33%	0.332	36%	0.358	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	158.3	174.3	-66.4	-64.9	167.7	0	0	109.9	C48 I83	C48-E92 WeakPolarHBondContact SG-CG 3.2Å; I83-E92 HydrophobicContact CD1-CB 4.44Å; I83-E92 HydrophobicContact CG1-CB 4.06Å; I83-E92 WeakPolarHBondContact CG1-O 3.27Å; I83-E92 PolarHBondContact N-O 3.44Å; I83-E92 PolarHBondContact O-N 3.43Å
93	F	88.1	Confident	82	Confident	70 Å²	70	73 Å²	73	31%	0.307	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	143.6	173.1	-64.4	-83.9	0	0	0	108.9	T71 K82	T71-F93 HydrophobicContact CG2-CB 4.13Å; T71-F93 HydrophobicContact CG2-CG 4.45Å; K82-F93 HydrophobicContact CB-CD1 4.42Å; K82-F93 HydrophobicContact CB-CE1 4.24Å; K82-F93 HydrophobicContact CD-CE1 4.29Å; K82-F93 HydrophobicContact CG-CD1 4.39Å; K82-F93 HydrophobicContact CG-CE1 3.96Å; K82-F93 HydrophobicContact CG-CZ 4.46Å
94	K	87.8	Confident	81.4	Confident	49 Å²	49	78.9 Å²	78.9	21%	0.213	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.4	140.3	177.4	-179.9	179.4	167.3	-166.7	0	109.6	W49 V80 E81 I83 C96	W49-K94 HydrophobicContact CD2-CD 4Å; W49-K94 HydrophobicContact CE3-CD 3.99Å; W49-K94 HydrophobicContact CH2-CD 3.98Å; W49-K94 HydrophobicContact CZ2-CD 3.96Å; W49-K94 HydrophobicContact CZ2-CG 4.2Å; W49-K94 HydrophobicContact CZ3-CD 3.99Å; V80-K94 VanDerWaalsContact CA-O 3.31Å; V80-K94 WeakPolarHBondContact CA-O 3.27Å; E81-K94 HydrophobicContact CG-CB 4.05Å; E81-K94 PolarHBondContact N-O 2.91Å; E81-K94 PolarHBondContact O-N 3.31Å; E81-K94 VanDerWaalsContact O-N 3.07Å; E81-K94 WeakPolarHBondContact OE1-CD 3.43Å; E81-K94 IonicContact OE1-NZ 3.15Å; I83-K94 HydrophobicContact CD1-CB 4.28Å; K94-C96 PolarHBondContact O-N 3.34Å
95	S	87.5	Confident	80.8	Confident	40 Å²	40	81.7 Å²	81.7	28%	0.28	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.7	128.5	170.1	63.1	0	0	0	0	110	E73	E73-S95 WeakPolarHBondContact O-CB 3.48Å
96	C	86.4	Confident	80.5	Confident	9 Å²	9	87.4 Å²	87.4	6%	0.061	44%	0.436	C	S	.	.			trans	-119.3	148.8	-179.7	59.7	0	0	0	0	110.4	C60 T77 Y79 E81 K94	C60-C96 WeakPolarHBondContact CA-SG 3.23Å; C60-C96 HydrophobicContact CB-CB 3.73Å; C60-C96 WeakPolarHBondContact CB-SG 3.27Å; C60-C96 WeakPolarHBondContact SG-CB 3.47Å; C60-C96 CovalentContact SG-SG 2.01Å; C60-C96 PolarHBondContact SG-SG 3.3Å; T77-C96 PolarHBondContact OG1-O 3.46Å; T77-C96 VanDerWaalsContact OG1-O 3.12Å; Y79-C96 PolarHBondContact O-N 2.95Å; E81-C96 HydrophobicContact CB-CB 4.06Å; E81-C96 HydrophobicContact CG-CB 3.96Å; E81-C96 PolarHBondContact N-SG 2.95Å; K94-C96 PolarHBondContact O-N 3.34Å
97	R	78.6	Confident	80.4	Confident	171 Å²	171	94 Å²	94	65%	0.645	45%	0.452	S	S	*	.			trans	-106.9	99	172.8	-169.5	173	177.6	111.3	6.3	107.4	A99 E102	R97-A99 PolarHBondContact O-N 3.28Å; R97-E102 IonicContact CZ-OE1 2.76Å; R97-E102 IonicContact NE-OE1 3.88Å; R97-E102 PolarHBondContact NE-OE1 3.07Å; R97-E102 IonicContact NH2-OE1 2.68Å; R97-E102 PolarHBondContact NH2-OE1 3.39Å
98	S	71.4	Confident	80.3	Confident	25 Å²	25	97.4 Å²	97.4	18%	0.175	46%	0.455	C	S	.	.			trans	-74.4	122.6	-178.1	-174.5	0	0	0	0	111	L100 M101 E102	S98-L100 PolarHBondContact O-N 3.34Å; S98-L100 PolarHBondContact OG-N 3.16Å; S98-M101 WeakPolarHBondContact O-CB 3.45Å; S98-M101 PolarHBondContact O-N 3Å; S98-M101 VanDerWaalsContact O-N 3.09Å; S98-E102 PolarHBondContact O-N 3.21Å
99	A	71.1	Confident	80.5	Confident	62 Å²	62	101.6 Å²	101.6	51%	0.512	47%	0.468	S	S	.	.	H	α-helix	trans	-60.5	-29.7	173.2	0	0	0	0	0	112.5	R97 M101 E102 Q103	R97-A99 PolarHBondContact O-N 3.28Å; A99-M101 VanDerWaalsContact C-N 3.32Å; A99-M101 PolarHBondContact O-N 3.39Å; A99-E102 PolarHBondContact O-N 3.07Å; A99-Q103 WeakPolarHBondContact O-CG 3.31Å; A99-Q103 PolarHBondContact O-N 3.47Å; A99-Q103 VanDerWaalsContact O-N 3.11Å
100	L	66.1	Low	80.7	Confident	110 Å²	110	97.7 Å²	97.7	58%	0.576	45%	0.453	S	S	*	.	H	α-helix	trans	-67.3	-34.4	175.5	-67.7	176.1	0	0	0	112	S98 Q103 H104	S98-L100 PolarHBondContact O-N 3.34Å; S98-L100 PolarHBondContact OG-N 3.16Å; L100-Q103 PolarHBondContact O-N 3.18Å; L100-H104 PolarHBondContact O-CD2 2.79Å; L100-H104 PolarHBondContact O-N 3.05Å
101	M	66.1	Low	80.9	Confident	70 Å²	70	91.6 Å²	91.6	35%	0.345	44%	0.442	S	S	.	.	H	α-helix	trans	-68.7	-41.3	176.1	-176.8	59.7	152.7	0	0	111.2	Y79 S98 A99 Q103 H104 L105	Y79-M101 HydrophobicContact CE2-CE 3.76Å; Y79-M101 HydrophobicContact CE2-CG 4.23Å; Y79-M101 HydrophobicContact CE2-SD 4.41Å; Y79-M101 WeakPolarHBondContact OH-CE 3.31Å; Y79-M101 PolarHBondContact OH-SD 3.12Å; Y79-M101 VanDerWaalsContact OH-SD 3.39Å; S98-M101 WeakPolarHBondContact O-CB 3.45Å; S98-M101 PolarHBondContact O-N 3Å; S98-M101 VanDerWaalsContact O-N 3.09Å; A99-M101 VanDerWaalsContact C-N 3.32Å; A99-M101 PolarHBondContact O-N 3.39Å; M101-Q103 VanDerWaalsContact C-N 3.27Å; M101-Q103 PolarHBondContact O-N 2.95Å; M101-H104 PolarHBondContact O-N 2.87Å; M101-L105 PolarHBondContact O-N 3.2Å
102	E	70.2	Confident	81	Confident	87 Å²	87	89.9 Å²	89.9	41%	0.407	44%	0.441	S	S	.	.	H	α-helix	trans	-60.1	-39.9	174.7	-63	-170.7	140.3	0	0	111.4	R97 S98 A99 L105 F106	R97-E102 IonicContact CZ-OE1 2.76Å; R97-E102 IonicContact NE-OE1 3.88Å; R97-E102 PolarHBondContact NE-OE1 3.07Å; R97-E102 IonicContact NH2-OE1 2.68Å; R97-E102 PolarHBondContact NH2-OE1 3.39Å; S98-E102 PolarHBondContact O-N 3.21Å; A99-E102 PolarHBondContact O-N 3.07Å; E102-L105 PolarHBondContact O-N 2.92Å; E102-F106 VanDerWaalsContact O-CB 3.23Å; E102-F106 WeakPolarHBondContact O-CB 3.42Å; E102-F106 PolarHBondContact O-N 2.98Å
103	Q	74.1	Confident	81.1	Confident	116 Å²	116	89.9 Å²	89.9	54%	0.542	45%	0.446	S	S	.	.	H	α-helix	trans	-64.9	-41.9	174.7	-71.5	-177.6	-2.8	0	0	112.8	A99 L100 M101 F106 W107	A99-Q103 WeakPolarHBondContact O-CG 3.31Å; A99-Q103 PolarHBondContact O-N 3.47Å; A99-Q103 VanDerWaalsContact O-N 3.11Å; L100-Q103 PolarHBondContact O-N 3.18Å; M101-Q103 VanDerWaalsContact C-N 3.27Å; M101-Q103 PolarHBondContact O-N 2.95Å; Q103-F106 WeakPolarHBondContact O-CB 3.28Å; Q103-F106 PolarHBondContact O-N 2.76Å; Q103-W107 VanDerWaalsContact O-CD1 3.31Å; Q103-W107 PolarHBondContact O-N 2.68Å
104	H	77.6	Confident	81.3	Confident	125 Å²	125	90.7 Å²	90.7	58%	0.579	46%	0.456	S	S	*	.	H	α-helix	trans	-65.5	-41.6	176.3	-78.3	-58.7	0	0	0	112.4	L100 M101 F106 W107 K108	L100-H104 PolarHBondContact O-CD2 2.79Å; L100-H104 PolarHBondContact O-N 3.05Å; M101-H104 PolarHBondContact O-N 2.87Å; H104-F106 VanDerWaalsContact C-N 3.32Å; H104-W107 PolarHBondContact O-N 3.29Å; H104-K108 VanDerWaalsContact O-CG 3.28Å; H104-K108 WeakPolarHBondContact O-CG 3.42Å; H104-K108 PolarHBondContact O-N 3.5Å
105	L	79.1	Confident	81.5	Confident	95 Å²	95	94.4 Å²	94.4	50%	0.497	47%	0.472	S	S	.	.	H	α-helix	trans	-62.5	-43.6	174.9	-125.9	68.7	0	0	0	110.9	M101 E102 K108 F109	M101-L105 PolarHBondContact O-N 3.2Å; E102-L105 PolarHBondContact O-N 2.92Å; L105-K108 PolarHBondContact O-N 3.07Å; L105-F109 WeakPolarHBondContact O-CB 3.36Å; L105-F109 PolarHBondContact O-N 3.11Å
106	F	82.8	Confident	81.6	Confident	119 Å²	119	94.5 Å²	94.5	52%	0.522	47%	0.471	S	S	.	.	H	α-helix	trans	-57.7	-50.5	175.1	-179.8	-96	0	0	0	111.7	E102 Q103 H104 K108 F109 E110	E102-F106 VanDerWaalsContact O-CB 3.23Å; E102-F106 WeakPolarHBondContact O-CB 3.42Å; E102-F106 PolarHBondContact O-N 2.98Å; Q103-F106 WeakPolarHBondContact O-CB 3.28Å; Q103-F106 PolarHBondContact O-N 2.76Å; H104-F106 VanDerWaalsContact C-N 3.32Å; F106-K108 VanDerWaalsContact C-N 3.31Å; F106-K108 PolarHBondContact O-N 3.35Å; F106-F109 PolarHBondContact O-N 3.37Å; F106-E110 HydrophobicContact CE1-CB 4.39Å; F106-E110 VanDerWaalsContact O-CB 3.27Å; F106-E110 WeakPolarHBondContact O-CB 3.15Å; F106-E110 PolarHBondContact O-N 2.88Å
107	W	86.7	Confident	81.8	Confident	199 Å²	199	96.7 Å²	96.7	75%	0.754	49%	0.49	S	S	*	.	H	α-helix	trans	-63	-35.9	179.2	-91.9	84.2	0	0	0	113.2	Q103 H104 G111	Q103-W107 VanDerWaalsContact O-CD1 3.31Å; Q103-W107 PolarHBondContact O-N 2.68Å; H104-W107 PolarHBondContact O-N 3.29Å; W107-G111 PolarHBondContact O-N 3.41Å
108	K	82.9	Confident	82.5	Confident	163 Å²	163	93.6 Å²	93.6	71%	0.709	49%	0.485	S	S	*	.	H	α-helix	trans	-69	-40.7	175.9	-70	179.4	85.8	168.7	0	111.4	H104 L105 F106 A112	H104-K108 VanDerWaalsContact O-CG 3.28Å; H104-K108 WeakPolarHBondContact O-CG 3.42Å; H104-K108 PolarHBondContact O-N 3.5Å; L105-K108 PolarHBondContact O-N 3.07Å; F106-K108 VanDerWaalsContact C-N 3.31Å; F106-K108 PolarHBondContact O-N 3.35Å; K108-A112 VanDerWaalsContact O-CB 3.31Å; K108-A112 WeakPolarHBondContact O-CB 3.17Å; K108-A112 PolarHBondContact O-N 3.4Å; K108-A112 VanDerWaalsContact O-N 3.07Å
109	F	86.1	Confident	83.4	Confident	128 Å²	128	95.6 Å²	95.6	56%	0.561	49%	0.493	S	S	*	.	H	α-helix	trans	-66.7	-53.8	175.9	175.6	-97.5	0	0	0	111.7	L105 F106 G111 A112 V113	L105-F109 WeakPolarHBondContact O-CB 3.36Å; L105-F109 PolarHBondContact O-N 3.11Å; F106-F109 PolarHBondContact O-N 3.37Å; F109-G111 VanDerWaalsContact C-N 3.31Å; F109-G111 PolarHBondContact O-N 2.89Å; F109-A112 WeakPolarHBondContact O-CB 3.18Å; F109-A112 PolarHBondContact O-N 3.39Å; F109-V113 HydrophobicContact CD1-CG2 4.26Å; F109-V113 HydrophobicContact CD2-CG2 4.33Å; F109-V113 HydrophobicContact CE1-CG2 3.81Å; F109-V113 HydrophobicContact CE2-CG2 3.88Å; F109-V113 HydrophobicContact CZ-CG2 3.6Å; F109-V113 WeakPolarHBondContact O-CG2 3.48Å; F109-V113 PolarHBondContact O-N 3.4Å
110	E	90.8	Very high	84.2	Confident	88 Å²	88	95.7 Å²	95.7	41%	0.411	48%	0.482	S	S	.	.	H	α-helix	trans	-56.6	-47	-179.8	-170	67.8	-168.7	0	0	110.5	F106 A112 V113 V114	F106-E110 HydrophobicContact CE1-CB 4.39Å; F106-E110 VanDerWaalsContact O-CB 3.27Å; F106-E110 WeakPolarHBondContact O-CB 3.15Å; F106-E110 PolarHBondContact O-N 2.88Å; E110-A112 VanDerWaalsContact C-N 3.35Å; E110-A112 PolarHBondContact O-N 3.31Å; E110-V113 PolarHBondContact O-N 3.45Å; E110-V114 WeakPolarHBondContact O-CB 3.03Å; E110-V114 VanDerWaalsContact O-CG2 3.29Å; E110-V114 WeakPolarHBondContact O-CG2 3.31Å; E110-V114 PolarHBondContact O-N 3.03Å
111	G	90.8	Very high	85.4	Confident	39 Å²	39	92.6 Å²	92.6	40%	0.402	47%	0.473	S	S	.	.	H	α-helix	trans	-60.6	-40.9	175.7	0	0	0	0	0	113.2	W107 F109 F115	W107-G111 PolarHBondContact O-N 3.41Å; F109-G111 VanDerWaalsContact C-N 3.31Å; F109-G111 PolarHBondContact O-N 2.89Å; G111-F115 VanDerWaalsContact O-CB 3.31Å; G111-F115 WeakPolarHBondContact O-CB 3.47Å; G111-F115 PolarHBondContact O-N 3.02Å
112	A	89.3	Confident	86.5	Confident	52 Å²	52	92.2 Å²	92.2	43%	0.43	48%	0.477	S	S	.	.	H	α-helix	trans	-65.4	-43.7	176.9	0	0	0	0	0	112	K108 F109 E110 F115 V116	K108-A112 VanDerWaalsContact O-CB 3.31Å; K108-A112 WeakPolarHBondContact O-CB 3.17Å; K108-A112 PolarHBondContact O-N 3.4Å; K108-A112 VanDerWaalsContact O-N 3.07Å; F109-A112 WeakPolarHBondContact O-CB 3.18Å; F109-A112 PolarHBondContact O-N 3.39Å; E110-A112 VanDerWaalsContact C-N 3.35Å; E110-A112 PolarHBondContact O-N 3.31Å; A112-F115 PolarHBondContact O-N 3.41Å; A112-V116 WeakPolarHBondContact O-CB 3.42Å; A112-V116 VanDerWaalsContact O-CG2 3.27Å; A112-V116 WeakPolarHBondContact O-CG2 3.41Å; A112-V116 PolarHBondContact O-N 3.09Å
113	V	89.6	Confident	87.4	Confident	71 Å²	71	91.1 Å²	91.1	43%	0.43	47%	0.473	S	S	.	.	H	α-helix	trans	-65	-45.1	179.1	174.2	0	0	0	0	111	F109 E110 F115 V116 A117	F109-V113 HydrophobicContact CD1-CG2 4.26Å; F109-V113 HydrophobicContact CD2-CG2 4.33Å; F109-V113 HydrophobicContact CE1-CG2 3.81Å; F109-V113 HydrophobicContact CE2-CG2 3.88Å; F109-V113 HydrophobicContact CZ-CG2 3.6Å; F109-V113 WeakPolarHBondContact O-CG2 3.48Å; F109-V113 PolarHBondContact O-N 3.4Å; E110-V113 PolarHBondContact O-N 3.45Å; V113-F115 VanDerWaalsContact C-N 3.35Å; V113-F115 PolarHBondContact O-N 2.92Å; V113-V116 PolarHBondContact O-N 3.21Å; V113-A117 WeakPolarHBondContact O-CB 3Å; V113-A117 PolarHBondContact O-N 3.22Å
114	V	93.4	Very high	88.1	Confident	86 Å²	86	89.2 Å²	89.2	52%	0.521	47%	0.469	S	S	.	.	H	α-helix	trans	-60.7	-44.2	176.4	170.5	0	0	0	0	111.2	E110 A117 L118	E110-V114 WeakPolarHBondContact O-CB 3.03Å; E110-V114 VanDerWaalsContact O-CG2 3.29Å; E110-V114 WeakPolarHBondContact O-CG2 3.31Å; E110-V114 PolarHBondContact O-N 3.03Å; V114-A117 PolarHBondContact O-N 3.08Å; V114-L118 PolarHBondContact O-N 3.1Å
115	F	91.3	Very high	88.6	Confident	128 Å²	128	86.8 Å²	86.8	56%	0.561	46%	0.46	S	S	*	.	H	α-helix	trans	-63	-45.2	178.1	-180	-104	0	0	0	112.2	G111 A112 V113 L118 I119	G111-F115 VanDerWaalsContact O-CB 3.31Å; G111-F115 WeakPolarHBondContact O-CB 3.47Å; G111-F115 PolarHBondContact O-N 3.02Å; A112-F115 PolarHBondContact O-N 3.41Å; V113-F115 VanDerWaalsContact C-N 3.35Å; V113-F115 PolarHBondContact O-N 2.92Å; F115-L118 WeakPolarHBondContact O-CB 2.97Å; F115-L118 PolarHBondContact O-N 2.93Å; F115-I119 HydrophobicContact CD1-CD1 3.8Å; F115-I119 HydrophobicContact CE1-CD1 3.32Å; F115-I119 HydrophobicContact CE1-CG1 4.31Å; F115-I119 HydrophobicContact CZ-CD1 3.74Å; F115-I119 HydrophobicContact CZ-CG1 4.39Å; F115-I119 WeakPolarHBondContact O-CG1 2.97Å; F115-I119 PolarHBondContact O-N 2.97Å; F115-I119 VanDerWaalsContact O-N 3.07Å
116	V	89.1	Confident	88.9	Confident	41 Å²	41	86.9 Å²	86.9	25%	0.248	46%	0.46	C	S	.	.	H	α-helix	trans	-61	-46	175.9	168.2	0	0	0	0	110.6	T24 A112 V113 L118 I119 F120	T24-V116 HydrophobicContact CG2-CG1 4.18Å; A112-V116 WeakPolarHBondContact O-CB 3.42Å; A112-V116 VanDerWaalsContact O-CG2 3.27Å; A112-V116 WeakPolarHBondContact O-CG2 3.41Å; A112-V116 PolarHBondContact O-N 3.09Å; V113-V116 PolarHBondContact O-N 3.21Å; V116-L118 VanDerWaalsContact C-N 3.31Å; V116-L118 PolarHBondContact O-N 3.18Å; V116-I119 WeakPolarHBondContact O-CB 3.46Å; V116-I119 PolarHBondContact O-N 3.46Å; V116-F120 HydrophobicContact CG1-CD2 3.68Å; V116-F120 HydrophobicContact CG1-CE2 3.35Å; V116-F120 WeakPolarHBondContact O-CD2 3.35Å; V116-F120 PolarHBondContact O-N 2.9Å; V116-F120 VanDerWaalsContact O-N 3.09Å
117	A	90.4	Very high	89.1	Confident	55 Å²	55	88.3 Å²	88.3	46%	0.455	46%	0.462	S	S	.	.	H	α-helix	trans	-58.6	-41.1	176.7	0	0	0	0	0	112.2	V113 V114 F120 A121	V113-A117 WeakPolarHBondContact O-CB 3Å; V113-A117 PolarHBondContact O-N 3.22Å; V114-A117 PolarHBondContact O-N 3.08Å; A117-F120 PolarHBondContact O-N 3.49Å; A117-A121 WeakPolarHBondContact O-CB 3.39Å; A117-A121 PolarHBondContact O-N 3.39Å
118	L	94.5	Very high	88.9	Confident	106 Å²	106	84 Å²	84	56%	0.555	45%	0.45	S	S	*	.	H	α-helix	trans	-62.6	-42.6	176.4	-176.1	65.1	0	0	0	112.1	V114 F115 V116 F120 A121 C122	V114-L118 PolarHBondContact O-N 3.1Å; F115-L118 WeakPolarHBondContact O-CB 2.97Å; F115-L118 PolarHBondContact O-N 2.93Å; V116-L118 VanDerWaalsContact C-N 3.31Å; V116-L118 PolarHBondContact O-N 3.18Å; L118-F120 VanDerWaalsContact C-N 3.34Å; L118-F120 PolarHBondContact O-N 3.16Å; L118-A121 PolarHBondContact O-N 3.29Å; L118-C122 WeakPolarHBondContact O-CB 3.47Å; L118-C122 PolarHBondContact O-N 3.21Å; L118-C122 PolarHBondContact O-SG 3.3Å; L118-C122 VanDerWaalsContact O-SG 3.34Å
119	I	89.6	Confident	89.1	Confident	67 Å²	67	84.1 Å²	84.1	34%	0.344	45%	0.446	S	S	.	.	H	α-helix	trans	-58.7	-48.4	175.6	-69.9	169.4	0	0	0	110.1	F115 V116 A121 C122 L123	F115-I119 HydrophobicContact CD1-CD1 3.8Å; F115-I119 HydrophobicContact CE1-CD1 3.32Å; F115-I119 HydrophobicContact CE1-CG1 4.31Å; F115-I119 HydrophobicContact CZ-CD1 3.74Å; F115-I119 HydrophobicContact CZ-CG1 4.39Å; F115-I119 WeakPolarHBondContact O-CG1 2.97Å; F115-I119 PolarHBondContact O-N 2.97Å; F115-I119 VanDerWaalsContact O-N 3.07Å; V116-I119 WeakPolarHBondContact O-CB 3.46Å; V116-I119 PolarHBondContact O-N 3.46Å; I119-A121 PolarHBondContact O-N 3.04Å; I119-C122 PolarHBondContact O-N 2.91Å; I119-L123 HydrophobicContact CG2-CD1 4.05Å; I119-L123 HydrophobicContact CG2-CG 4.46Å; I119-L123 WeakPolarHBondContact O-CG 3.46Å; I119-L123 PolarHBondContact O-N 3.44Å
120	F	88.2	Confident	88.8	Confident	64 Å²	64	83.3 Å²	83.3	28%	0.281	44%	0.444	S	S	.	.	H	α-helix	trans	-61.8	-43.7	178.4	-76.9	-71.5	0	0	0	112.3	L20 T24 V116 A117 L118 C122 L123 V124	L20-F120 HydrophobicContact CB-CE1 3.52Å; L20-F120 HydrophobicContact CB-CZ 3.55Å; L20-F120 HydrophobicContact CD1-CD1 4.12Å; L20-F120 HydrophobicContact CD1-CE1 3.59Å; L20-F120 HydrophobicContact CD1-CZ 4.27Å; L20-F120 HydrophobicContact CD2-CE1 4.33Å; L20-F120 HydrophobicContact CD2-CZ 4.21Å; L20-F120 HydrophobicContact CG-CE1 4.01Å; L20-F120 HydrophobicContact CG-CZ 4.22Å; T24-F120 HydrophobicContact CG2-CE2 4.31Å; T24-F120 HydrophobicContact CG2-CZ 4.46Å; V116-F120 HydrophobicContact CG1-CD2 3.68Å; V116-F120 HydrophobicContact CG1-CE2 3.35Å; V116-F120 WeakPolarHBondContact O-CD2 3.35Å; V116-F120 PolarHBondContact O-N 2.9Å; V116-F120 VanDerWaalsContact O-N 3.09Å; A117-F120 PolarHBondContact O-N 3.49Å; L118-F120 VanDerWaalsContact C-N 3.34Å; L118-F120 PolarHBondContact O-N 3.16Å; F120-C122 PolarHBondContact O-N 2.01Å; F120-L123 PolarHBondContact O-N 3.45Å; F120-V124 WeakPolarHBondContact O-CG2 3.05Å; F120-V124 PolarHBondContact O-N 3.49Å
121	A	90.5	Very high	88.1	Confident	46 Å²	46	84.1 Å²	84.1	38%	0.38	45%	0.45	S	S	.	.	H	α-helix	trans	-58.8	-47	176.7	0	0	0	0	0	111.5	A117 L118 I119 L123 V124 I125	A117-A121 WeakPolarHBondContact O-CB 3.39Å; A117-A121 PolarHBondContact O-N 3.39Å; L118-A121 PolarHBondContact O-N 3.29Å; I119-A121 PolarHBondContact O-N 3.04Å; A121-L123 PolarHBondContact O-N 3.41Å; A121-V124 PolarHBondContact O-N 3.12Å; A121-I125 VanDerWaalsContact O-CG1 3.31Å; A121-I125 WeakPolarHBondContact O-CG1 3.08Å; A121-I125 PolarHBondContact O-N 2.03Å
122	C	90.1	Very high	87.5	Confident	62 Å²	62	87.4 Å²	87.4	42%	0.419	46%	0.459	S	S	.	.	H	α-helix	trans	-58.5	-45.8	176	-74.2	0	0	0	0	112.3	L118 I119 F120 V124 I125 I126	L118-C122 WeakPolarHBondContact O-CB 3.47Å; L118-C122 PolarHBondContact O-N 3.21Å; L118-C122 PolarHBondContact O-SG 3.3Å; L118-C122 VanDerWaalsContact O-SG 3.34Å; I119-C122 PolarHBondContact O-N 2.91Å; F120-C122 PolarHBondContact O-N 2.01Å; C122-V124 VanDerWaalsContact C-N 3.34Å; C122-V124 PolarHBondContact O-N 3.14Å; C122-I125 PolarHBondContact O-N 3.12Å; C122-I126 VanDerWaalsContact O-CG1 3.27Å; C122-I126 WeakPolarHBondContact O-CG1 3.5Å; C122-I126 PolarHBondContact O-N 2.91Å
123	L	88.2	Confident	87	Confident	64 Å²	64	93.9 Å²	93.9	34%	0.335	47%	0.472	S	S	.	.	H	α-helix	trans	-61.1	-42.4	177.9	-71	174	0	0	0	112.1	L16 L20 I119 F120 A121 I126 R127	L16-L123 HydrophobicContact CD2-CD1 4.28Å; L16-L123 HydrophobicContact CD2-CD2 4.29Å; L20-L123 HydrophobicContact CD1-CD1 3.68Å; I119-L123 HydrophobicContact CG2-CD1 4.05Å; I119-L123 HydrophobicContact CG2-CG 4.46Å; I119-L123 WeakPolarHBondContact O-CG 3.46Å; I119-L123 PolarHBondContact O-N 3.44Å; F120-L123 PolarHBondContact O-N 3.45Å; A121-L123 PolarHBondContact O-N 3.41Å; L123-I126 PolarHBondContact O-N 2.78Å; L123-R127 WeakPolarHBondContact O-CB 3.41Å; L123-R127 PolarHBondContact O-N 3.06Å
124	V	88.6	Confident	86.5	Confident	76 Å²	76	96 Å²	96	46%	0.461	48%	0.475	S	S	.	.	H	α-helix	trans	-63.4	-46.2	177.3	170.4	0	0	0	0	110.9	F120 A121 C122 I126 R127 Q128	F120-V124 WeakPolarHBondContact O-CG2 3.05Å; F120-V124 PolarHBondContact O-N 3.49Å; A121-V124 PolarHBondContact O-N 3.12Å; C122-V124 VanDerWaalsContact C-N 3.34Å; C122-V124 PolarHBondContact O-N 3.14Å; V124-I126 PolarHBondContact O-N 3.24Å; V124-R127 PolarHBondContact O-N 3Å; V124-Q128 HydrophobicContact CG1-CG 4.39Å; V124-Q128 WeakPolarHBondContact O-CG 3.39Å; V124-Q128 PolarHBondContact O-N 3.23Å
125	I	89.4	Confident	85.6	Confident	74 Å²	74	94.4 Å²	94.4	38%	0.379	47%	0.471	S	S	.	.	H	α-helix	trans	-61.4	-45.3	178.5	-68.5	165.8	0	0	0	111.1	A121 C122 R127 Q128 R129	A121-I125 VanDerWaalsContact O-CG1 3.31Å; A121-I125 WeakPolarHBondContact O-CG1 3.08Å; A121-I125 PolarHBondContact O-N 2.03Å; C122-I125 PolarHBondContact O-N 3.12Å; I125-R127 VanDerWaalsContact C-N 3.28Å; I125-R127 PolarHBondContact O-N 3.41Å; I125-Q128 PolarHBondContact O-N 3.03Å; I125-R129 HydrophobicContact CG2-CG 4.35Å; I125-R129 WeakPolarHBondContact O-CB 3.21Å; I125-R129 VanDerWaalsContact O-CG 3.32Å; I125-R129 WeakPolarHBondContact O-CG 3.4Å; I125-R129 PolarHBondContact O-N 2.84Å
126	I	84.1	Confident	84.3	Confident	96 Å²	96	93.8 Å²	93.8	49%	0.492	47%	0.474	S	S	.	.	H	α-helix	trans	-59.7	-43.9	178.2	-69.5	164.9	0	0	0	110.1	C122 L123 V124 R129 Q130	C122-I126 VanDerWaalsContact O-CG1 3.27Å; C122-I126 WeakPolarHBondContact O-CG1 3.5Å; C122-I126 PolarHBondContact O-N 2.91Å; L123-I126 PolarHBondContact O-N 2.78Å; V124-I126 PolarHBondContact O-N 3.24Å; I126-R129 PolarHBondContact O-N 3.5Å; I126-Q130 WeakPolarHBondContact O-CG 3.49Å; I126-Q130 PolarHBondContact O-N 3.47Å
127	R	86.8	Confident	83.7	Confident	150 Å²	150	97.9 Å²	97.9	57%	0.566	49%	0.49	S	S	*	.	H	α-helix	trans	-65.5	-42.7	179	-173.9	176.4	175.6	142.6	-1.6	112.3	L123 V124 I125 Q130 L131	L123-R127 WeakPolarHBondContact O-CB 3.41Å; L123-R127 PolarHBondContact O-N 3.06Å; V124-R127 PolarHBondContact O-N 3Å; I125-R127 VanDerWaalsContact C-N 3.28Å; I125-R127 PolarHBondContact O-N 3.41Å; R127-Q130 PolarHBondContact O-N 3.1Å; R127-L131 PolarHBondContact O-N 2.02Å
128	Q	84.5	Confident	82.9	Confident	108 Å²	108	102.5 Å²	102.5	51%	0.505	50%	0.5	S	S	.	.	H	α-helix	trans	-61.2	-47.1	175.1	-75	170.2	-4.2	0	0	110.8	V124 I125 Q130 L131 D132	V124-Q128 HydrophobicContact CG1-CG 4.39Å; V124-Q128 WeakPolarHBondContact O-CG 3.39Å; V124-Q128 PolarHBondContact O-N 3.23Å; I125-Q128 PolarHBondContact O-N 3.03Å; Q128-Q130 VanDerWaalsContact C-N 3.26Å; Q128-Q130 PolarHBondContact O-N 3.36Å; Q128-L131 WeakPolarHBondContact O-CA 3.46Å; Q128-L131 WeakPolarHBondContact O-CB 3.46Å; Q128-L131 PolarHBondContact O-N 3.2Å; Q128-D132 PolarHBondContact O-N 2.87Å
129	R	85.9	Confident	81.8	Confident	165 Å²	165	101.2 Å²	101.2	62%	0.623	50%	0.496	S	S	*	.	H	α-helix	trans	-58.8	-35.5	175.8	-73.4	178.5	178.1	-177	1.1	113.1	I125 I126 L131 R133	I125-R129 HydrophobicContact CG2-CG 4.35Å; I125-R129 WeakPolarHBondContact O-CB 3.21Å; I125-R129 VanDerWaalsContact O-CG 3.32Å; I125-R129 WeakPolarHBondContact O-CG 3.4Å; I125-R129 PolarHBondContact O-N 2.84Å; I126-R129 PolarHBondContact O-N 3.5Å; R129-L131 VanDerWaalsContact C-N 3.34Å; R129-R133 WeakPolarHBondContact O-CG 3.27Å; R129-R133 PolarHBondContact O-N 3.14Å
130	Q	79	Confident	80.8	Confident	112 Å²	112	106.5 Å²	106.5	52%	0.523	51%	0.512	S	S	.	.	H	α-helix	trans	-67.3	-35.2	174.2	-72.7	-141.3	-2.5	0	0	112.8	I126 R127 Q128 K134	I126-Q130 WeakPolarHBondContact O-CG 3.49Å; I126-Q130 PolarHBondContact O-N 3.47Å; R127-Q130 PolarHBondContact O-N 3.1Å; Q128-Q130 VanDerWaalsContact C-N 3.26Å; Q128-Q130 PolarHBondContact O-N 3.36Å; Q130-K134 VanDerWaalsContact O-CG 3.29Å; Q130-K134 WeakPolarHBondContact O-CG 3.08Å; Q130-K134 PolarHBondContact O-N 3.04Å
131	L	77.8	Confident	80	Confident	105 Å²	105	111 Å²	111	55%	0.55	53%	0.531	S	S	.	.	H	α-helix	trans	-70.9	-41.8	175.7	-69.4	169.3	0	0	0	110.9	R127 Q128 R129 K134 A135	R127-L131 PolarHBondContact O-N 2.02Å; Q128-L131 WeakPolarHBondContact O-CA 3.46Å; Q128-L131 WeakPolarHBondContact O-CB 3.46Å; Q128-L131 PolarHBondContact O-N 3.2Å; R129-L131 VanDerWaalsContact C-N 3.34Å; L131-K134 PolarHBondContact O-N 3.4Å; L131-A135 WeakPolarHBondContact O-CB 3.48Å; L131-A135 PolarHBondContact O-N 3.03Å
132	D	77.3	Confident	78.8	Confident	108 Å²	108	115.1 Å²	115.1	58%	0.578	54%	0.542	S	S	*	.	H	α-helix	trans	-63.3	-43.4	177.9	-70.8	-19.2	0	0	0	112.2	Q128 K134 A135 L136	Q128-D132 PolarHBondContact O-N 2.87Å; D132-K134 VanDerWaalsContact C-N 3.31Å; D132-K134 PolarHBondContact O-N 3.44Å; D132-A135 PolarHBondContact O-N 3.3Å; D132-L136 WeakPolarHBondContact O-CB 3.24Å; D132-L136 PolarHBondContact O-N 3.07Å
133	R	79.2	Confident	78.1	Confident	187 Å²	187	117.9 Å²	117.9	71%	0.706	55%	0.552	S	S	*	*	H	α-helix	trans	-59.6	-42.6	174.6	-74.5	-171.5	-177.1	-139.7	2.1	111.9	R129 L136 E137	R129-R133 WeakPolarHBondContact O-CG 3.27Å; R129-R133 PolarHBondContact O-N 3.14Å; R133-L136 PolarHBondContact O-N 3.08Å; R133-E137 WeakPolarHBondContact O-CB 3.32Å; R133-E137 WeakPolarHBondContact O-CG 3.42Å; R133-E137 PolarHBondContact O-N 3.16Å
134	K	77.9	Confident	77	Confident	115 Å²	115	122.8 Å²	122.8	50%	0.5	57%	0.573	S	S	.	*	H	α-helix	trans	-68.4	-33.6	177.7	-72.5	173.4	-175.7	172.1	0	112.6	Q130 L131 D132 K138	Q130-K134 VanDerWaalsContact O-CG 3.29Å; Q130-K134 WeakPolarHBondContact O-CG 3.08Å; Q130-K134 PolarHBondContact O-N 3.04Å; L131-K134 PolarHBondContact O-N 3.4Å; D132-K134 VanDerWaalsContact C-N 3.31Å; D132-K134 PolarHBondContact O-N 3.44Å; K134-K138 WeakPolarHBondContact O-CG 3.34Å; K134-K138 PolarHBondContact O-N 2.91Å
135	A	74.4	Confident	75.7	Confident	53 Å²	53	123.8 Å²	123.8	44%	0.438	58%	0.583	S	S	.	*	H	α-helix	trans	-70.3	-44.4	175.6	0	0	0	0	0	111.1	L131 D132 E137 K138 V139	L131-A135 WeakPolarHBondContact O-CB 3.48Å; L131-A135 PolarHBondContact O-N 3.03Å; D132-A135 PolarHBondContact O-N 3.3Å; A135-E137 PolarHBondContact O-N 3.05Å; A135-K138 WeakPolarHBondContact O-CB 3.44Å; A135-K138 PolarHBondContact O-N 2.76Å; A135-K138 VanDerWaalsContact O-N 3.14Å; A135-V139 PolarHBondContact O-N 2.87Å; A135-V139 VanDerWaalsContact O-N 3.13Å
136	L	64.8	Low	74	Confident	116 Å²	116	129.9 Å²	129.9	61%	0.607	62%	0.615	S	S	*	*	H	α-helix	trans	-68	-36.6	-179.1	-155.7	146.2	0	0	0	112	D132 R133 K138 V139 R140	D132-L136 WeakPolarHBondContact O-CB 3.24Å; D132-L136 PolarHBondContact O-N 3.07Å; R133-L136 PolarHBondContact O-N 3.08Å; L136-K138 VanDerWaalsContact C-N 3.31Å; L136-K138 PolarHBondContact O-N 2.76Å; L136-V139 PolarHBondContact O-N 2.85Å; L136-R140 PolarHBondContact O-N 3.18Å
137	E	76	Confident	73.5	Confident	126 Å²	126	131.6 Å²	131.6	59%	0.589	62%	0.621	S	S	*	*	H	α-helix	trans	-61.8	-35.9	170.8	-79	176	-171.6	0	0	113	R133 A135 K141	R133-E137 WeakPolarHBondContact O-CB 3.32Å; R133-E137 WeakPolarHBondContact O-CG 3.42Å; R133-E137 PolarHBondContact O-N 3.16Å; A135-E137 PolarHBondContact O-N 3.05Å; E137-K141 PolarHBondContact O-N 2.81Å
138	K	73.6	Confident	72.8	Confident	152 Å²	152	130.6 Å²	130.6	66%	0.661	62%	0.624	S	S	*	*	H	α-helix	trans	-67.2	-42	175.6	-73.8	175.7	-179.1	-175.6	0	111.6	K134 A135 L136 Q142	K134-K138 WeakPolarHBondContact O-CG 3.34Å; K134-K138 PolarHBondContact O-N 2.91Å; A135-K138 WeakPolarHBondContact O-CB 3.44Å; A135-K138 PolarHBondContact O-N 2.76Å; A135-K138 VanDerWaalsContact O-N 3.14Å; L136-K138 VanDerWaalsContact C-N 3.31Å; L136-K138 PolarHBondContact O-N 2.76Å; K138-Q142 PolarHBondContact O-N 2.92Å
139	V	70.9	Confident	72.2	Confident	80 Å²	80	131.8 Å²	131.8	49%	0.485	63%	0.63	S	S	.	*	H	α-helix	trans	-64.8	-44.3	176.7	176.7	0	0	0	0	110.8	A135 L136 K141 Q142 I143	A135-V139 PolarHBondContact O-N 2.87Å; A135-V139 VanDerWaalsContact O-N 3.13Å; L136-V139 PolarHBondContact O-N 2.85Å; V139-K141 VanDerWaalsContact C-N 3.33Å; V139-K141 PolarHBondContact O-N 2.88Å; V139-Q142 WeakPolarHBondContact O-CB 3.38Å; V139-Q142 PolarHBondContact O-N 2.88Å; V139-I143 HydrophobicContact CG1-CD1 4.2Å; V139-I143 PolarHBondContact O-N 3.34Å
140	R	69.6	Low	71.3	Confident	178 Å²	178	129.9 Å²	129.9	67%	0.672	63%	0.631	S	S	*	*	H	α-helix	trans	-60.3	-41.4	179.5	-127.2	-176.8	-179.5	175.1	-0.1	112.7	L136 Q142 I143 E144	L136-R140 PolarHBondContact O-N 3.18Å; R140-Q142 VanDerWaalsContact C-N 3.25Å; R140-Q142 PolarHBondContact O-N 3.07Å; R140-I143 PolarHBondContact O-N 2.98Å; R140-I143 VanDerWaalsContact O-N 3.11Å; R140-E144 PolarHBondContact O-N 2.75Å; R140-E144 VanDerWaalsContact O-N 3.15Å
141	K	72.4	Confident	70.9	Confident	157 Å²	157	131 Å²	131	68%	0.683	64%	0.637	S	S	*	*	H	α-helix	trans	-64.6	-26.2	175.4	-78.8	-173.5	175.6	-173.9	0	114	E137 V139 S145	E137-K141 PolarHBondContact O-N 2.81Å; V139-K141 VanDerWaalsContact C-N 3.33Å; V139-K141 PolarHBondContact O-N 2.88Å; K141-S145 PolarHBondContact O-OG 3.1Å
142	Q	65.2	Low	70.4	Confident	133 Å²	133	132.7 Å²	132.7	62%	0.621	64%	0.643	S	S	*	*	H	α-helix	trans	-74.9	-27.5	173.3	-70.9	-173.2	-64.3	0	0	112.6	K138 V139 R140 S145 I146	K138-Q142 PolarHBondContact O-N 2.92Å; V139-Q142 WeakPolarHBondContact O-CB 3.38Å; V139-Q142 PolarHBondContact O-N 2.88Å; R140-Q142 VanDerWaalsContact C-N 3.25Å; R140-Q142 PolarHBondContact O-N 3.07Å; Q142-S145 PolarHBondContact O-OG 2.92Å; Q142-I146 WeakPolarHBondContact O-CD1 3.42Å; Q142-I146 WeakPolarHBondContact O-CG1 3.46Å
143	I	73.7	Confident	69.9	Low	120 Å²	120	134.5 Å²	134.5	62%	0.615	65%	0.648	S	S	*	*	H	α-helix	trans	-81	-32.2	179.5	-58	166.9	0	0	0	110.9	V139 R140 S145	V139-I143 HydrophobicContact CG1-CD1 4.2Å; V139-I143 PolarHBondContact O-N 3.34Å; R140-I143 PolarHBondContact O-N 2.98Å; R140-I143 VanDerWaalsContact O-N 3.11Å; I143-S145 VanDerWaalsContact C-N 3.33Å
144	E	65.4	Low	69.2	Low	168 Å²	168	130.5 Å²	130.5	79%	0.785	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.5	-12.4	-178.5	-156.9	167.3	-152.5	0	0	113.3	R140	R140-E144 PolarHBondContact O-N 2.75Å; R140-E144 VanDerWaalsContact O-N 3.15Å
145	S	61.3	Low	68.5	Low	96 Å²	96	131.8 Å²	131.8	67%	0.671	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.1	8.9	177.4	73.8	0	0	0	0	114.2	K141 Q142 I143	K141-S145 PolarHBondContact O-OG 3.1Å; Q142-S145 PolarHBondContact O-OG 2.92Å; I143-S145 VanDerWaalsContact C-N 3.33Å
146	I	54.4	Low	67.9	Low	202 Å²	202	138.9 Å²	138.9	100%	1.036	68%	0.675	S	S	*	*			trans	-100	0	176.1	-69.3	170.4	0	0	0	109.1	Q142	Q142-I146 WeakPolarHBondContact O-CD1 3.42Å; Q142-I146 WeakPolarHBondContact O-CG1 3.46Å

Retrieved 146 of 146 residues in 547.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).