M3ZQZ5_XIPMA Loading...

TAFA chemokine like family member 5

AlphaFold DB , UniProt , Accession M3ZQZ5, Species XIPMA (Xiphophorus maculatus, Southern platyfish), Gene n/a, Length 132 aa.

						>M3ZQZ5_XIPMA|M3ZQZ5
MASVPRSARRKDATRWPRMSSTFWAVVLLTALLVLYCGQLAAGTCEIVTLNKDSSQPRRTIARQTARCACKKGQIAGTTRARPACVDAGIVRKRQWCEMVPCLEDEGCDLLVNKSGWTCTQPGGRVKTTTAL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	36.5	Very low	47.4	Very low	249 Å²	249	164.5 Å²	164.5	100%	1.227	86%	0.855	S	S	*	*				0	138	0	-75	168.5	-179.9	0	0	108.5
2	A	44.3	Very low	47.9	Very low	97 Å²	97	162.3 Å²	162.3	80%	0.802	85%	0.845	S	S	*	*			trans	-70.4	160.7	-163.4	0	0	0	0	0	115.2
3	S	39.7	Very low	48.3	Very low	124 Å²	124	157.2 Å²	157.2	87%	0.867	84%	0.841	S	S	*	*			trans	-167.2	105.1	134.6	27.4	0	0	0	0	111.7
4	V	45.3	Very low	48.6	Very low	137 Å²	137	154.4 Å²	154.4	83%	0.83	83%	0.833	S	S	*	*			trans	-104.4	160.5	152.3	175.3	0	0	0	0	105.2
5	P	62.6	Low	48.5	Very low	106 Å²	106	159.8 Å²	159.8	69%	0.688	84%	0.837	S	S	*	*			cis	-126.7	179.2	-15.9	25.9	-4.8	0	0	0	112.6
6	R	48.8	Very low	48.6	Very low	252 Å²	252	163.2 Å²	163.2	95%	0.951	84%	0.835	S	S	*	*			trans	-154.8	112.2	132	-113	169.5	-161.4	-179.8	5.5	112.9
7	S	50.7	Low	49	Very low	112 Å²	112	158.4 Å²	158.4	78%	0.783	82%	0.817	S	S	*	*			trans	-41.4	134.4	161.7	177.3	0	0	0	0	113.1
8	A	44.3	Very low	50	Low	88 Å²	88	163.8 Å²	163.8	73%	0.727	83%	0.825	S	S	*	*			trans	-157.5	61.6	143.9	0	0	0	0	0	110.1	R10	A8-R10 PolarHBondContact O-N 3.02Å
9	R	51.1	Low	50.7	Low	226 Å²	226	159.7 Å²	159.7	85%	0.853	80%	0.804	S	S	*	*			trans	-67.7	91.3	158.3	-166.4	-171.6	-86.1	-154	-0.6	105.9	K11	R9-K11 PolarHBondContact O-N 3.39Å
10	R	47.8	Very low	52.3	Low	248 Å²	248	155.1 Å²	155.1	94%	0.936	79%	0.787	S	S	*	*			trans	-62.3	100.3	172.3	-86.9	-167.2	-166.9	-153.6	4	107.8	A8	A8-R10 PolarHBondContact O-N 3.02Å
11	K	50.1	Low	53.7	Low	170 Å²	170	152.5 Å²	152.5	74%	0.739	78%	0.783	S	S	*	*			trans	-67.5	128.6	163.8	-80.8	176.3	172.8	178.2	0	108.8	R9	R9-K11 PolarHBondContact O-N 3.39Å
12	D	54.1	Low	55.9	Low	138 Å²	138	145.2 Å²	145.2	74%	0.738	75%	0.753	S	S	*	*			trans	49.7	79.9	138.4	-48.6	-39.4	0	0	0	115.8	T14	D12-T14 PolarHBondContact O-N 3.35Å; D12-T14 VanDerWaalsContact O-N 3.11Å
13	A	52.1	Low	57.8	Low	96 Å²	96	145.7 Å²	145.7	79%	0.793	74%	0.737	S	S	*	*			trans	-62.9	110.2	147.8	0	0	0	0	0	106.6	R15	A13-R15 PolarHBondContact O-N 2.7Å
14	T	53.3	Low	60.1	Low	119 Å²	119	146.9 Å²	146.9	73%	0.73	72%	0.723	S	S	*	*			trans	-46.9	84.9	167.6	29.8	0	0	0	0	110.3	D12 W16	D12-T14 PolarHBondContact O-N 3.35Å; D12-T14 VanDerWaalsContact O-N 3.11Å; T14-W16 PolarHBondContact O-N 2.06Å
15	R	47.3	Very low	62.2	Low	235 Å²	235	142.6 Å²	142.6	89%	0.887	70%	0.702	S	S	*	*			trans	-72.1	81.9	168.4	-172.4	177.6	-170.8	-170.7	2.2	106.5	A13 P17	A13-R15 PolarHBondContact O-N 2.7Å; R15-P17 VanDerWaalsContact O-N 3.12Å
16	W	49	Very low	63.5	Low	214 Å²	214	141.7 Å²	141.7	81%	0.811	69%	0.694	S	S	*	*			trans	-52.5	121.6	163.1	-78.2	75.7	0	0	0	106.3	T14 R18	T14-W16 PolarHBondContact O-N 2.06Å; W16-R18 PolarHBondContact O-N 3.43Å; W16-R18 VanDerWaalsContact O-N 3.08Å
17	P	56.7	Low	65.5	Low	82 Å²	82	132.5 Å²	132.5	53%	0.532	67%	0.666	S	S	.	*			trans	-58.3	126.9	-179.5	25.8	-32.6	0	0	0	105.9	R15 M19	R15-P17 VanDerWaalsContact O-N 3.12Å; P17-M19 HydrophobicContact CB-CE 3.68Å; P17-M19 HydrophobicContact CG-CE 3.56Å; P17-M19 HydrophobicContact CG-CG 4.4Å; P17-M19 PolarHBondContact O-N 3Å
18	R	66	Low	67.4	Low	255 Å²	255	132.7 Å²	132.7	96%	0.962	66%	0.657	S	S	*	*			trans	-67.9	79.7	176.5	-155.5	172.8	-178.6	-176.7	-0.4	105.6	W16 S20	W16-R18 PolarHBondContact O-N 3.43Å; W16-R18 VanDerWaalsContact O-N 3.08Å; R18-S20 PolarHBondContact O-N 2.8Å
19	M	64.6	Low	69.5	Low	87 Å²	87	134.5 Å²	134.5	43%	0.429	65%	0.654	S	S	.	*			trans	-57.8	133.3	-175.8	-81.6	-73.7	136.4	0	0	107.4	P17 F23	P17-M19 HydrophobicContact CB-CE 3.68Å; P17-M19 HydrophobicContact CG-CE 3.56Å; P17-M19 HydrophobicContact CG-CG 4.4Å; P17-M19 PolarHBondContact O-N 3Å; M19-F23 HydrophobicContact CB-CB 4.49Å; M19-F23 HydrophobicContact CB-CD1 3.83Å; M19-F23 HydrophobicContact CB-CG 4.42Å; M19-F23 HydrophobicContact CG-CD1 4.07Å; M19-F23 HydrophobicContact CG-CE1 4.31Å; M19-F23 HydrophobicContact SD-CD1 4.11Å; M19-F23 HydrophobicContact SD-CE1 4.34Å; M19-F23 HydrophobicContact SD-CG 4.25Å
20	S	81.3	Confident	71.3	Confident	66 Å²	66	127.2 Å²	127.2	46%	0.462	64%	0.635	S	S	.	*			trans	-49.3	143.2	-176.1	176.6	0	0	0	0	110.7	R18 T22 F23 W24	R18-S20 PolarHBondContact O-N 2.8Å; S20-T22 WeakPolarHBondContact CB-OG1 3.05Å; S20-T22 PolarHBondContact O-N 3.15Å; S20-T22 PolarHBondContact OG-N 2.96Å; S20-T22 PolarHBondContact OG-OG1 2.9Å; S20-F23 WeakPolarHBondContact O-CB 3.13Å; S20-F23 PolarHBondContact O-N 3.43Å; S20-W24 PolarHBondContact O-N 3.2Å
21	S	81.3	Confident	73.1	Confident	101 Å²	101	117.7 Å²	117.7	71%	0.706	61%	0.61	S	S	*	*	H	α-helix	trans	-53.2	-29.3	175	-171.9	0	0	0	0	112	A25	S21-A25 WeakPolarHBondContact O-CB 3.45Å; S21-A25 PolarHBondContact O-N 3.04Å
22	T	82.8	Confident	74.6	Confident	96 Å²	96	114.7 Å²	114.7	59%	0.589	60%	0.601	S	S	*	*	H	α-helix	trans	-67.6	-36	175.5	56	0	0	0	0	112.7	S20 A25 V26	S20-T22 WeakPolarHBondContact CB-OG1 3.05Å; S20-T22 PolarHBondContact O-N 3.15Å; S20-T22 PolarHBondContact OG-N 2.96Å; S20-T22 PolarHBondContact OG-OG1 2.9Å; T22-A25 PolarHBondContact O-N 2.76Å; T22-V26 WeakPolarHBondContact O-CB 3.38Å; T22-V26 VanDerWaalsContact O-CG2 3.23Å; T22-V26 WeakPolarHBondContact O-CG2 3.36Å; T22-V26 PolarHBondContact O-N 3.25Å
23	F	85.9	Confident	75.9	Confident	107 Å²	107	113.5 Å²	113.5	47%	0.469	59%	0.594	S	S	.	*	H	α-helix	trans	-65.8	-46.5	176.8	179.1	-97.3	0	0	0	110.9	M19 S20 A25 V26 V27	M19-F23 HydrophobicContact CB-CB 4.49Å; M19-F23 HydrophobicContact CB-CD1 3.83Å; M19-F23 HydrophobicContact CB-CG 4.42Å; M19-F23 HydrophobicContact CG-CD1 4.07Å; M19-F23 HydrophobicContact CG-CE1 4.31Å; M19-F23 HydrophobicContact SD-CD1 4.11Å; M19-F23 HydrophobicContact SD-CE1 4.34Å; M19-F23 HydrophobicContact SD-CG 4.25Å; S20-F23 WeakPolarHBondContact O-CB 3.13Å; S20-F23 PolarHBondContact O-N 3.43Å; F23-A25 PolarHBondContact O-N 2.9Å; F23-V26 PolarHBondContact O-N 3.37Å; F23-V27 HydrophobicContact CD1-CG2 4.32Å; F23-V27 HydrophobicContact CE1-CG2 4Å; F23-V27 HydrophobicContact CE2-CG2 4.46Å; F23-V27 HydrophobicContact CZ-CG2 4.08Å; F23-V27 VanDerWaalsContact O-CG2 3.3Å; F23-V27 WeakPolarHBondContact O-CG2 3.05Å; F23-V27 PolarHBondContact O-N 3.09Å
24	W	87.4	Confident	77.2	Confident	150 Å²	150	114.3 Å²	114.3	57%	0.568	59%	0.589	S	S	*	*	H	α-helix	trans	-64.5	-38.9	175.2	-72.7	105.1	0	0	0	112.6	S20 V27 L28	S20-W24 PolarHBondContact O-N 3.2Å; W24-V27 PolarHBondContact O-N 2.98Å; W24-L28 WeakPolarHBondContact O-CB 3.39Å; W24-L28 WeakPolarHBondContact O-CG 3.22Å; W24-L28 PolarHBondContact O-N 3.01Å
25	A	88.8	Confident	78.2	Confident	46 Å²	46	114.3 Å²	114.3	38%	0.38	58%	0.584	S	S	.	*	H	α-helix	trans	-62	-43.7	174.8	0	0	0	0	0	111.9	S21 T22 F23 L28 L29	S21-A25 WeakPolarHBondContact O-CB 3.45Å; S21-A25 PolarHBondContact O-N 3.04Å; T22-A25 PolarHBondContact O-N 2.76Å; F23-A25 PolarHBondContact O-N 2.9Å; A25-L28 PolarHBondContact O-N 2.89Å; A25-L29 WeakPolarHBondContact O-CB 3.43Å; A25-L29 PolarHBondContact O-N 2.04Å
26	V	90.4	Very high	79.3	Confident	88 Å²	88	111.1 Å²	111.1	53%	0.533	57%	0.573	S	S	.	*	H	α-helix	trans	-66.3	-40.7	176.5	171.4	0	0	0	0	111.5	T22 F23 L29 T30	T22-V26 WeakPolarHBondContact O-CB 3.38Å; T22-V26 VanDerWaalsContact O-CG2 3.23Å; T22-V26 WeakPolarHBondContact O-CG2 3.36Å; T22-V26 PolarHBondContact O-N 3.25Å; F23-V26 PolarHBondContact O-N 3.37Å; V26-L29 PolarHBondContact O-N 2.88Å; V26-T30 HydrophobicContact CG1-CG2 4.28Å; V26-T30 WeakPolarHBondContact O-CB 3.39Å; V26-T30 VanDerWaalsContact O-CG2 3.27Å; V26-T30 WeakPolarHBondContact O-CG2 3.43Å; V26-T30 PolarHBondContact O-N 2.83Å; V26-T30 PolarHBondContact O-OG1 3.37Å
27	V	90.8	Very high	80.1	Confident	59 Å²	59	106.1 Å²	106.1	36%	0.358	57%	0.569	S	S	.	*	H	α-helix	trans	-63.8	-43.1	175.4	170.9	0	0	0	0	111.1	F23 W24 T30 A31	F23-V27 HydrophobicContact CD1-CG2 4.32Å; F23-V27 HydrophobicContact CE1-CG2 4Å; F23-V27 HydrophobicContact CE2-CG2 4.46Å; F23-V27 HydrophobicContact CZ-CG2 4.08Å; F23-V27 VanDerWaalsContact O-CG2 3.3Å; F23-V27 WeakPolarHBondContact O-CG2 3.05Å; F23-V27 PolarHBondContact O-N 3.09Å; W24-V27 PolarHBondContact O-N 2.98Å; V27-T30 WeakPolarHBondContact CA-OG1 3.4Å; V27-T30 PolarHBondContact O-OG1 2.9Å; V27-A31 VanDerWaalsContact O-CB 3.25Å; V27-A31 WeakPolarHBondContact O-CB 2.92Å; V27-A31 PolarHBondContact O-N 3.49Å
28	L	90.3	Very high	80.4	Confident	115 Å²	115	104.8 Å²	104.8	60%	0.602	57%	0.57	S	S	*	*	H	α-helix	trans	-65	-44	176.3	-77.2	166.7	0	0	0	111.8	W24 A25 A31 L32	W24-L28 WeakPolarHBondContact O-CB 3.39Å; W24-L28 WeakPolarHBondContact O-CG 3.22Å; W24-L28 PolarHBondContact O-N 3.01Å; A25-L28 PolarHBondContact O-N 2.89Å; L28-A31 PolarHBondContact O-N 3.48Å; L28-L32 WeakPolarHBondContact O-CB 3.19Å; L28-L32 PolarHBondContact O-N 2.9Å
29	L	89.8	Confident	80.5	Confident	126 Å²	126	99.2 Å²	99.2	66%	0.66	56%	0.555	S	S	*	*	H	α-helix	trans	-63.1	-44.7	177.1	-105	147.5	0	0	0	112.2	A25 V26 L32 L33	A25-L29 WeakPolarHBondContact O-CB 3.43Å; A25-L29 PolarHBondContact O-N 2.04Å; V26-L29 PolarHBondContact O-N 2.88Å; L29-L32 PolarHBondContact O-N 2.86Å; L29-L33 WeakPolarHBondContact O-CB 3.02Å; L29-L33 PolarHBondContact O-N 2.92Å
30	T	87.2	Confident	80.7	Confident	73 Å²	73	97.3 Å²	97.3	45%	0.448	55%	0.547	S	S	.	.	H	α-helix	trans	-66.8	-40.9	177.8	51	0	0	0	0	111.3	V26 V27 L33 V34	V26-T30 HydrophobicContact CG1-CG2 4.28Å; V26-T30 WeakPolarHBondContact O-CB 3.39Å; V26-T30 VanDerWaalsContact O-CG2 3.27Å; V26-T30 WeakPolarHBondContact O-CG2 3.43Å; V26-T30 PolarHBondContact O-N 2.83Å; V26-T30 PolarHBondContact O-OG1 3.37Å; V27-T30 WeakPolarHBondContact CA-OG1 3.4Å; V27-T30 PolarHBondContact O-OG1 2.9Å; T30-L33 PolarHBondContact O-N 3.34Å; T30-V34 VanDerWaalsContact O-CG2 3.26Å; T30-V34 WeakPolarHBondContact O-CG2 3.44Å; T30-V34 PolarHBondContact O-N 3.49Å
31	A	85.4	Confident	80.5	Confident	49 Å²	49	97.4 Å²	97.4	41%	0.405	55%	0.551	S	S	.	*	H	α-helix	trans	-61.6	-44.2	173	0	0	0	0	0	112.1	V27 L28 L33 V34 L35	V27-A31 VanDerWaalsContact O-CB 3.25Å; V27-A31 WeakPolarHBondContact O-CB 2.92Å; V27-A31 PolarHBondContact O-N 3.49Å; L28-A31 PolarHBondContact O-N 3.48Å; A31-L33 PolarHBondContact O-N 3.44Å; A31-V34 PolarHBondContact O-N 3.16Å; A31-L35 WeakPolarHBondContact O-CB 3.31Å; A31-L35 VanDerWaalsContact O-CG 3.28Å; A31-L35 WeakPolarHBondContact O-CG 3.29Å; A31-L35 PolarHBondContact O-N 3.1Å
32	L	83.3	Confident	80.4	Confident	107 Å²	107	96.2 Å²	96.2	56%	0.56	55%	0.548	S	S	*	.	H	α-helix	trans	-61.6	-43.9	176.2	-128	97.1	0	0	0	111.5	L28 L29 L35 Y36	L28-L32 WeakPolarHBondContact O-CB 3.19Å; L28-L32 PolarHBondContact O-N 2.9Å; L29-L32 PolarHBondContact O-N 2.86Å; L32-L35 PolarHBondContact O-N 3.4Å; L32-Y36 WeakPolarHBondContact O-CB 3.33Å; L32-Y36 PolarHBondContact O-N 2.77Å
33	L	81.4	Confident	80.3	Confident	113 Å²	113	93.3 Å²	93.3	59%	0.592	54%	0.536	S	S	*	.	H	α-helix	trans	-64.1	-43.1	-179.8	-170.4	73.6	0	0	0	111.6	L29 T30 A31 L35 Y36 C37	L29-L33 WeakPolarHBondContact O-CB 3.02Å; L29-L33 PolarHBondContact O-N 2.92Å; T30-L33 PolarHBondContact O-N 3.34Å; A31-L33 PolarHBondContact O-N 3.44Å; L33-L35 VanDerWaalsContact C-N 3.33Å; L33-L35 PolarHBondContact O-N 3.02Å; L33-Y36 PolarHBondContact O-N 2.88Å; L33-C37 WeakPolarHBondContact O-CB 3.18Å; L33-C37 PolarHBondContact O-N 3.45Å
34	V	78.1	Confident	80.3	Confident	112 Å²	112	91 Å²	91	68%	0.679	53%	0.531	S	S	*	.	H	α-helix	trans	-63.3	-40.4	175.5	171	0	0	0	0	111.1	T30 A31 Y36	T30-V34 VanDerWaalsContact O-CG2 3.26Å; T30-V34 WeakPolarHBondContact O-CG2 3.44Å; T30-V34 PolarHBondContact O-N 3.49Å; A31-V34 PolarHBondContact O-N 3.16Å; V34-Y36 VanDerWaalsContact C-N 3.32Å; V34-Y36 PolarHBondContact O-N 2.95Å
35	L	74.4	Confident	80.5	Confident	120 Å²	120	85.3 Å²	85.3	63%	0.628	51%	0.514	S	S	*	.	H	α-helix	trans	-65	-35.4	175.1	-74.4	166.3	0	0	0	112.5	A31 L32 L33	A31-L35 WeakPolarHBondContact O-CB 3.31Å; A31-L35 VanDerWaalsContact O-CG 3.28Å; A31-L35 WeakPolarHBondContact O-CG 3.29Å; A31-L35 PolarHBondContact O-N 3.1Å; L32-L35 PolarHBondContact O-N 3.4Å; L33-L35 VanDerWaalsContact C-N 3.33Å; L33-L35 PolarHBondContact O-N 3.02Å
36	Y	71.4	Confident	80.5	Confident	167 Å²	167	89 Å²	89	66%	0.655	52%	0.523	S	S	*	.	H	α-helix	trans	-79	-43.5	-178.3	-120.1	-95.7	0	0	0	113.2	L32 L33 V34 G38 Q39	L32-Y36 WeakPolarHBondContact O-CB 3.33Å; L32-Y36 PolarHBondContact O-N 2.77Å; L33-Y36 PolarHBondContact O-N 2.88Å; V34-Y36 VanDerWaalsContact C-N 3.32Å; V34-Y36 PolarHBondContact O-N 2.95Å; Y36-G38 PolarHBondContact O-N 3.46Å; Y36-G38 VanDerWaalsContact O-N 3.12Å; Y36-Q39 PolarHBondContact O-N 3.48Å; Y36-Q39 VanDerWaalsContact O-N 3.15Å
37	C	64.3	Low	80.5	Confident	109 Å²	109	88.3 Å²	88.3	74%	0.736	52%	0.516	S	S	*	.	H	α-helix	trans	-64.7	-16.4	-179.2	-84	0	0	0	0	114.1	L33	L33-C37 WeakPolarHBondContact O-CB 3.18Å; L33-C37 PolarHBondContact O-N 3.45Å
38	G	64.4	Low	80.4	Confident	54 Å²	54	88.8 Å²	88.8	56%	0.557	52%	0.519	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.6	-6	176.9	0	0	0	0	0	115.1	Y36	Y36-G38 PolarHBondContact O-N 3.46Å; Y36-G38 VanDerWaalsContact O-N 3.12Å
39	Q	67	Low	80.2	Confident	139 Å²	139	86.8 Å²	86.8	65%	0.65	51%	0.512	S	S	*	.			trans	-91	112.5	-174.9	-61.9	-169.8	3	0	0	111	Y36	Y36-Q39 PolarHBondContact O-N 3.48Å; Y36-Q39 VanDerWaalsContact O-N 3.15Å
40	L	69.4	Low	80.1	Confident	47 Å²	47	86.3 Å²	86.3	25%	0.246	51%	0.509	C	S	.	.	P	Polyproline II helix	trans	-64.2	142	168.9	-78.9	134.9	0	0	0	110.3	E46 R67 A69	L40-E46 HydrophobicContact CD2-CB 3.76Å; L40-R67 HydrophobicContact CD1-CB 3.47Å; L40-R67 VanDerWaalsContact CD1-CB 3.47Å; L40-A69 HydrophobicContact CB-CB 3.7Å
41	A	76.7	Confident	80	Confident	67 Å²	67	87.6 Å²	87.6	55%	0.554	51%	0.513	S	S	*	.	P	Polyproline II helix	trans	-57.6	139.7	173.1	0	0	0	0	0	111	G43 T44	A41-G43 PolarHBondContact O-N 3.09Å; A41-G43 VanDerWaalsContact O-N 3.15Å; A41-T44 HydrophobicContact CB-CG2 3.94Å; A41-T44 PolarHBondContact O-N 3.43Å; A41-T44 VanDerWaalsContact O-N 3.07Å; A41-T44 PolarHBondContact O-OG1 2.9Å
42	A	79.3	Confident	80	Confident	77 Å²	77	92.3 Å²	92.3	64%	0.636	53%	0.525	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.9	120.3	-178.1	0	0	0	0	0	111.4
43	G	80.4	Confident	80.2	Confident	34 Å²	34	90.6 Å²	90.6	35%	0.351	52%	0.516	S	S	.	.	T	Hydrogen-bonded Turn	trans	101.8	3.2	-176.6	0	0	0	0	0	114.4	A41 A69	A41-G43 PolarHBondContact O-N 3.09Å; A41-G43 VanDerWaalsContact O-N 3.15Å; G43-A69 WeakPolarHBondContact CA-O 3.45Å; G43-A69 PolarHBondContact N-O 2.84Å
44	T	86.4	Confident	80.3	Confident	58 Å²	58	89.3 Å²	89.3	36%	0.356	52%	0.516	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.2	151.8	-178.2	70.3	0	0	0	0	113	A41 C68 A69	A41-T44 HydrophobicContact CB-CG2 3.94Å; A41-T44 PolarHBondContact O-N 3.43Å; A41-T44 VanDerWaalsContact O-N 3.07Å; A41-T44 PolarHBondContact O-OG1 2.9Å; T44-C68 WeakPolarHBondContact O-CA 3.38Å; T44-A69 PolarHBondContact O-N 2.83Å
45	C	91.3	Very high	80.6	Confident	32 Å²	32	88.1 Å²	88.1	22%	0.216	51%	0.513	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	133.4	170.8	-73.2	0	0	0	0	108.9	R67 C68 P83 A84	C45-R67 CarbonylContact C-O 3.59Å; C45-R67 VanDerWaalsContact CA-O 3.32Å; C45-R67 WeakPolarHBondContact CA-O 3.37Å; C45-C68 HydrophobicContact CB-CB 4.16Å; C45-C68 WeakPolarHBondContact CB-SG 3.4Å; C45-C68 WeakPolarHBondContact SG-CB 3.43Å; C45-C68 CovalentContact SG-SG 2.04Å; C45-C68 PolarHBondContact SG-SG 2.95Å; C45-P83 HydrophobicContact CB-CB 3.92Å; C45-P83 HydrophobicContact CB-CG 4.17Å; C45-P83 WeakPolarHBondContact CB-O 3.37Å; C45-A84 VanDerWaalsContact SG-C 3.58Å
46	E	89.8	Confident	80.9	Confident	122 Å²	122	87 Å²	87	57%	0.57	51%	0.505	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-125.9	137.9	177.9	-172.9	179	-171.7	0	0	110.2	L40 V48 A66 R67	L40-E46 HydrophobicContact CD2-CB 3.76Å; E46-V48 PolarHBondContact O-N 2.85Å; E46-A66 CarbonylContact O-C 3.57Å; E46-A66 WeakPolarHBondContact O-CA 3.38Å; E46-A66 WeakPolarHBondContact O-CB 3.37Å; E46-R67 PolarHBondContact N-O 3.17Å; E46-R67 PolarHBondContact O-N 3.13Å
47	I	89.6	Confident	81.1	Confident	75 Å²	75	85.6 Å²	85.6	39%	0.385	52%	0.516	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.9	117.1	177.5	-58.9	168.1	0	0	0	108.2	P83	I47-P83 HydrophobicContact CD1-CG 4.29Å; I47-P83 HydrophobicContact CG1-CG 3.67Å
48	V	88.4	Confident	81.9	Confident	69 Å²	69	92.5 Å²	92.5	42%	0.418	53%	0.527	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.6	-40	-177	-174.8	0	0	0	0	111.6	E46 T65 R67	E46-V48 PolarHBondContact O-N 2.85Å; V48-T65 PolarHBondContact N-O 2.89Å; V48-R67 HydrophobicContact CG2-CB 3.89Å; V48-R67 HydrophobicContact CG2-CG 3.53Å
49	T	87.1	Confident	82.7	Confident	73 Å²	73	97.1 Å²	97.1	45%	0.448	53%	0.527	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140	140.7	177.4	58.9	0	0	0	0	111	T65	T49-T65 PolarHBondContact N-O 2.76Å; T49-T65 PolarHBondContact O-N 2.88Å; T49-T65 WeakPolarHBondContact OG1-CB 3.31Å; T49-T65 PolarHBondContact OG1-OG1 3.09Å
50	L	87.3	Confident	83.6	Confident	115 Å²	115	93.6 Å²	93.6	60%	0.602	52%	0.515	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-125.5	113.3	173.4	178.7	64.6	0	0	0	107.9	Q64	L50-Q64 HydrophobicContact CD1-CB 4.4Å; L50-Q64 HydrophobicContact CD1-CG 3.54Å
51	N	85.8	Confident	84.3	Confident	100 Å²	100	93.4 Å²	93.4	54%	0.535	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114	129.2	175.4	-173.3	1.7	0	0	0	109.3	A62 R63	N51-A62 CarbonylContact O-C 3.45Å; N51-R63 HydrophobicContact CB-CB 4.39Å; N51-R63 PolarHBondContact N-O 3.36Å; N51-R63 PolarHBondContact O-N 2.84Å
52	K	85.1	Confident	84.7	Confident	148 Å²	148	93.4 Å²	93.4	64%	0.643	51%	0.514	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.7	115.5	179.6	-174	179.6	177.7	-176.5	0	108.5	T60	K52-T60 HydrophobicContact CD-CG2 4.22Å; K52-T60 VanDerWaalsContact CE-CG2 3.45Å; K52-T60 HydrophobicContact CG-CG2 3.72Å
53	D	86.1	Confident	84.9	Confident	71 Å²	71	97.6 Å²	97.6	38%	0.38	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.3	115.3	177.3	-173.5	-3.7	0	0	0	109.4	S55 T60 I61	D53-S55 WeakPolarHBondContact OD1-CB 3.15Å; D53-S55 PolarHBondContact OD1-N 3.49Å; D53-S55 PolarHBondContact OD1-OG 3.31Å; D53-S55 PolarHBondContact OD2-OG 2.98Å; D53-T60 WeakPolarHBondContact O-CA 3.35Å; D53-I61 HydrophobicContact CB-CB 4.41Å; D53-I61 PolarHBondContact N-O 2.79Å; D53-I61 PolarHBondContact O-N 2.72Å
54	S	83.8	Confident	85.2	Confident	86 Å²	86	101 Å²	101	60%	0.601	52%	0.521	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-110.8	17.3	176.4	61.9	0	0	0	0	112.7	Q56	S54-Q56 PolarHBondContact O-N 2.85Å
55	S	84.3	Confident	85.3	Confident	88 Å²	88	102 Å²	102	62%	0.615	53%	0.527	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-58	-27.3	178.5	56.1	0	0	0	0	113.2	D53	D53-S55 WeakPolarHBondContact OD1-CB 3.15Å; D53-S55 PolarHBondContact OD1-N 3.49Å; D53-S55 PolarHBondContact OD1-OG 3.31Å; D53-S55 PolarHBondContact OD2-OG 2.98Å
56	Q	81.8	Confident	85.2	Confident	96 Å²	96	102.3 Å²	102.3	45%	0.449	53%	0.532	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94	121	175.5	-66.7	177.3	19.9	0	0	111	S54 R58 R59	S54-Q56 PolarHBondContact O-N 2.85Å; Q56-R58 VanDerWaalsContact C-N 3.27Å; Q56-R58 PolarHBondContact O-N 2.83Å; Q56-R59 HydrophobicContact CB-CB 4.26Å; Q56-R59 WeakPolarHBondContact CB-O 3.2Å; Q56-R59 CarbonylContact O-C 3.55Å; Q56-R59 PolarHBondContact O-N 3.34Å; Q56-R59 VanDerWaalsContact O-N 3.14Å
57	P	75.4	Confident	85.3	Confident	137 Å²	137	104 Å²	104	89%	0.89	53%	0.532	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.6	-26.6	-173.9	22.9	-32.4	0	0	0	113.8
58	R	80.8	Confident	85.4	Confident	254 Å²	254	102.3 Å²	102.3	96%	0.958	53%	0.527	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.9	-10.9	177.2	-73.4	-169.2	-178.9	178.2	1.4	114.2	Q56	Q56-R58 VanDerWaalsContact C-N 3.27Å; Q56-R58 PolarHBondContact O-N 2.83Å
59	R	81.7	Confident	85.5	Confident	152 Å²	152	100.4 Å²	100.4	57%	0.574	52%	0.519	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-143.8	121.1	-171.9	-173.9	179.9	-177.3	178.5	1.7	111.2	Q56 I61	Q56-R59 HydrophobicContact CB-CB 4.26Å; Q56-R59 WeakPolarHBondContact CB-O 3.2Å; Q56-R59 CarbonylContact O-C 3.55Å; Q56-R59 PolarHBondContact O-N 3.34Å; Q56-R59 VanDerWaalsContact O-N 3.14Å; R59-I61 HydrophobicContact CG-CG1 4.32Å
60	T	85.1	Confident	85.8	Confident	64 Å²	64	98.8 Å²	98.8	39%	0.393	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.3	126	168.7	-47.3	0	0	0	0	109.5	K52 D53	K52-T60 HydrophobicContact CD-CG2 4.22Å; K52-T60 VanDerWaalsContact CE-CG2 3.45Å; K52-T60 HydrophobicContact CG-CG2 3.72Å; D53-T60 WeakPolarHBondContact O-CA 3.35Å
61	I	84.4	Confident	86	Confident	43 Å²	43	99.5 Å²	99.5	22%	0.221	51%	0.508	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.6	113.9	175.4	-58.9	175.4	0	0	0	107.7	D53 R59 R63	D53-I61 HydrophobicContact CB-CB 4.41Å; D53-I61 PolarHBondContact N-O 2.79Å; D53-I61 PolarHBondContact O-N 2.72Å; R59-I61 HydrophobicContact CG-CG1 4.32Å; I61-R63 HydrophobicContact CG2-CG 4.2Å
62	A	84.6	Confident	86.3	Confident	68 Å²	68	105.2 Å²	105.2	56%	0.562	53%	0.528	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103	121.7	172.3	0	0	0	0	0	109.2	N51	N51-A62 CarbonylContact O-C 3.45Å
63	R	84.8	Confident	86.5	Confident	164 Å²	164	100.5 Å²	100.5	62%	0.619	52%	0.522	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.2	119.7	174.3	-65.1	179.1	-177.9	-91.2	1.9	108.4	N51 I61	N51-R63 HydrophobicContact CB-CB 4.39Å; N51-R63 PolarHBondContact N-O 3.36Å; N51-R63 PolarHBondContact O-N 2.84Å; I61-R63 HydrophobicContact CG2-CG 4.2Å
64	Q	85.4	Confident	86.9	Confident	107 Å²	107	101 Å²	101	50%	0.5	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	128.8	173.7	-47.5	-160.4	-34.5	0	0	108.2	L50	L50-Q64 HydrophobicContact CD1-CB 4.4Å; L50-Q64 HydrophobicContact CD1-CG 3.54Å
65	T	88.4	Confident	87.4	Confident	78 Å²	78	100.3 Å²	100.3	48%	0.479	51%	0.511	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.5	119.3	169.1	-44.7	0	0	0	0	107.5	V48 T49	V48-T65 PolarHBondContact N-O 2.89Å; T49-T65 PolarHBondContact N-O 2.76Å; T49-T65 PolarHBondContact O-N 2.88Å; T49-T65 WeakPolarHBondContact OG1-CB 3.31Å; T49-T65 PolarHBondContact OG1-OG1 3.09Å
66	A	90.3	Very high	87.8	Confident	39 Å²	39	98.7 Å²	98.7	32%	0.322	50%	0.503	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	145.5	175	0	0	0	0	0	110.1	E46 P83	E46-A66 CarbonylContact O-C 3.57Å; E46-A66 WeakPolarHBondContact O-CA 3.38Å; E46-A66 WeakPolarHBondContact O-CB 3.37Å; A66-P83 HydrophobicContact CB-CB 3.55Å; A66-P83 HydrophobicContact CB-CG 3.72Å
67	R	90.3	Very high	88.3	Confident	156 Å²	156	94.9 Å²	94.9	59%	0.589	49%	0.489	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.9	128.3	164.8	-76.8	177.7	-177.3	178.1	-1.1	108	L40 C45 E46 V48	L40-R67 HydrophobicContact CD1-CB 3.47Å; L40-R67 VanDerWaalsContact CD1-CB 3.47Å; C45-R67 CarbonylContact C-O 3.59Å; C45-R67 VanDerWaalsContact CA-O 3.32Å; C45-R67 WeakPolarHBondContact CA-O 3.37Å; E46-R67 PolarHBondContact N-O 3.17Å; E46-R67 PolarHBondContact O-N 3.13Å; V48-R67 HydrophobicContact CG2-CB 3.89Å; V48-R67 HydrophobicContact CG2-CG 3.53Å
68	C	91.6	Very high	89.1	Confident	41 Å²	41	90 Å²	90	28%	0.277	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	135.2	-179.2	-71.3	0	0	0	0	110.2	T44 C45 A76	T44-C68 WeakPolarHBondContact O-CA 3.38Å; C45-C68 HydrophobicContact CB-CB 4.16Å; C45-C68 WeakPolarHBondContact CB-SG 3.4Å; C45-C68 WeakPolarHBondContact SG-CB 3.43Å; C45-C68 CovalentContact SG-SG 2.04Å; C45-C68 PolarHBondContact SG-SG 2.95Å; C68-A76 HydrophobicContact CB-CB 3.85Å
69	A	92	Very high	89.7	Confident	29 Å²	29	80.2 Å²	80.2	24%	0.24	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	87.2	169.7	0	0	0	0	0	108.7	L40 G43 T44	L40-A69 HydrophobicContact CB-CB 3.7Å; G43-A69 WeakPolarHBondContact CA-O 3.45Å; G43-A69 PolarHBondContact N-O 2.84Å; T44-A69 PolarHBondContact O-N 2.83Å
70	C	92.6	Very high	90.3	Very high	39 Å²	39	79.7 Å²	79.7	26%	0.264	42%	0.423	S	S	.	.	P	Polyproline II helix	trans	-88.5	150	-177	-60.2	0	0	0	0	113	Q74 I75 C85	C70-Q74 HydrophobicContact CB-CB 3.92Å; C70-I75 VanDerWaalsContact SG-C 3.57Å; C70-C85 WeakPolarHBondContact CA-SG 3.27Å; C70-C85 HydrophobicContact CB-CB 3.8Å; C70-C85 WeakPolarHBondContact CB-SG 3.39Å; C70-C85 VanDerWaalsContact SG-CA 3.56Å; C70-C85 WeakPolarHBondContact SG-CB 3.37Å; C70-C85 CovalentContact SG-SG 2.05Å; C70-C85 PolarHBondContact SG-SG 3.15Å
71	K	91.7	Very high	90.5	Very high	129 Å²	129	79.1 Å²	79.1	56%	0.561	43%	0.425	S	S	*	.	P	Polyproline II helix	trans	-72.6	165	176.9	-64.8	179.8	-179	177.2	0	110.9	G73 Q74	K71-G73 PolarHBondContact O-N 3.04Å; K71-Q74 WeakPolarHBondContact O-CB 3.13Å; K71-Q74 PolarHBondContact O-N 2.87Å
72	K	91.3	Very high	90.8	Very high	220 Å²	220	85.8 Å²	85.8	96%	0.957	45%	0.447	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.1	126.6	175.3	-171	179	-179.1	-179	0	110.1
73	G	91.1	Very high	91.2	Very high	50 Å²	50	83.9 Å²	83.9	52%	0.515	43%	0.429	S	S	.	.	T	Hydrogen-bonded Turn	trans	92.2	-9.7	-176.4	0	0	0	0	0	114.6	K71 A88	K71-G73 PolarHBondContact O-N 3.04Å; G73-A88 WeakPolarHBondContact O-CB 3.36Å; G73-A88 PolarHBondContact O-N 3.11Å; G73-A88 VanDerWaalsContact O-N 3.09Å
74	Q	94.4	Very high	91.6	Very high	80 Å²	80	77.3 Å²	77.3	37%	0.374	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.6	156.6	173.7	-65.6	-178.9	-34.5	0	0	111.5	C70 K71 C85 V86	C70-Q74 HydrophobicContact CB-CB 3.92Å; K71-Q74 WeakPolarHBondContact O-CB 3.13Å; K71-Q74 PolarHBondContact O-N 2.87Å; Q74-C85 HydrophobicContact CB-CB 4.24Å; Q74-V86 CarbonylContact C-O 3.5Å; Q74-V86 WeakPolarHBondContact CA-O 3.05Å; Q74-V86 WeakPolarHBondContact CB-O 3.48Å
75	I	92.6	Very high	92	Very high	73 Å²	73	73.3 Å²	73.3	37%	0.374	39%	0.393	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.9	157.4	174.5	-167.3	165.6	0	0	0	109.7	C70 G77 C85 V86 A88 V91	C70-I75 VanDerWaalsContact SG-C 3.57Å; I75-G77 PolarHBondContact O-N 2.78Å; I75-C85 WeakPolarHBondContact O-CA 3.24Å; I75-V86 HydrophobicContact CG2-CG2 4.12Å; I75-V86 PolarHBondContact N-O 2.05Å; I75-V86 PolarHBondContact O-N 2.68Å; I75-A88 HydrophobicContact CB-CB 4.42Å; I75-A88 HydrophobicContact CG2-CB 4.29Å; I75-V91 HydrophobicContact CG2-CB 4Å; I75-V91 HydrophobicContact CG2-CG2 3.48Å; I75-V91 VanDerWaalsContact CG2-CG2 3.48Å
76	A	93.1	Very high	92.3	Very high	54 Å²	54	70 Å²	70	45%	0.446	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.7	129.9	171.4	0	0	0	0	0	109.9	C68	C68-A76 HydrophobicContact CB-CB 3.85Å
77	G	93.3	Very high	92.5	Very high	15 Å²	15	72.8 Å²	72.8	16%	0.155	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.3	-156.9	175.7	0	0	0	0	0	109.6	I75 P83 A84	I75-G77 PolarHBondContact O-N 2.78Å; G77-P83 WeakPolarHBondContact O-CA 3.04Å; G77-A84 CarbonylContact C-O 3.43Å; G77-A84 PolarHBondContact N-O 3.07Å; G77-A84 PolarHBondContact O-N 3.2Å; G77-A84 VanDerWaalsContact O-O 3.13Å
78	T	92.3	Very high	92.7	Very high	36 Å²	36	66 Å²	66	22%	0.221	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.7	132.8	-176.5	51.9	0	0	0	0	110.6	R82 M99 P101 W117	T78-R82 CarbonylContact C-O 3.49Å; T78-R82 VanDerWaalsContact CA-O 3.28Å; T78-R82 WeakPolarHBondContact CA-O 3.36Å; T78-M99 WeakPolarHBondContact O-CG 3.32Å; T78-P101 WeakPolarHBondContact OG1-CB 3.14Å; T78-W117 HydrophobicContact CG2-CH2 4.29Å; T78-W117 HydrophobicContact CG2-CZ2 4.15Å; T78-W117 WeakPolarHBondContact OG1-CH2 3.49Å; T78-W117 WeakPolarHBondContact OG1-CZ2 3.43Å
79	T	93.6	Very high	92.9	Very high	48 Å²	48	65 Å²	65	29%	0.294	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.4	131	174.9	-58.9	0	0	0	0	108.1	A81 R82 M99 V100	T79-A81 PolarHBondContact O-N 3.36Å; T79-R82 PolarHBondContact N-O 2.95Å; T79-R82 PolarHBondContact O-N 2.94Å; T79-R82 VanDerWaalsContact O-O 3.09Å; T79-M99 PolarHBondContact OG1-O 3.25Å; T79-V100 CarbonylContact C-O 3.58Å; T79-V100 WeakPolarHBondContact CA-O 3.47Å
80	R	92.8	Very high	93	Very high	141 Å²	141	64.9 Å²	64.9	53%	0.532	35%	0.352	S	S	.	.	T	Hydrogen-bonded Turn	trans	48.8	52.3	-179.4	-65.7	177.8	170.9	164.1	-1.7	113.5	R82 V100 E104	R80-R82 PolarHBondContact O-N 3.14Å; R80-R82 VanDerWaalsContact O-N 3.11Å; R80-V100 PolarHBondContact N-O 3.29Å; R80-E104 IonicContact CZ-OE1 2.9Å; R80-E104 IonicContact NE-OE1 2.72Å; R80-E104 PolarHBondContact NE-OE1 2.86Å; R80-E104 IonicContact NH2-OE1 3.88Å; R80-E104 PolarHBondContact NH2-OE1 3Å
81	A	89.6	Confident	92.9	Very high	51 Å²	51	64.7 Å²	64.7	42%	0.421	35%	0.35	S	S	.	.	T	Hydrogen-bonded Turn	trans	56.4	23.5	-179	0	0	0	0	0	115.1	T79 P101 L103	T79-A81 PolarHBondContact O-N 3.36Å; A81-P101 PolarHBondContact N-O 2.88Å; A81-L103 HydrophobicContact CB-CD2 4.48Å; A81-L103 HydrophobicContact CB-CG 4.39Å
82	R	90.5	Very high	92.9	Very high	184 Å²	184	68.6 Å²	68.6	69%	0.694	36%	0.361	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-132.3	152.6	177.3	-70.2	-174.4	178	129.7	-0.7	111.4	T78 T79 R80	T78-R82 CarbonylContact C-O 3.49Å; T78-R82 VanDerWaalsContact CA-O 3.28Å; T78-R82 WeakPolarHBondContact CA-O 3.36Å; T79-R82 PolarHBondContact N-O 2.95Å; T79-R82 PolarHBondContact O-N 2.94Å; T79-R82 VanDerWaalsContact O-O 3.09Å; R80-R82 PolarHBondContact O-N 3.14Å; R80-R82 VanDerWaalsContact O-N 3.11Å
83	P	92.8	Very high	93.1	Very high	27 Å²	27	65.2 Å²	65.2	18%	0.175	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.3	135.3	175.4	30.4	-36.2	0	0	0	110.5	C45 I47 A66 G77	C45-P83 HydrophobicContact CB-CB 3.92Å; C45-P83 HydrophobicContact CB-CG 4.17Å; C45-P83 WeakPolarHBondContact CB-O 3.37Å; I47-P83 HydrophobicContact CD1-CG 4.29Å; I47-P83 HydrophobicContact CG1-CG 3.67Å; A66-P83 HydrophobicContact CB-CB 3.55Å; A66-P83 HydrophobicContact CB-CG 3.72Å; G77-P83 WeakPolarHBondContact O-CA 3.04Å
84	A	93.6	Very high	93.2	Very high	26 Å²	26	69.2 Å²	69.2	22%	0.215	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.4	160.9	-178.5	0	0	0	0	0	111	C45 G77	C45-A84 VanDerWaalsContact SG-C 3.58Å; G77-A84 CarbonylContact C-O 3.43Å; G77-A84 PolarHBondContact N-O 3.07Å; G77-A84 PolarHBondContact O-N 3.2Å; G77-A84 VanDerWaalsContact O-O 3.13Å
85	C	93.9	Very high	93.2	Very high	23 Å²	23	68.4 Å²	68.4	16%	0.155	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.6	119.7	170.5	-68.7	0	0	0	0	110	C70 Q74 I75	C70-C85 WeakPolarHBondContact CA-SG 3.27Å; C70-C85 HydrophobicContact CB-CB 3.8Å; C70-C85 WeakPolarHBondContact CB-SG 3.39Å; C70-C85 VanDerWaalsContact SG-CA 3.56Å; C70-C85 WeakPolarHBondContact SG-CB 3.37Å; C70-C85 CovalentContact SG-SG 2.05Å; C70-C85 PolarHBondContact SG-SG 3.15Å; Q74-C85 HydrophobicContact CB-CB 4.24Å; I75-C85 WeakPolarHBondContact O-CA 3.24Å
86	V	94.9	Very high	93.3	Very high	10 Å²	10	66 Å²	66	6%	0.061	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.9	166	-176.9	-57.6	0	0	0	0	110.3	Q74 I75 A88 V91 M99	Q74-V86 CarbonylContact C-O 3.5Å; Q74-V86 WeakPolarHBondContact CA-O 3.05Å; Q74-V86 WeakPolarHBondContact CB-O 3.48Å; I75-V86 HydrophobicContact CG2-CG2 4.12Å; I75-V86 PolarHBondContact N-O 2.05Å; I75-V86 PolarHBondContact O-N 2.68Å; V86-A88 PolarHBondContact O-N 2.88Å; V86-V91 HydrophobicContact CG2-CG2 4.11Å; V86-M99 HydrophobicContact CB-CB 4.29Å; V86-M99 HydrophobicContact CG1-CB 3.82Å
87	D	95.3	Very high	93.4	Very high	96 Å²	96	65.2 Å²	65.2	51%	0.513	32%	0.319	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.1	128.9	175.6	-171.7	-23.8	0	0	0	110.7	G89 I90	D87-G89 PolarHBondContact O-N 2.75Å; D87-G89 VanDerWaalsContact O-N 3.17Å; D87-G89 PolarHBondContact OD1-N 2.04Å; D87-I90 HydrophobicContact CB-CD1 4.07Å; D87-I90 HydrophobicContact CB-CG1 4.18Å; D87-I90 WeakPolarHBondContact O-CB 3.43Å; D87-I90 PolarHBondContact O-N 3.39Å; D87-I90 VanDerWaalsContact O-N 3.1Å
88	A	94.2	Very high	93.5	Very high	13 Å²	13	69.6 Å²	69.6	11%	0.107	34%	0.336	C	S	.	.	H	α-helix	trans	-58.3	-26.1	175.8	0	0	0	0	0	113.1	G73 I75 V86 I90 V91 R92	G73-A88 WeakPolarHBondContact O-CB 3.36Å; G73-A88 PolarHBondContact O-N 3.11Å; G73-A88 VanDerWaalsContact O-N 3.09Å; I75-A88 HydrophobicContact CB-CB 4.42Å; I75-A88 HydrophobicContact CG2-CB 4.29Å; V86-A88 PolarHBondContact O-N 2.88Å; A88-I90 VanDerWaalsContact C-N 3.33Å; A88-I90 PolarHBondContact O-N 2.63Å; A88-V91 PolarHBondContact O-N 2.84Å; A88-R92 WeakPolarHBondContact O-CB 3.47Å; A88-R92 VanDerWaalsContact O-CG 3.24Å; A88-R92 WeakPolarHBondContact O-CG 3.44Å; A88-R92 PolarHBondContact O-N 2.83Å
89	G	94.8	Very high	93.6	Very high	22 Å²	22	68.3 Å²	68.3	23%	0.227	33%	0.327	C	S	.	.	H	α-helix	trans	-59.2	-40.5	174.2	0	0	0	0	0	113	D87 R92 K93	D87-G89 PolarHBondContact O-N 2.75Å; D87-G89 VanDerWaalsContact O-N 3.17Å; D87-G89 PolarHBondContact OD1-N 2.04Å; G89-R92 PolarHBondContact O-N 2.82Å; G89-K93 WeakPolarHBondContact O-CB 3.28Å; G89-K93 VanDerWaalsContact O-CG 3.29Å; G89-K93 WeakPolarHBondContact O-CG 3.47Å; G89-K93 PolarHBondContact O-N 3.19Å
90	I	94	Very high	93.7	Very high	26 Å²	26	69.7 Å²	69.7	13%	0.133	34%	0.335	C	S	.	.	H	α-helix	trans	-61.8	-48.3	179.8	-63.1	171.1	0	0	0	110	D87 A88 K93 R94 Q95 E98 M99	D87-I90 HydrophobicContact CB-CD1 4.07Å; D87-I90 HydrophobicContact CB-CG1 4.18Å; D87-I90 WeakPolarHBondContact O-CB 3.43Å; D87-I90 PolarHBondContact O-N 3.39Å; D87-I90 VanDerWaalsContact O-N 3.1Å; A88-I90 VanDerWaalsContact C-N 3.33Å; A88-I90 PolarHBondContact O-N 2.63Å; I90-K93 PolarHBondContact O-N 2.93Å; I90-R94 PolarHBondContact O-N 2.9Å; I90-Q95 HydrophobicContact CG2-CB 4.37Å; I90-Q95 WeakPolarHBondContact CG2-O 3.33Å; I90-Q95 PolarHBondContact O-N 2.84Å; I90-E98 HydrophobicContact CD1-CB 4.29Å; I90-E98 HydrophobicContact CG1-CB 4.28Å; I90-E98 HydrophobicContact CG2-CB 4.1Å; I90-M99 HydrophobicContact CG2-CB 4.34Å; I90-M99 HydrophobicContact CG2-CG 4.48Å
91	V	91.8	Very high	93.8	Very high	35 Å²	35	63.1 Å²	63.1	21%	0.212	31%	0.311	C	S	.	.	H	α-helix	trans	-67.3	-42.9	179.8	177.4	0	0	0	0	111.2	I75 V86 A88 K93 R94 W96	I75-V91 HydrophobicContact CG2-CB 4Å; I75-V91 HydrophobicContact CG2-CG2 3.48Å; I75-V91 VanDerWaalsContact CG2-CG2 3.48Å; V86-V91 HydrophobicContact CG2-CG2 4.11Å; A88-V91 PolarHBondContact O-N 2.84Å; V91-K93 PolarHBondContact O-N 2.8Å; V91-R94 PolarHBondContact O-N 2.8Å; V91-R94 VanDerWaalsContact O-N 3.09Å; V91-W96 HydrophobicContact CB-CZ3 4.19Å; V91-W96 HydrophobicContact CG1-CH2 3.89Å; V91-W96 HydrophobicContact CG1-CZ3 3.82Å; V91-W96 HydrophobicContact CG2-CZ3 4.06Å
92	R	92.1	Very high	94	Very high	211 Å²	211	61 Å²	61	80%	0.796	29%	0.292	S	S	*	.	H	α-helix	trans	-63.3	-40.3	178.1	-76.1	174.7	-177.8	171.3	1.3	112.7	A88 G89 R94	A88-R92 WeakPolarHBondContact O-CB 3.47Å; A88-R92 VanDerWaalsContact O-CG 3.24Å; A88-R92 WeakPolarHBondContact O-CG 3.44Å; A88-R92 PolarHBondContact O-N 2.83Å; G89-R92 PolarHBondContact O-N 2.82Å; R92-R94 PolarHBondContact O-N 3.48Å
93	K	94.3	Very high	94.2	Very high	149 Å²	149	55.9 Å²	55.9	65%	0.648	28%	0.279	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.8	-4.3	176.5	-65.2	174.8	-177.9	176.7	0	112.8	G89 I90 V91 Q95	G89-K93 WeakPolarHBondContact O-CB 3.28Å; G89-K93 VanDerWaalsContact O-CG 3.29Å; G89-K93 WeakPolarHBondContact O-CG 3.47Å; G89-K93 PolarHBondContact O-N 3.19Å; I90-K93 PolarHBondContact O-N 2.93Å; V91-K93 PolarHBondContact O-N 2.8Å; K93-Q95 HydrophobicContact CB-CG 3.78Å; K93-Q95 PolarHBondContact O-N 3.19Å
94	R	93.6	Very high	94.1	Very high	134 Å²	134	61 Å²	61	51%	0.506	30%	0.3	S	S	.	.	T	Hydrogen-bonded Turn	trans	56.9	33.8	-176.4	-51.9	179.1	-175.6	-178.6	0	112.6	I90 V91 R92 W96 K114	I90-R94 PolarHBondContact O-N 2.9Å; V91-R94 PolarHBondContact O-N 2.8Å; V91-R94 VanDerWaalsContact O-N 3.09Å; R92-R94 PolarHBondContact O-N 3.48Å; R94-W96 HydrophobicContact CB-CZ2 4.2Å; R94-W96 HydrophobicContact CG-CZ2 4.23Å; R94-W96 PolarHBondContact O-N 2.82Å; R94-W96 VanDerWaalsContact O-N 3.16Å; R94-K114 HydrophobicContact CB-CB 4.13Å
95	Q	94.4	Very high	94	Very high	63 Å²	63	66.3 Å²	66.3	29%	0.294	33%	0.325	S	S	.	.			trans	-89.4	56.8	-179.4	-67.2	179.5	-71.1	0	0	110.2	I90 K93 C97 E98	I90-Q95 HydrophobicContact CG2-CB 4.37Å; I90-Q95 WeakPolarHBondContact CG2-O 3.33Å; I90-Q95 PolarHBondContact O-N 2.84Å; K93-Q95 HydrophobicContact CB-CG 3.78Å; K93-Q95 PolarHBondContact O-N 3.19Å; Q95-C97 PolarHBondContact O-N 3.15Å; Q95-E98 HydrophobicContact CB-CB 4.37Å; Q95-E98 HydrophobicContact CB-CG 3.93Å; Q95-E98 PolarHBondContact NE2-OE1 2.92Å; Q95-E98 WeakPolarHBondContact O-CB 3.42Å; Q95-E98 PolarHBondContact O-N 3.49Å; Q95-E98 PolarHBondContact OE1-OE2 2.9Å
96	W	94.5	Very high	94.1	Very high	22 Å²	22	66.1 Å²	66.1	8%	0.083	32%	0.322	C	S	.	.	G	3₁₀ helix	trans	-57.7	-26.8	-166.1	-50.4	113.1	0	0	0	115.3	V91 R94 E98 M99 P101 L110 K114 G116 W117 A131	V91-W96 HydrophobicContact CB-CZ3 4.19Å; V91-W96 HydrophobicContact CG1-CH2 3.89Å; V91-W96 HydrophobicContact CG1-CZ3 3.82Å; V91-W96 HydrophobicContact CG2-CZ3 4.06Å; R94-W96 HydrophobicContact CB-CZ2 4.2Å; R94-W96 HydrophobicContact CG-CZ2 4.23Å; R94-W96 PolarHBondContact O-N 2.82Å; R94-W96 VanDerWaalsContact O-N 3.16Å; W96-E98 VanDerWaalsContact C-N 3.32Å; W96-M99 HydrophobicContact CB-CE 3.75Å; W96-M99 HydrophobicContact CD2-CE 4.35Å; W96-M99 HydrophobicContact CE3-CE 3.67Å; W96-M99 HydrophobicContact CG-CE 4.43Å; W96-M99 WeakPolarHBondContact O-CE 3.06Å; W96-M99 WeakPolarHBondContact O-CG 3.44Å; W96-P101 WeakPolarHBondContact O-CD 3.16Å; W96-L110 HydrophobicContact CB-CD2 3.64Å; W96-L110 HydrophobicContact CG-CD2 4.09Å; W96-K114 PolarHBondContact NE1-O 2.8Å; W96-G116 VanDerWaalsContact CD1-C 3.49Å; W96-W117 HydrophobicContact CB-CB 4.02Å; W96-W117 HydrophobicContact CB-CD2 4.18Å; W96-W117 HydrophobicContact CB-CE3 3.65Å; W96-W117 HydrophobicContact CB-CG 4.36Å; W96-W117 HydrophobicContact CB-CZ3 4.47Å; W96-W117 HydrophobicContact CD2-CE3 4.11Å; W96-W117 HydrophobicContact CD2-CZ3 4.28Å; W96-W117 HydrophobicContact CE3-CE3 4.32Å; W96-W117 HydrophobicContact CE3-CZ3 4.07Å; W96-W117 AromaticContact CG-CE3 3.84Å; W96-W117 HydrophobicContact CG-CE3 3.84Å; W96-W117 HydrophobicContact CG-CZ3 4.47Å; W96-A131 HydrophobicContact CH2-CB 3.45Å; W96-A131 VanDerWaalsContact CH2-CB 3.45Å; W96-A131 HydrophobicContact CZ2-CB 3.75Å; W96-A131 HydrophobicContact CZ3-CB 3.96Å
97	C	95.2	Very high	94.1	Very high	38 Å²	38	67.5 Å²	67.5	26%	0.257	34%	0.338	S	S	.	.	G	3₁₀ helix	trans	-76.7	-17.3	177.2	-67.4	0	0	0	0	113.7	Q95 M99 V100 C108 L110	Q95-C97 PolarHBondContact O-N 3.15Å; C97-M99 VanDerWaalsContact C-N 3.26Å; C97-M99 PolarHBondContact O-N 3.49Å; C97-V100 PolarHBondContact O-N 3.35Å; C97-V100 VanDerWaalsContact O-N 3.09Å; C97-C108 WeakPolarHBondContact CA-SG 3.28Å; C97-C108 HydrophobicContact CB-CB 3.87Å; C97-C108 WeakPolarHBondContact CB-SG 3.04Å; C97-C108 WeakPolarHBondContact SG-CB 3.02Å; C97-C108 PolarHBondContact SG-O 2.93Å; C97-C108 CovalentContact SG-SG 2.06Å; C97-C108 PolarHBondContact SG-SG 3.23Å; C97-L110 HydrophobicContact CB-CD2 4.41Å
98	E	95	Very high	94.1	Very high	107 Å²	107	64.7 Å²	64.7	50%	0.5	33%	0.326	S	S	.	.	G	3₁₀ helix	trans	-69.7	-22.5	176.8	-67.6	-176	-176.8	0	0	112.9	I90 Q95 W96 V100	I90-E98 HydrophobicContact CD1-CB 4.29Å; I90-E98 HydrophobicContact CG1-CB 4.28Å; I90-E98 HydrophobicContact CG2-CB 4.1Å; Q95-E98 HydrophobicContact CB-CB 4.37Å; Q95-E98 HydrophobicContact CB-CG 3.93Å; Q95-E98 PolarHBondContact NE2-OE1 2.92Å; Q95-E98 WeakPolarHBondContact O-CB 3.42Å; Q95-E98 PolarHBondContact O-N 3.49Å; Q95-E98 PolarHBondContact OE1-OE2 2.9Å; W96-E98 VanDerWaalsContact C-N 3.32Å; E98-V100 PolarHBondContact O-N 3.12Å
99	M	94.3	Very high	94.2	Very high	9 Å²	9	68.6 Å²	68.6	4%	0.044	34%	0.344	C	S	.	.	G	3₁₀ helix	trans	-78.7	-0.5	172.1	53.6	172.9	171.1	0	0	113.9	T78 T79 V86 I90 W96 C97 P101 W117	T78-M99 WeakPolarHBondContact O-CG 3.32Å; T79-M99 PolarHBondContact OG1-O 3.25Å; V86-M99 HydrophobicContact CB-CB 4.29Å; V86-M99 HydrophobicContact CG1-CB 3.82Å; I90-M99 HydrophobicContact CG2-CB 4.34Å; I90-M99 HydrophobicContact CG2-CG 4.48Å; W96-M99 HydrophobicContact CB-CE 3.75Å; W96-M99 HydrophobicContact CD2-CE 4.35Å; W96-M99 HydrophobicContact CE3-CE 3.67Å; W96-M99 HydrophobicContact CG-CE 4.43Å; W96-M99 WeakPolarHBondContact O-CE 3.06Å; W96-M99 WeakPolarHBondContact O-CG 3.44Å; C97-M99 VanDerWaalsContact C-N 3.26Å; C97-M99 PolarHBondContact O-N 3.49Å; M99-P101 HydrophobicContact CE-CB 4.19Å; M99-P101 HydrophobicContact CE-CG 4.42Å; M99-P101 HydrophobicContact CG-CB 4.37Å; M99-W117 HydrophobicContact CE-CD2 4.09Å; M99-W117 HydrophobicContact CE-CE3 3.68Å; M99-W117 HydrophobicContact CE-CH2 3.66Å; M99-W117 HydrophobicContact CE-CZ2 4.06Å; M99-W117 HydrophobicContact CE-CZ3 3.47Å; M99-W117 VanDerWaalsContact CE-CZ3 3.47Å
100	V	95.9	Very high	94.3	Very high	77 Å²	77	71.2 Å²	71.2	47%	0.467	35%	0.353	S	S	.	.			trans	52.8	61.8	-177.7	-165.4	0	0	0	0	111.3	T79 R80 C97 E98 C102	T79-V100 CarbonylContact C-O 3.58Å; T79-V100 WeakPolarHBondContact CA-O 3.47Å; R80-V100 PolarHBondContact N-O 3.29Å; C97-V100 PolarHBondContact O-N 3.35Å; C97-V100 VanDerWaalsContact O-N 3.09Å; E98-V100 PolarHBondContact O-N 3.12Å; V100-C102 VanDerWaalsContact C-N 3.35Å; V100-C102 PolarHBondContact O-N 2.96Å
101	P	94.7	Very high	94.3	Very high	3 Å²	3	71.7 Å²	71.7	2%	0.019	36%	0.355	C	S	.	.			trans	-78	-20.9	-170.4	33.1	-36.4	0	0	0	113.2	T78 A81 W96 M99 W117	T78-P101 WeakPolarHBondContact OG1-CB 3.14Å; A81-P101 PolarHBondContact N-O 2.88Å; W96-P101 WeakPolarHBondContact O-CD 3.16Å; M99-P101 HydrophobicContact CE-CB 4.19Å; M99-P101 HydrophobicContact CE-CG 4.42Å; M99-P101 HydrophobicContact CG-CB 4.37Å; P101-W117 HydrophobicContact CB-CD2 4.37Å; P101-W117 HydrophobicContact CB-CG 4.49Å; P101-W117 HydrophobicContact CB-CZ2 4.07Å; P101-W117 HydrophobicContact CG-CD2 4.25Å; P101-W117 HydrophobicContact CG-CG 3.95Å
102	C	95.3	Very high	94.4	Very high	5 Å²	5	77.5 Å²	77.5	3%	0.034	39%	0.391	C	S	.	.	S	Bend	trans	-88.6	167.4	-179.2	-52.3	0	0	0	0	111.9	V100 E106 C119	V100-C102 VanDerWaalsContact C-N 3.35Å; V100-C102 PolarHBondContact O-N 2.96Å; C102-E106 HydrophobicContact CB-CB 3.74Å; C102-C119 WeakPolarHBondContact CA-SG 3.09Å; C102-C119 HydrophobicContact CB-CB 3.75Å; C102-C119 WeakPolarHBondContact CB-SG 3.47Å; C102-C119 WeakPolarHBondContact SG-CA 3.48Å; C102-C119 WeakPolarHBondContact SG-CB 3.47Å; C102-C119 CovalentContact SG-SG 2.04Å; C102-C119 PolarHBondContact SG-SG 3.37Å
103	L	94.1	Very high	94.5	Very high	78 Å²	78	72.2 Å²	72.2	41%	0.408	38%	0.378	S	S	.	.			trans	-72.5	164	169.9	-67.2	167.1	0	0	0	110.5	A81 D105 E106	A81-L103 HydrophobicContact CB-CD2 4.48Å; A81-L103 HydrophobicContact CB-CG 4.39Å; L103-D105 PolarHBondContact O-N 2.86Å; L103-E106 HydrophobicContact CB-CG 4.18Å; L103-E106 PolarHBondContact N-OE2 3.44Å; L103-E106 PolarHBondContact O-N 3.5Å
104	E	91.3	Very high	94.4	Very high	134 Å²	134	70.8 Å²	70.8	63%	0.626	37%	0.372	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.2	-31.1	-177.6	-57.1	-70.4	146.9	0	0	112.6	R80 E106	R80-E104 IonicContact CZ-OE1 2.9Å; R80-E104 IonicContact NE-OE1 2.72Å; R80-E104 PolarHBondContact NE-OE1 2.86Å; R80-E104 IonicContact NH2-OE1 3.88Å; R80-E104 PolarHBondContact NH2-OE1 3Å; E104-E106 VanDerWaalsContact C-N 3.34Å
105	D	91.4	Very high	94.4	Very high	137 Å²	137	65.9 Å²	65.9	73%	0.733	36%	0.358	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.4	2	178.6	-53.9	-57	0	0	0	113.7	L103 P122	L103-D105 PolarHBondContact O-N 2.86Å; D105-P122 WeakPolarHBondContact O-CD 3.41Å
106	E	95.1	Very high	94.4	Very high	20 Å²	20	62.9 Å²	62.9	9%	0.093	34%	0.344	C	S	.	.	S	Bend	trans	-110.3	133.9	-176	-71	179.3	168.1	0	0	111.2	C102 L103 E104 C119 T120 Q121 K127	C102-E106 HydrophobicContact CB-CB 3.74Å; L103-E106 HydrophobicContact CB-CG 4.18Å; L103-E106 PolarHBondContact N-OE2 3.44Å; L103-E106 PolarHBondContact O-N 3.5Å; E104-E106 VanDerWaalsContact C-N 3.34Å; E106-C119 HydrophobicContact CB-CB 4.32Å; E106-C119 WeakPolarHBondContact OE2-CB 3.33Å; E106-T120 WeakPolarHBondContact CA-O 3.23Å; E106-Q121 HydrophobicContact CG-CG 3.84Å; E106-Q121 WeakPolarHBondContact OE1-CG 3.3Å; E106-Q121 PolarHBondContact OE1-NE2 3.37Å; E106-K127 IonicContact OE1-NZ 2.76Å; E106-K127 PolarHBondContact OE1-NZ 2.92Å; E106-K127 IonicContact OE2-NZ 3.22Å
107	G	95	Very high	94.5	Very high	38 Å²	38	62.6 Å²	62.6	39%	0.392	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.6	135.7	171.4	0	0	0	0	0	111.4	C119 T120	G107-C119 CarbonylContact O-C 3.58Å; G107-C119 VanDerWaalsContact O-CA 3.31Å; G107-C119 WeakPolarHBondContact O-CA 3.34Å; G107-T120 PolarHBondContact N-O 3.42Å; G107-T120 PolarHBondContact O-N 2.86Å
108	C	96	Very high	94.5	Very high	38 Å²	38	62 Å²	62	26%	0.257	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	124.6	174.7	-173.1	0	0	0	0	111.4	C97 T118	C97-C108 WeakPolarHBondContact CA-SG 3.28Å; C97-C108 HydrophobicContact CB-CB 3.87Å; C97-C108 WeakPolarHBondContact CB-SG 3.04Å; C97-C108 WeakPolarHBondContact SG-CB 3.02Å; C97-C108 PolarHBondContact SG-O 2.93Å; C97-C108 CovalentContact SG-SG 2.06Å; C97-C108 PolarHBondContact SG-SG 3.23Å; C108-T118 WeakPolarHBondContact CA-O 3.28Å
109	D	95.9	Very high	94.5	Very high	94 Å²	94	57.2 Å²	57.2	50%	0.503	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.4	146.6	173.6	-65.2	-65	0	0	0	111	W117 T118	D109-W117 CarbonylContact O-C 3.56Å; D109-W117 WeakPolarHBondContact O-CA 3.34Å; D109-W117 WeakPolarHBondContact O-CB 3.38Å; D109-T118 PolarHBondContact N-O 2.87Å; D109-T118 PolarHBondContact O-N 3.42Å; D109-T118 PolarHBondContact O-OG1 3.44Å
110	L	95.5	Very high	94.6	Very high	78 Å²	78	59.1 Å²	59.1	41%	0.408	33%	0.329	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.3	143.1	174.8	-57.8	177.2	0	0	0	110.3	W96 C97	W96-L110 HydrophobicContact CB-CD2 3.64Å; W96-L110 HydrophobicContact CG-CD2 4.09Å; C97-L110 HydrophobicContact CB-CD2 4.41Å
111	L	95.5	Very high	94.4	Very high	35 Å²	35	58 Å²	58	18%	0.183	32%	0.319	C	S	.	.			trans	-62.9	147.9	168.6	-90.9	69.1	0	0	0	109.9	N113 K114 G116 W117 T118 T128	L111-N113 WeakPolarHBondContact CB-OD1 3.26Å; L111-N113 PolarHBondContact O-N 2.88Å; L111-N113 VanDerWaalsContact O-N 3.15Å; L111-K114 WeakPolarHBondContact O-CA 3.34Å; L111-K114 PolarHBondContact O-N 3Å; L111-G116 PolarHBondContact N-O 2.92Å; L111-W117 WeakPolarHBondContact CD1-O 3.25Å; L111-T118 HydrophobicContact CD1-CG2 3.83Å; L111-T128 HydrophobicContact CD1-CG2 4.09Å; L111-T128 HydrophobicContact CD2-CG2 4.26Å
112	V	93.3	Very high	94.1	Very high	157 Å²	157	63.6 Å²	63.6	95%	0.952	36%	0.355	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.1	-38.5	-178.7	-178.8	0	0	0	0	112.5	K114	V112-K114 VanDerWaalsContact C-N 3.27Å; V112-K114 PolarHBondContact O-N 3.4Å
113	N	94.3	Very high	93.6	Very high	101 Å²	101	67.1 Å²	67.1	54%	0.54	39%	0.392	S	S	.	.	T	Hydrogen-bonded Turn	trans	-83.9	3.1	178.3	67.3	-5.9	0	0	0	113.8	L111 S115	L111-N113 WeakPolarHBondContact CB-OD1 3.26Å; L111-N113 PolarHBondContact O-N 2.88Å; L111-N113 VanDerWaalsContact O-N 3.15Å; N113-S115 VanDerWaalsContact CG-OG 3.22Å; N113-S115 WeakPolarHBondContact ND2-CB 3.27Å; N113-S115 PolarHBondContact ND2-OG 3.49Å; N113-S115 PolarHBondContact O-N 3.32Å; N113-S115 VanDerWaalsContact O-N 3.13Å; N113-S115 VanDerWaalsContact OD1-CB 3.31Å; N113-S115 WeakPolarHBondContact OD1-CB 3.39Å; N113-S115 PolarHBondContact OD1-N 2.98Å; N113-S115 PolarHBondContact OD1-OG 3.38Å
114	K	91.9	Very high	93.2	Very high	119 Å²	119	66.2 Å²	66.2	52%	0.517	40%	0.402	S	S	.	.	S	Bend	trans	55.3	22.1	-172.9	-53.6	-179.6	179.8	-179.1	0	113.9	R94 W96 L111 V112 G116	R94-K114 HydrophobicContact CB-CB 4.13Å; W96-K114 PolarHBondContact NE1-O 2.8Å; L111-K114 WeakPolarHBondContact O-CA 3.34Å; L111-K114 PolarHBondContact O-N 3Å; V112-K114 VanDerWaalsContact C-N 3.27Å; V112-K114 PolarHBondContact O-N 3.4Å; K114-G116 PolarHBondContact O-N 2.93Å
115	S	94.1	Very high	93.1	Very high	30 Å²	30	67.1 Å²	67.1	21%	0.21	40%	0.399	C	S	.	.	S	Bend	trans	-83.2	2.2	177.8	76.6	0	0	0	0	113	N113 T130 A131	N113-S115 VanDerWaalsContact CG-OG 3.22Å; N113-S115 WeakPolarHBondContact ND2-CB 3.27Å; N113-S115 PolarHBondContact ND2-OG 3.49Å; N113-S115 PolarHBondContact O-N 3.32Å; N113-S115 VanDerWaalsContact O-N 3.13Å; N113-S115 VanDerWaalsContact OD1-CB 3.31Å; N113-S115 WeakPolarHBondContact OD1-CB 3.39Å; N113-S115 PolarHBondContact OD1-N 2.98Å; N113-S115 PolarHBondContact OD1-OG 3.38Å; S115-T130 WeakPolarHBondContact O-CG2 3.33Å; S115-A131 PolarHBondContact O-N 2.95Å
116	G	94.6	Very high	93.2	Very high	0 Å²	0	64.4 Å²	64.4	0%	0	39%	0.387	C	S	.	.	E	Extended strand (participates in β ladder)	trans	170.2	-159.1	-178.4	0	0	0	0	0	112.6	W96 L111 K114 T129	W96-G116 VanDerWaalsContact CD1-C 3.49Å; L111-G116 PolarHBondContact N-O 2.92Å; K114-G116 PolarHBondContact O-N 2.93Å; G116-T129 CarbonylContact C-O 3.41Å; G116-T129 VanDerWaalsContact CA-O 3.27Å; G116-T129 WeakPolarHBondContact CA-O 3.47Å
117	W	95.6	Very high	93	Very high	17 Å²	17	67 Å²	67	6%	0.064	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.6	165.7	-179.2	64.2	98	0	0	0	112.3	T78 W96 M99 P101 D109 L111 T129	T78-W117 HydrophobicContact CG2-CH2 4.29Å; T78-W117 HydrophobicContact CG2-CZ2 4.15Å; T78-W117 WeakPolarHBondContact OG1-CH2 3.49Å; T78-W117 WeakPolarHBondContact OG1-CZ2 3.43Å; W96-W117 HydrophobicContact CB-CB 4.02Å; W96-W117 HydrophobicContact CB-CD2 4.18Å; W96-W117 HydrophobicContact CB-CE3 3.65Å; W96-W117 HydrophobicContact CB-CG 4.36Å; W96-W117 HydrophobicContact CB-CZ3 4.47Å; W96-W117 HydrophobicContact CD2-CE3 4.11Å; W96-W117 HydrophobicContact CD2-CZ3 4.28Å; W96-W117 HydrophobicContact CE3-CE3 4.32Å; W96-W117 HydrophobicContact CE3-CZ3 4.07Å; W96-W117 AromaticContact CG-CE3 3.84Å; W96-W117 HydrophobicContact CG-CE3 3.84Å; W96-W117 HydrophobicContact CG-CZ3 4.47Å; M99-W117 HydrophobicContact CE-CD2 4.09Å; M99-W117 HydrophobicContact CE-CE3 3.68Å; M99-W117 HydrophobicContact CE-CH2 3.66Å; M99-W117 HydrophobicContact CE-CZ2 4.06Å; M99-W117 HydrophobicContact CE-CZ3 3.47Å; M99-W117 VanDerWaalsContact CE-CZ3 3.47Å; P101-W117 HydrophobicContact CB-CD2 4.37Å; P101-W117 HydrophobicContact CB-CG 4.49Å; P101-W117 HydrophobicContact CB-CZ2 4.07Å; P101-W117 HydrophobicContact CG-CD2 4.25Å; P101-W117 HydrophobicContact CG-CG 3.95Å; D109-W117 CarbonylContact O-C 3.56Å; D109-W117 WeakPolarHBondContact O-CA 3.34Å; D109-W117 WeakPolarHBondContact O-CB 3.38Å; L111-W117 WeakPolarHBondContact CD1-O 3.25Å; W117-T129 HydrophobicContact CD2-CG2 4.42Å; W117-T129 VanDerWaalsContact CE2-CB 3.48Å; W117-T129 HydrophobicContact CH2-CG2 3.42Å; W117-T129 VanDerWaalsContact CH2-CG2 3.42Å; W117-T129 HydrophobicContact CZ2-CG2 3.26Å; W117-T129 HydrophobicContact CZ3-CG2 4.05Å; W117-T129 PolarHBondContact N-O 2.92Å; W117-T129 PolarHBondContact O-N 2.76Å; W117-T129 VanDerWaalsContact O-O 3.1Å
118	T	95.8	Very high	92.9	Very high	25 Å²	25	69.1 Å²	69.1	15%	0.153	40%	0.404	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121	140.2	169.3	48.7	0	0	0	0	110.4	C108 D109 L111 V126 K127 T128	C108-T118 WeakPolarHBondContact CA-O 3.28Å; D109-T118 PolarHBondContact N-O 2.87Å; D109-T118 PolarHBondContact O-N 3.42Å; D109-T118 PolarHBondContact O-OG1 3.44Å; L111-T118 HydrophobicContact CD1-CG2 3.83Å; T118-V126 HydrophobicContact CG2-CG1 3.93Å; T118-K127 CarbonylContact C-O 3.47Å; T118-K127 WeakPolarHBondContact CA-O 3.41Å; T118-T128 HydrophobicContact CG2-CG2 4.11Å
119	C	95.8	Very high	92.7	Very high	7 Å²	7	70 Å²	70	5%	0.047	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	116.6	168.2	-59.5	0	0	0	0	108.9	C102 E106 G107 K127	C102-C119 WeakPolarHBondContact CA-SG 3.09Å; C102-C119 HydrophobicContact CB-CB 3.75Å; C102-C119 WeakPolarHBondContact CB-SG 3.47Å; C102-C119 WeakPolarHBondContact SG-CA 3.48Å; C102-C119 WeakPolarHBondContact SG-CB 3.47Å; C102-C119 CovalentContact SG-SG 2.04Å; C102-C119 PolarHBondContact SG-SG 3.37Å; E106-C119 HydrophobicContact CB-CB 4.32Å; E106-C119 WeakPolarHBondContact OE2-CB 3.33Å; G107-C119 CarbonylContact O-C 3.58Å; G107-C119 VanDerWaalsContact O-CA 3.31Å; G107-C119 WeakPolarHBondContact O-CA 3.34Å; C119-K127 HydrophobicContact CB-CB 4.31Å; C119-K127 PolarHBondContact N-O 3.36Å; C119-K127 PolarHBondContact O-N 3.03Å
120	T	94.9	Very high	92.5	Very high	49 Å²	49	69.2 Å²	69.2	30%	0.301	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	116.8	-176.8	-52.7	0	0	0	0	109.1	E106 G107 V126	E106-T120 WeakPolarHBondContact CA-O 3.23Å; G107-T120 PolarHBondContact N-O 3.42Å; G107-T120 PolarHBondContact O-N 2.86Å; T120-V126 HydrophobicContact CG2-CG2 4.33Å
121	Q	93.3	Very high	91.9	Very high	54 Å²	54	67.1 Å²	67.1	25%	0.252	40%	0.401	S	S	.	.			trans	-80.2	150.1	175.7	-68.1	-172.1	-28.9	0	0	110.9	E106 G123 G124 R125	E106-Q121 HydrophobicContact CG-CG 3.84Å; E106-Q121 WeakPolarHBondContact OE1-CG 3.3Å; E106-Q121 PolarHBondContact OE1-NE2 3.37Å; Q121-G123 PolarHBondContact O-N 2.87Å; Q121-G124 PolarHBondContact O-N 2.68Å; Q121-R125 HydrophobicContact CB-CB 4.25Å; Q121-R125 WeakPolarHBondContact CB-O 3.47Å; Q121-R125 PolarHBondContact N-O 3.38Å
122	P	88.3	Confident	90.7	Very high	119 Å²	119	76.7 Å²	76.7	77%	0.773	45%	0.451	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.3	-21.2	178.5	19.2	-29.8	0	0	0	113.2	D105 G124	D105-P122 WeakPolarHBondContact O-CD 3.41Å; P122-G124 VanDerWaalsContact C-N 3.28Å; P122-G124 PolarHBondContact O-N 3.08Å
123	G	84.6	Confident	90.5	Very high	79 Å²	79	72.7 Å²	72.7	81%	0.814	43%	0.426	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.1	15.5	172.1	0	0	0	0	0	115.6	Q121 R125	Q121-G123 PolarHBondContact O-N 2.87Å; G123-R125 PolarHBondContact O-N 2.71Å
124	G	86.1	Confident	90.4	Very high	60 Å²	60	71.2 Å²	71.2	62%	0.619	42%	0.42	S	S	*	.	S	Bend	trans	76.9	0.4	178.2	0	0	0	0	0	115.3	Q121 P122 V126	Q121-G124 PolarHBondContact O-N 2.68Å; P122-G124 VanDerWaalsContact C-N 3.28Å; P122-G124 PolarHBondContact O-N 3.08Å; G124-V126 PolarHBondContact O-N 3.11Å
125	R	88.7	Confident	90.3	Very high	152 Å²	152	68.5 Å²	68.5	57%	0.574	41%	0.414	S	S	*	.			trans	-77.5	124	176.5	-171.3	179.4	-173	174.1	5.5	110.1	Q121 G123	Q121-R125 HydrophobicContact CB-CB 4.25Å; Q121-R125 WeakPolarHBondContact CB-O 3.47Å; Q121-R125 PolarHBondContact N-O 3.38Å; G123-R125 PolarHBondContact O-N 2.71Å
126	V	92.4	Very high	90	Very high	80 Å²	80	70.8 Å²	70.8	49%	0.485	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.2	128.3	178.1	-172.1	0	0	0	0	110.2	T118 T120 G124	T118-V126 HydrophobicContact CG2-CG1 3.93Å; T120-V126 HydrophobicContact CG2-CG2 4.33Å; G124-V126 PolarHBondContact O-N 3.11Å
127	K	92	Very high	89.8	Confident	76 Å²	76	75.2 Å²	75.2	33%	0.33	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	120.5	169.9	-64	171.7	-174.9	162	0	108.4	E106 T118 C119	E106-K127 IonicContact OE1-NZ 2.76Å; E106-K127 PolarHBondContact OE1-NZ 2.92Å; E106-K127 IonicContact OE2-NZ 3.22Å; T118-K127 CarbonylContact C-O 3.47Å; T118-K127 WeakPolarHBondContact CA-O 3.41Å; C119-K127 HydrophobicContact CB-CB 4.31Å; C119-K127 PolarHBondContact N-O 3.36Å; C119-K127 PolarHBondContact O-N 3.03Å
128	T	92	Very high	89.4	Confident	81 Å²	81	79.1 Å²	79.1	50%	0.497	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	129.1	177.5	-52.6	0	0	0	0	110.2	L111 T118	L111-T128 HydrophobicContact CD1-CG2 4.09Å; L111-T128 HydrophobicContact CD2-CG2 4.26Å; T118-T128 HydrophobicContact CG2-CG2 4.11Å
129	T	91.9	Very high	88.9	Confident	56 Å²	56	82.9 Å²	82.9	34%	0.344	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.9	127.7	173.9	-54.5	0	0	0	0	109.7	G116 W117	G116-T129 CarbonylContact C-O 3.41Å; G116-T129 VanDerWaalsContact CA-O 3.27Å; G116-T129 WeakPolarHBondContact CA-O 3.47Å; W117-T129 HydrophobicContact CD2-CG2 4.42Å; W117-T129 VanDerWaalsContact CE2-CB 3.48Å; W117-T129 HydrophobicContact CH2-CG2 3.42Å; W117-T129 VanDerWaalsContact CH2-CG2 3.42Å; W117-T129 HydrophobicContact CZ2-CG2 3.26Å; W117-T129 HydrophobicContact CZ3-CG2 4.05Å; W117-T129 PolarHBondContact N-O 2.92Å; W117-T129 PolarHBondContact O-N 2.76Å; W117-T129 VanDerWaalsContact O-O 3.1Å
130	T	91.5	Very high	88.4	Confident	79 Å²	79	88.8 Å²	88.8	49%	0.485	54%	0.537	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	130.7	178	-44.5	0	0	0	0	108.5	S115	S115-T130 WeakPolarHBondContact O-CG2 3.33Å
131	A	83.9	Confident	87.8	Confident	33 Å²	33	92.1 Å²	92.1	27%	0.273	56%	0.557	S	S	.	*			trans	-82.5	127.5	166.1	0	0	0	0	0	108.3	W96 S115	W96-A131 HydrophobicContact CH2-CB 3.45Å; W96-A131 VanDerWaalsContact CH2-CB 3.45Å; W96-A131 HydrophobicContact CZ2-CB 3.75Å; W96-A131 HydrophobicContact CZ3-CB 3.96Å; S115-A131 PolarHBondContact O-N 2.95Å
132	L	69.3	Low	87.3	Confident	236 Å²	236	95.5 Å²	95.5	100%	1.236	58%	0.584	S	S	*	*			trans	-84.4	0	175	-68.2	172.1	0	0	0	110.8

Retrieved 132 of 132 residues in 157.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).