M4APW3_XIPMA Loading...

Nuclear envelope phosphatase-regulatory subunit 1

AlphaFold DB , UniProt , Accession M4APW3, Species XIPMA (Xiphophorus maculatus, Southern platyfish), Gene n/a, Length 125 aa.

						>M4APW3_XIPMA|M4APW3
MNSLEQAEDLKAFERRLTEYISCLQPATGRWRMILIVVSVCTATGAWNWLIDPDTQKVSFLSSLWNHPFFTISCITLIALFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPNIQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.8	Low	81	Confident	188 Å²	188	110.5 Å²	110.5	93%	0.926	58%	0.575	S	S	*	*				0	116.1	0	-146.1	123.3	134.6	0	0	107	Q6	M1-Q6 HydrophobicContact CG-CG 4.3Å
2	N	77.7	Confident	81.8	Confident	98 Å²	98	105.2 Å²	105.2	52%	0.524	56%	0.559	S	S	.	*			trans	-77	138.4	-174.1	-153.6	-13.6	0	0	0	109	L4 E5 Q6	N2-L4 PolarHBondContact O-N 3.16Å; N2-E5 HydrophobicContact CB-CB 4.31Å; N2-E5 VanDerWaalsContact O-CB 3.27Å; N2-E5 WeakPolarHBondContact O-CB 3.32Å; N2-E5 PolarHBondContact O-N 3.08Å; N2-Q6 PolarHBondContact O-N 3Å
3	S	77.2	Confident	82.3	Confident	85 Å²	85	103.8 Å²	103.8	59%	0.594	55%	0.546	S	S	*	.	H	α-helix	trans	-60.9	-27.2	-178.3	51.8	0	0	0	0	112.7	A7	S3-A7 PolarHBondContact O-N 3.21Å
4	L	80.6	Confident	82.8	Confident	119 Å²	119	100.3 Å²	100.3	62%	0.623	53%	0.525	S	S	*	.	H	α-helix	trans	-63.1	-44.8	171.4	-80.6	160.1	0	0	0	112.5	N2 Q6 A7 E8	N2-L4 PolarHBondContact O-N 3.16Å; L4-Q6 VanDerWaalsContact C-N 3.31Å; L4-Q6 PolarHBondContact O-N 3.43Å; L4-A7 PolarHBondContact O-N 3Å; L4-A7 VanDerWaalsContact O-N 3.16Å; L4-E8 WeakPolarHBondContact O-CG 3.48Å; L4-E8 PolarHBondContact O-N 3.18Å
5	E	83.4	Confident	83.3	Confident	108 Å²	108	104.9 Å²	104.9	51%	0.505	53%	0.533	S	S	.	.	H	α-helix	trans	-61.9	-41.8	179.8	-135.8	177.9	151.8	0	0	110.6	N2 A7 E8 D9	N2-E5 HydrophobicContact CB-CB 4.31Å; N2-E5 VanDerWaalsContact O-CB 3.27Å; N2-E5 WeakPolarHBondContact O-CB 3.32Å; N2-E5 PolarHBondContact O-N 3.08Å; E5-A7 VanDerWaalsContact C-N 3.34Å; E5-A7 PolarHBondContact O-N 3.08Å; E5-E8 PolarHBondContact O-N 2.86Å; E5-D9 PolarHBondContact O-N 2.73Å
6	Q	81.8	Confident	83.8	Confident	109 Å²	109	110.3 Å²	110.3	51%	0.509	54%	0.544	S	S	.	.	H	α-helix	trans	-64.8	-36.9	176.2	-66.2	-177.8	-49.4	0	0	112.7	M1 N2 L4 L10	M1-Q6 HydrophobicContact CG-CG 4.3Å; N2-Q6 PolarHBondContact O-N 3Å; L4-Q6 VanDerWaalsContact C-N 3.31Å; L4-Q6 PolarHBondContact O-N 3.43Å; Q6-L10 WeakPolarHBondContact O-CB 3.32Å; Q6-L10 PolarHBondContact O-N 3.36Å; Q6-L10 VanDerWaalsContact O-N 3.09Å
7	A	84.3	Confident	84	Confident	60 Å²	60	104.6 Å²	104.6	50%	0.496	52%	0.516	S	S	.	.	H	α-helix	trans	-70.3	-38	177.7	0	0	0	0	0	111.8	S3 L4 E5 L10 K11	S3-A7 PolarHBondContact O-N 3.21Å; L4-A7 PolarHBondContact O-N 3Å; L4-A7 VanDerWaalsContact O-N 3.16Å; E5-A7 VanDerWaalsContact C-N 3.34Å; E5-A7 PolarHBondContact O-N 3.08Å; A7-L10 PolarHBondContact O-N 3.08Å; A7-K11 WeakPolarHBondContact O-CB 3.45Å; A7-K11 PolarHBondContact O-N 3.3Å; A7-K11 VanDerWaalsContact O-N 3.1Å
8	E	88.2	Confident	84.2	Confident	133 Å²	133	101.4 Å²	101.4	62%	0.621	50%	0.504	S	S	*	.	H	α-helix	trans	-65	-43.9	174.8	-72.8	-176.1	162.4	0	0	111.8	L4 E5 L10 K11 A12	L4-E8 WeakPolarHBondContact O-CG 3.48Å; L4-E8 PolarHBondContact O-N 3.18Å; E5-E8 PolarHBondContact O-N 2.86Å; E8-L10 PolarHBondContact O-N 3.46Å; E8-K11 PolarHBondContact O-N 3.1Å; E8-A12 WeakPolarHBondContact O-CB 3.44Å; E8-A12 PolarHBondContact O-N 2.76Å
9	D	88.3	Confident	84.4	Confident	102 Å²	102	100.9 Å²	100.9	55%	0.545	50%	0.5	S	S	.	.	H	α-helix	trans	-61	-43.2	175.8	-82.5	-15.9	0	0	0	112.2	E5 K11 A12 F13	E5-D9 PolarHBondContact O-N 2.73Å; D9-K11 VanDerWaalsContact C-N 3.33Å; D9-K11 PolarHBondContact O-N 3.45Å; D9-A12 PolarHBondContact O-N 2.77Å; D9-F13 WeakPolarHBondContact O-CB 3.48Å; D9-F13 PolarHBondContact O-N 3.09Å
10	L	87.3	Confident	84.4	Confident	62 Å²	62	102.9 Å²	102.9	33%	0.325	50%	0.502	S	S	.	.	H	α-helix	trans	-64.6	-40.1	179.2	-155.1	79.1	0	0	0	111.5	Q6 A7 E8 F13 E14 M108 L116	Q6-L10 WeakPolarHBondContact O-CB 3.32Å; Q6-L10 PolarHBondContact O-N 3.36Å; Q6-L10 VanDerWaalsContact O-N 3.09Å; A7-L10 PolarHBondContact O-N 3.08Å; E8-L10 PolarHBondContact O-N 3.46Å; L10-F13 PolarHBondContact O-N 2.98Å; L10-E14 PolarHBondContact O-N 3.34Å; L10-M108 HydrophobicContact CD1-CE 3.91Å; L10-M108 HydrophobicContact CD1-SD 3.9Å; L10-M108 HydrophobicContact CD2-SD 3.9Å; L10-L116 HydrophobicContact CG-CD1 4.33Å
11	K	87.6	Confident	84.5	Confident	152 Å²	152	98 Å²	98	66%	0.661	48%	0.479	S	S	*	.	H	α-helix	trans	-67.2	-38.5	175.7	-172.3	177.2	-177.9	179.2	0	111.9	A7 E8 D9 E14 R15	A7-K11 WeakPolarHBondContact O-CB 3.45Å; A7-K11 PolarHBondContact O-N 3.3Å; A7-K11 VanDerWaalsContact O-N 3.1Å; E8-K11 PolarHBondContact O-N 3.1Å; D9-K11 VanDerWaalsContact C-N 3.33Å; D9-K11 PolarHBondContact O-N 3.45Å; K11-E14 WeakPolarHBondContact O-CB 3.49Å; K11-E14 PolarHBondContact O-N 3.46Å; K11-R15 WeakPolarHBondContact O-CB 3.06Å; K11-R15 PolarHBondContact O-N 3.49Å; K11-R15 VanDerWaalsContact O-N 3.08Å
12	A	90.3	Very high	85.9	Confident	46 Å²	46	92 Å²	92	38%	0.38	46%	0.456	S	S	.	.	H	α-helix	trans	-65.3	-40.6	174.6	0	0	0	0	0	111.4	E8 D9 R15 R16	E8-A12 WeakPolarHBondContact O-CB 3.44Å; E8-A12 PolarHBondContact O-N 2.76Å; D9-A12 PolarHBondContact O-N 2.77Å; A12-R15 PolarHBondContact O-N 3.44Å; A12-R16 WeakPolarHBondContact O-CG 3.43Å; A12-R16 PolarHBondContact O-N 2.9Å; A12-R16 VanDerWaalsContact O-N 3.09Å
13	F	88.5	Confident	86.2	Confident	87 Å²	87	91.9 Å²	91.9	38%	0.382	46%	0.461	S	S	.	.	H	α-helix	trans	-62.3	-47.8	173.5	175.4	-100.1	0	0	0	111.8	D9 L10 R15 R16 L17 L103 L116	D9-F13 WeakPolarHBondContact O-CB 3.48Å; D9-F13 PolarHBondContact O-N 3.09Å; L10-F13 PolarHBondContact O-N 2.98Å; F13-R15 VanDerWaalsContact C-N 3.29Å; F13-R15 PolarHBondContact O-N 3.29Å; F13-R16 PolarHBondContact O-N 2.88Å; F13-L17 HydrophobicContact CE1-CD2 4.01Å; F13-L17 HydrophobicContact CZ-CD2 4.19Å; F13-L17 WeakPolarHBondContact O-CB 3.49Å; F13-L17 PolarHBondContact O-N 3.13Å; F13-L103 HydrophobicContact CE1-CD2 4.26Å; F13-L116 HydrophobicContact CD1-CD1 3.98Å; F13-L116 HydrophobicContact CD1-CD2 4.4Å; F13-L116 HydrophobicContact CE1-CD2 4.32Å
14	E	89.6	Confident	86.3	Confident	55 Å²	55	90.1 Å²	90.1	26%	0.257	45%	0.445	S	S	.	.	H	α-helix	trans	-52.4	-48.8	175.7	-163.6	170.3	170.5	0	0	112	L10 K11 L17 T18 K115 L116	L10-E14 PolarHBondContact O-N 3.34Å; K11-E14 WeakPolarHBondContact O-CB 3.49Å; K11-E14 PolarHBondContact O-N 3.46Å; E14-L17 PolarHBondContact O-N 3.5Å; E14-T18 WeakPolarHBondContact O-CB 3.27Å; E14-T18 PolarHBondContact O-N 3.35Å; E14-T18 PolarHBondContact O-OG1 2.75Å; E14-K115 WeakPolarHBondContact OE1-CG 3.34Å; E14-L116 HydrophobicContact CB-CD1 3.38Å; E14-L116 HydrophobicContact CG-CD1 3.63Å; E14-L116 HydrophobicContact CG-CG 4.35Å; E14-L116 PolarHBondContact OE1-N 2.97Å
15	R	90.7	Very high	86.1	Confident	170 Å²	170	89 Å²	89	64%	0.642	44%	0.436	S	S	*	.	H	α-helix	trans	-62.3	-46.8	-178.4	-178.2	177.3	175	170.7	3	111.1	K11 A12 F13 T18 E19	K11-R15 WeakPolarHBondContact O-CB 3.06Å; K11-R15 PolarHBondContact O-N 3.49Å; K11-R15 VanDerWaalsContact O-N 3.08Å; A12-R15 PolarHBondContact O-N 3.44Å; F13-R15 VanDerWaalsContact C-N 3.29Å; F13-R15 PolarHBondContact O-N 3.29Å; R15-T18 PolarHBondContact O-N 2.89Å; R15-E19 HydrophobicContact CG-CG 4.49Å; R15-E19 WeakPolarHBondContact CG-OE1 3.44Å; R15-E19 IonicContact CZ-OE1 3.72Å; R15-E19 IonicContact NE-OE1 2.9Å; R15-E19 PolarHBondContact NE-OE1 3Å; R15-E19 IonicContact NH2-OE1 3.65Å; R15-E19 WeakPolarHBondContact O-CB 3.42Å; R15-E19 WeakPolarHBondContact O-CG 3.43Å; R15-E19 PolarHBondContact O-N 2.83Å
16	R	90.2	Very high	85.8	Confident	191 Å²	191	87 Å²	87	72%	0.721	43%	0.433	S	S	*	.	H	α-helix	trans	-63.7	-41.8	178	-73.4	-178.4	-179.9	-174	3	112	A12 F13 T18 E19 Y20	A12-R16 WeakPolarHBondContact O-CG 3.43Å; A12-R16 PolarHBondContact O-N 2.9Å; A12-R16 VanDerWaalsContact O-N 3.09Å; F13-R16 PolarHBondContact O-N 2.88Å; R16-T18 VanDerWaalsContact C-N 3.35Å; R16-E19 PolarHBondContact O-N 2.78Å; R16-Y20 WeakPolarHBondContact O-CB 3.42Å; R16-Y20 PolarHBondContact O-N 2.87Å
17	L	87.2	Confident	85.6	Confident	13 Å²	13	83.9 Å²	83.9	7%	0.068	43%	0.426	C	S	.	.	H	α-helix	trans	-63.4	-44.1	178	-176.8	60	0	0	0	110.9	F13 E14 Y20 I21 C99 C110	F13-L17 HydrophobicContact CE1-CD2 4.01Å; F13-L17 HydrophobicContact CZ-CD2 4.19Å; F13-L17 WeakPolarHBondContact O-CB 3.49Å; F13-L17 PolarHBondContact O-N 3.13Å; E14-L17 PolarHBondContact O-N 3.5Å; L17-Y20 PolarHBondContact O-N 3.03Å; L17-I21 HydrophobicContact CD1-CD1 3.82Å; L17-I21 HydrophobicContact CD1-CG1 4.36Å; L17-I21 HydrophobicContact CG-CD1 3.93Å; L17-I21 WeakPolarHBondContact O-CB 3.34Å; L17-I21 WeakPolarHBondContact O-CG1 3.06Å; L17-I21 PolarHBondContact O-N 2.76Å; L17-C99 HydrophobicContact CD2-CB 4.46Å; L17-C110 HydrophobicContact CD2-CB 4.17Å
18	T	87.3	Confident	85.5	Confident	48 Å²	48	81.3 Å²	81.3	29%	0.294	40%	0.404	S	S	.	.	H	α-helix	trans	-64.9	-45.8	176.9	-55.2	0	0	0	0	111.7	E14 R15 R16 Y20 I21 S22 T113 G114	E14-T18 WeakPolarHBondContact O-CB 3.27Å; E14-T18 PolarHBondContact O-N 3.35Å; E14-T18 PolarHBondContact O-OG1 2.75Å; R15-T18 PolarHBondContact O-N 2.89Å; R16-T18 VanDerWaalsContact C-N 3.35Å; T18-Y20 VanDerWaalsContact C-N 3.33Å; T18-Y20 PolarHBondContact O-N 3.33Å; T18-I21 PolarHBondContact O-N 2.83Å; T18-S22 WeakPolarHBondContact O-CB 3.49Å; T18-S22 PolarHBondContact O-N 3.35Å; T18-S22 PolarHBondContact O-OG 3.46Å; T18-T113 WeakPolarHBondContact CA-O 3.39Å; T18-G114 PolarHBondContact OG1-O 2.93Å
19	E	88.3	Confident	85.1	Confident	92 Å²	92	76.2 Å²	76.2	43%	0.43	39%	0.387	S	S	.	.	H	α-helix	trans	-59.3	-43.7	175.1	-77.2	173.7	-169.7	0	0	111.1	R15 R16 S22 C23	R15-E19 HydrophobicContact CG-CG 4.49Å; R15-E19 WeakPolarHBondContact CG-OE1 3.44Å; R15-E19 IonicContact CZ-OE1 3.72Å; R15-E19 IonicContact NE-OE1 2.9Å; R15-E19 PolarHBondContact NE-OE1 3Å; R15-E19 IonicContact NH2-OE1 3.65Å; R15-E19 WeakPolarHBondContact O-CB 3.42Å; R15-E19 WeakPolarHBondContact O-CG 3.43Å; R15-E19 PolarHBondContact O-N 2.83Å; R16-E19 PolarHBondContact O-N 2.78Å; E19-S22 WeakPolarHBondContact CA-OG 3.32Å; E19-S22 PolarHBondContact O-OG 2.76Å; E19-C23 PolarHBondContact O-N 2.87Å; E19-C23 VanDerWaalsContact O-N 3.08Å; E19-C23 PolarHBondContact O-SG 3.46Å
20	Y	85.8	Confident	85	Confident	139 Å²	139	79.9 Å²	79.9	55%	0.545	39%	0.393	S	S	.	.	H	α-helix	trans	-64.9	-47.7	178.5	-165.9	-108.2	0	0	0	112.4	R16 L17 T18 C23 L24 I95	R16-Y20 WeakPolarHBondContact O-CB 3.42Å; R16-Y20 PolarHBondContact O-N 2.87Å; L17-Y20 PolarHBondContact O-N 3.03Å; T18-Y20 VanDerWaalsContact C-N 3.33Å; T18-Y20 PolarHBondContact O-N 3.33Å; Y20-C23 PolarHBondContact O-N 3.37Å; Y20-L24 HydrophobicContact CD1-CD1 3.67Å; Y20-L24 HydrophobicContact CE1-CD1 3.49Å; Y20-L24 VanDerWaalsContact CE1-CD1 3.49Å; Y20-L24 HydrophobicContact CG-CD1 4.38Å; Y20-L24 WeakPolarHBondContact O-CD1 3.28Å; Y20-L24 WeakPolarHBondContact O-CG 3.48Å; Y20-L24 PolarHBondContact O-N 2.88Å; Y20-I95 HydrophobicContact CD1-CD1 4.47Å; Y20-I95 HydrophobicContact CD1-CG2 4.49Å; Y20-I95 HydrophobicContact CE1-CD1 3.81Å
21	I	85.3	Confident	84.9	Confident	1 Å²	1	80.1 Å²	80.1	1%	0.005	39%	0.39	C	S	.	.	H	α-helix	trans	-67	-41.7	179.6	-71.2	171.8	0	0	0	111.1	L17 T18 C23 L24 Q25 A96 D112	L17-I21 HydrophobicContact CD1-CD1 3.82Å; L17-I21 HydrophobicContact CD1-CG1 4.36Å; L17-I21 HydrophobicContact CG-CD1 3.93Å; L17-I21 WeakPolarHBondContact O-CB 3.34Å; L17-I21 WeakPolarHBondContact O-CG1 3.06Å; L17-I21 PolarHBondContact O-N 2.76Å; T18-I21 PolarHBondContact O-N 2.83Å; I21-C23 VanDerWaalsContact C-N 3.3Å; I21-C23 PolarHBondContact O-N 3.35Å; I21-L24 PolarHBondContact O-N 3.34Å; I21-L24 VanDerWaalsContact O-N 3.08Å; I21-Q25 HydrophobicContact CG2-CG 4.45Å; I21-Q25 WeakPolarHBondContact O-CB 3.38Å; I21-Q25 PolarHBondContact O-N 3.47Å; I21-A96 HydrophobicContact CD1-CB 4.49Å; I21-D112 VanDerWaalsContact CG2-O 3.28Å; I21-D112 WeakPolarHBondContact CG2-O 3.48Å
22	S	83.9	Confident	84.8	Confident	63 Å²	63	78.3 Å²	78.3	44%	0.441	38%	0.379	S	S	.	.	H	α-helix	trans	-64.4	-30.5	177.5	61	0	0	0	0	113.1	T18 E19 P26	T18-S22 WeakPolarHBondContact O-CB 3.49Å; T18-S22 PolarHBondContact O-N 3.35Å; T18-S22 PolarHBondContact O-OG 3.46Å; E19-S22 WeakPolarHBondContact CA-OG 3.32Å; E19-S22 PolarHBondContact O-OG 2.76Å; S22-P26 WeakPolarHBondContact O-CD 3.33Å
23	C	84.1	Confident	84.6	Confident	95 Å²	95	81.7 Å²	81.7	64%	0.642	39%	0.388	S	S	*	.	H	α-helix	trans	-69.7	-34.3	171.6	-69.3	0	0	0	0	112.4	E19 Y20 I21	E19-C23 PolarHBondContact O-N 2.87Å; E19-C23 VanDerWaalsContact O-N 3.08Å; E19-C23 PolarHBondContact O-SG 3.46Å; Y20-C23 PolarHBondContact O-N 3.37Å; I21-C23 VanDerWaalsContact C-N 3.3Å; I21-C23 PolarHBondContact O-N 3.35Å
24	L	80.6	Confident	84.6	Confident	47 Å²	47	81 Å²	81	25%	0.246	39%	0.388	C	S	.	.	H	α-helix	trans	-80.6	-36.2	-178.4	-73.5	160.5	0	0	0	113	Y20 I21 A27 T28 P92 I95	Y20-L24 HydrophobicContact CD1-CD1 3.67Å; Y20-L24 HydrophobicContact CE1-CD1 3.49Å; Y20-L24 VanDerWaalsContact CE1-CD1 3.49Å; Y20-L24 HydrophobicContact CG-CD1 4.38Å; Y20-L24 WeakPolarHBondContact O-CD1 3.28Å; Y20-L24 WeakPolarHBondContact O-CG 3.48Å; Y20-L24 PolarHBondContact O-N 2.88Å; I21-L24 PolarHBondContact O-N 3.34Å; I21-L24 VanDerWaalsContact O-N 3.08Å; L24-A27 PolarHBondContact O-N 2.87Å; L24-T28 PolarHBondContact O-N 3.26Å; L24-T28 PolarHBondContact O-OG1 2.91Å; L24-P92 HydrophobicContact CB-CG 4.17Å; L24-I95 HydrophobicContact CD1-CD1 3.57Å
25	Q	76.3	Confident	84.4	Confident	95 Å²	95	80.6 Å²	80.6	44%	0.444	39%	0.387	S	S	.	.	H	α-helix	trans	-52.9	-48.6	-178.8	-108.8	-107.6	-96.9	0	0	115.7	I21 A27 T28 G29	I21-Q25 HydrophobicContact CG2-CG 4.45Å; I21-Q25 WeakPolarHBondContact O-CB 3.38Å; I21-Q25 PolarHBondContact O-N 3.47Å; Q25-A27 PolarHBondContact O-N 2.9Å; Q25-T28 PolarHBondContact O-N 3.23Å; Q25-G29 PolarHBondContact O-N 3.43Å
26	P	76.3	Confident	84.3	Confident	67 Å²	67	77.1 Å²	77.1	44%	0.435	38%	0.38	S	S	.	.	H	α-helix	trans	-67.5	-36	-177.5	23.6	-32.9	0	0	0	111.9	S22 R30	S22-P26 WeakPolarHBondContact O-CD 3.33Å; P26-R30 VanDerWaalsContact O-CG 3.25Å; P26-R30 WeakPolarHBondContact O-CG 3.45Å; P26-R30 PolarHBondContact O-N 3.36Å
27	A	78.9	Confident	84.3	Confident	44 Å²	44	72 Å²	72	36%	0.364	37%	0.37	S	S	.	.	H	α-helix	trans	-65.1	-48.6	173.5	0	0	0	0	0	110.6	L24 Q25 G29 R30 W31	L24-A27 PolarHBondContact O-N 2.87Å; Q25-A27 PolarHBondContact O-N 2.9Å; A27-G29 VanDerWaalsContact C-N 3.35Å; A27-G29 PolarHBondContact O-N 3.44Å; A27-R30 PolarHBondContact O-N 3.47Å; A27-W31 PolarHBondContact O-N 3.09Å; A27-W31 VanDerWaalsContact O-N 3.11Å
28	T	80.9	Confident	84.3	Confident	6 Å²	6	72.3 Å²	72.3	4%	0.037	37%	0.373	C	S	.	.	H	α-helix	trans	-60.6	-41.7	176.4	-63	0	0	0	0	112.2	L24 Q25 W31 R32 R88 V89 P92	L24-T28 PolarHBondContact O-N 3.26Å; L24-T28 PolarHBondContact O-OG1 2.91Å; Q25-T28 PolarHBondContact O-N 3.23Å; T28-W31 PolarHBondContact O-N 2.77Å; T28-R32 WeakPolarHBondContact O-CG 3.15Å; T28-R32 PolarHBondContact O-N 3.26Å; T28-R88 PolarHBondContact OG1-O 2.81Å; T28-V89 VanDerWaalsContact CG2-O 3.28Å; T28-V89 WeakPolarHBondContact CG2-O 3.33Å; T28-P92 HydrophobicContact CG2-CG 3.83Å; T28-P92 WeakPolarHBondContact OG1-CD 3.37Å; T28-P92 WeakPolarHBondContact OG1-CG 3.35Å
29	G	80.9	Confident	84.3	Confident	26 Å²	26	72.7 Å²	72.7	27%	0.268	38%	0.377	S	S	.	.	H	α-helix	trans	-60.3	-44.7	176.4	0	0	0	0	0	112.3	Q25 A27 W31 R32 M33	Q25-G29 PolarHBondContact O-N 3.43Å; A27-G29 VanDerWaalsContact C-N 3.35Å; A27-G29 PolarHBondContact O-N 3.44Å; G29-W31 PolarHBondContact O-N 2.85Å; G29-R32 PolarHBondContact O-N 3.34Å; G29-M33 WeakPolarHBondContact O-CG 3.34Å; G29-M33 PolarHBondContact O-N 3.08Å
30	R	84.4	Confident	84.3	Confident	178 Å²	178	72.3 Å²	72.3	67%	0.672	38%	0.381	S	S	*	.	H	α-helix	trans	-58.8	-45.9	174.2	-71.9	168.9	-177.6	175.8	1.5	111.9	P26 A27 R32 M33 I34	P26-R30 VanDerWaalsContact O-CG 3.25Å; P26-R30 WeakPolarHBondContact O-CG 3.45Å; P26-R30 PolarHBondContact O-N 3.36Å; A27-R30 PolarHBondContact O-N 3.47Å; R30-R32 PolarHBondContact O-N 2.7Å; R30-M33 PolarHBondContact O-N 3.3Å; R30-I34 WeakPolarHBondContact O-CG1 3.39Å; R30-I34 PolarHBondContact O-N 3.47Å
31	W	85.3	Confident	84.3	Confident	67 Å²	67	67.4 Å²	67.4	25%	0.254	37%	0.366	S	S	.	.	H	α-helix	trans	-64.5	-37.4	177.7	-72.7	112.5	0	0	0	113	A27 T28 G29 I34 L35 L80 I85 R88 V89	A27-W31 PolarHBondContact O-N 3.09Å; A27-W31 VanDerWaalsContact O-N 3.11Å; T28-W31 PolarHBondContact O-N 2.77Å; G29-W31 PolarHBondContact O-N 2.85Å; W31-I34 HydrophobicContact CE3-CD1 4.24Å; W31-I34 HydrophobicContact CZ3-CD1 4.48Å; W31-I34 PolarHBondContact O-N 2.92Å; W31-L35 PolarHBondContact O-N 3.23Å; W31-L80 HydrophobicContact CE3-CD2 4.42Å; W31-L80 HydrophobicContact CZ3-CD2 3.79Å; W31-I85 HydrophobicContact CB-CD1 4.41Å; W31-I85 HydrophobicContact CB-CG1 4.33Å; W31-I85 HydrophobicContact CD2-CD1 4.34Å; W31-I85 HydrophobicContact CE3-CD1 3.48Å; W31-I85 VanDerWaalsContact CE3-CD1 3.48Å; W31-I85 HydrophobicContact CE3-CG1 4.07Å; W31-I85 HydrophobicContact CZ3-CD1 4.13Å; W31-R88 HydrophobicContact CG-CB 4.27Å; W31-V89 HydrophobicContact CB-CG1 3.66Å
32	R	86.8	Confident	84.4	Confident	115 Å²	115	68.5 Å²	68.5	43%	0.434	37%	0.373	S	S	.	.	H	α-helix	trans	-63.8	-44.5	173.7	-72.5	178.8	-178.3	-177.5	0.9	111.6	T28 G29 R30 L35 I36 V89	T28-R32 WeakPolarHBondContact O-CG 3.15Å; T28-R32 PolarHBondContact O-N 3.26Å; G29-R32 PolarHBondContact O-N 3.34Å; R30-R32 PolarHBondContact O-N 2.7Å; R32-L35 PolarHBondContact O-N 3.27Å; R32-I36 VanDerWaalsContact O-CG1 3.28Å; R32-I36 WeakPolarHBondContact O-CG1 3.42Å; R32-I36 PolarHBondContact O-N 3.49Å; R32-V89 HydrophobicContact CG-CB 4Å; R32-V89 HydrophobicContact CG-CG1 3.87Å; R32-V89 PolarHBondContact NE-O 3.17Å; R32-V89 PolarHBondContact NH2-O 3.2Å
33	M	86.3	Confident	84.6	Confident	117 Å²	117	68.4 Å²	68.4	58%	0.576	38%	0.376	S	S	*	.	H	α-helix	trans	-61.5	-44.7	176.4	-72.8	-58.7	-64.1	0	0	112	G29 R30 L35 I36 V37	G29-M33 WeakPolarHBondContact O-CG 3.34Å; G29-M33 PolarHBondContact O-N 3.08Å; R30-M33 PolarHBondContact O-N 3.3Å; M33-L35 VanDerWaalsContact C-N 3.34Å; M33-L35 PolarHBondContact O-N 2.92Å; M33-I36 PolarHBondContact O-N 3.27Å; M33-V37 WeakPolarHBondContact O-CG2 3.27Å; M33-V37 PolarHBondContact O-N 3.45Å
34	I	87.1	Confident	84.6	Confident	72 Å²	72	67 Å²	67	37%	0.369	37%	0.365	S	S	.	.	H	α-helix	trans	-58.6	-46.5	175.7	-68.6	166.5	0	0	0	110.6	R30 W31 I36 V37 V38 L80	R30-I34 WeakPolarHBondContact O-CG1 3.39Å; R30-I34 PolarHBondContact O-N 3.47Å; W31-I34 HydrophobicContact CE3-CD1 4.24Å; W31-I34 HydrophobicContact CZ3-CD1 4.48Å; W31-I34 PolarHBondContact O-N 2.92Å; I34-I36 PolarHBondContact O-N 3.05Å; I34-V37 PolarHBondContact O-N 3.35Å; I34-V38 HydrophobicContact CG2-CG2 4.27Å; I34-V38 WeakPolarHBondContact O-CB 3.49Å; I34-V38 VanDerWaalsContact O-CG2 3.28Å; I34-V38 WeakPolarHBondContact O-CG2 3.3Å; I34-V38 PolarHBondContact O-N 3.39Å; I34-L80 HydrophobicContact CG2-CD1 3.96Å; I34-L80 HydrophobicContact CG2-CD2 4.35Å
35	L	86.6	Confident	84.8	Confident	46 Å²	46	65 Å²	65	24%	0.241	36%	0.355	C	S	.	.	H	α-helix	trans	-59.2	-44.6	177	-83.7	177.4	0	0	0	112.7	W31 R32 M33 S39 L80 I85 V89	W31-L35 PolarHBondContact O-N 3.23Å; R32-L35 PolarHBondContact O-N 3.27Å; M33-L35 VanDerWaalsContact C-N 3.34Å; M33-L35 PolarHBondContact O-N 2.92Å; L35-S39 VanDerWaalsContact O-CB 3.24Å; L35-S39 WeakPolarHBondContact O-CB 3.46Å; L35-S39 PolarHBondContact O-N 2.95Å; L35-S39 PolarHBondContact O-OG 3.32Å; L35-L80 HydrophobicContact CD2-CD1 4.49Å; L35-I85 HydrophobicContact CD1-CD1 3.89Å; L35-I85 HydrophobicContact CD1-CG1 3.81Å; L35-I85 HydrophobicContact CD1-CG2 4.21Å; L35-I85 HydrophobicContact CD2-CD1 3.65Å; L35-I85 HydrophobicContact CD2-CG1 4.26Å; L35-I85 HydrophobicContact CD2-CG2 4.01Å; L35-I85 HydrophobicContact CG-CD1 3.43Å; L35-I85 VanDerWaalsContact CG-CD1 3.43Å; L35-I85 HydrophobicContact CG-CG1 3.95Å; L35-I85 HydrophobicContact CG-CG2 4.5Å; L35-V89 HydrophobicContact CD1-CG1 4.03Å
36	I	88.8	Confident	85.1	Confident	98 Å²	98	62.1 Å²	62.1	50%	0.503	35%	0.348	S	S	.	.	H	α-helix	trans	-61.7	-49.7	179.8	-68.7	164.1	0	0	0	109.8	R32 M33 I34 V38 S39 V40	R32-I36 VanDerWaalsContact O-CG1 3.28Å; R32-I36 WeakPolarHBondContact O-CG1 3.42Å; R32-I36 PolarHBondContact O-N 3.49Å; M33-I36 PolarHBondContact O-N 3.27Å; I34-I36 PolarHBondContact O-N 3.05Å; I36-V38 PolarHBondContact O-N 2.87Å; I36-S39 PolarHBondContact O-N 3.27Å; I36-V40 HydrophobicContact CG2-CG2 4.47Å; I36-V40 WeakPolarHBondContact O-CG2 3.34Å; I36-V40 PolarHBondContact O-N 3.36Å
37	V	88.5	Confident	85.4	Confident	83 Å²	83	67 Å²	67	50%	0.503	36%	0.358	S	S	.	.	H	α-helix	trans	-59.1	-50.2	179.9	172	0	0	0	0	110.8	M33 I34 S39 V40 C41	M33-V37 WeakPolarHBondContact O-CG2 3.27Å; M33-V37 PolarHBondContact O-N 3.45Å; I34-V37 PolarHBondContact O-N 3.35Å; V37-S39 VanDerWaalsContact C-N 3.31Å; V37-S39 PolarHBondContact O-N 3.06Å; V37-V40 PolarHBondContact O-N 3.47Å; V37-C41 WeakPolarHBondContact O-CB 3.24Å; V37-C41 PolarHBondContact O-N 3.08Å; V37-C41 PolarHBondContact O-SG 3.39Å
38	V	87.2	Confident	85.4	Confident	20 Å²	20	70 Å²	70	12%	0.121	37%	0.367	C	S	.	.	H	α-helix	trans	-62.8	-39.8	179.7	174.5	0	0	0	0	111.1	I34 I36 C41 T42 T76 L77 L80	I34-V38 HydrophobicContact CG2-CG2 4.27Å; I34-V38 WeakPolarHBondContact O-CB 3.49Å; I34-V38 VanDerWaalsContact O-CG2 3.28Å; I34-V38 WeakPolarHBondContact O-CG2 3.3Å; I34-V38 PolarHBondContact O-N 3.39Å; I36-V38 PolarHBondContact O-N 2.87Å; V38-C41 PolarHBondContact O-N 3.3Å; V38-T42 WeakPolarHBondContact O-CB 3.44Å; V38-T42 PolarHBondContact O-N 3.39Å; V38-T42 PolarHBondContact O-OG1 3.13Å; V38-T76 HydrophobicContact CG1-CG2 4.32Å; V38-T76 HydrophobicContact CG2-CG2 4.03Å; V38-L77 HydrophobicContact CG1-CB 3.97Å; V38-L77 HydrophobicContact CG1-CD1 4.26Å; V38-L77 HydrophobicContact CG1-CG 4.44Å; V38-L80 HydrophobicContact CB-CD1 4.41Å; V38-L80 HydrophobicContact CG1-CD1 4.38Å; V38-L80 HydrophobicContact CG2-CD1 4.02Å
39	S	87.2	Confident	85.3	Confident	55 Å²	55	71.9 Å²	71.9	39%	0.385	37%	0.374	S	S	.	.	H	α-helix	trans	-65.2	-42.7	178.7	-57.7	0	0	0	0	112.1	L35 I36 V37 T42 A43	L35-S39 VanDerWaalsContact O-CB 3.24Å; L35-S39 WeakPolarHBondContact O-CB 3.46Å; L35-S39 PolarHBondContact O-N 2.95Å; L35-S39 PolarHBondContact O-OG 3.32Å; I36-S39 PolarHBondContact O-N 3.27Å; V37-S39 VanDerWaalsContact C-N 3.31Å; V37-S39 PolarHBondContact O-N 3.06Å; S39-T42 PolarHBondContact O-N 3.08Å; S39-A43 WeakPolarHBondContact O-CB 3.46Å; S39-A43 PolarHBondContact O-N 2.92Å
40	V	89.9	Confident	85.2	Confident	84 Å²	84	76.8 Å²	76.8	51%	0.509	39%	0.393	S	S	.	.	H	α-helix	trans	-64.2	-45	176.2	172.3	0	0	0	0	110.5	I36 V37 T42 A43 T44	I36-V40 HydrophobicContact CG2-CG2 4.47Å; I36-V40 WeakPolarHBondContact O-CG2 3.34Å; I36-V40 PolarHBondContact O-N 3.36Å; V37-V40 PolarHBondContact O-N 3.47Å; V40-T42 VanDerWaalsContact C-N 3.34Å; V40-T42 PolarHBondContact O-N 2.85Å; V40-A43 PolarHBondContact O-N 3.19Å; V40-T44 HydrophobicContact CG1-CG2 4.44Å; V40-T44 WeakPolarHBondContact O-CG2 3.45Å; V40-T44 PolarHBondContact O-N 3.23Å; V40-T44 PolarHBondContact O-OG1 3.48Å; V40-T44 VanDerWaalsContact O-OG1 3.1Å
41	C	86.2	Confident	84.9	Confident	36 Å²	36	73.3 Å²	73.3	24%	0.243	39%	0.387	C	S	.	.	H	α-helix	trans	-61.6	-39.9	175.9	-68.4	0	0	0	0	112.5	V37 V38 T44 G45 F69	V37-C41 WeakPolarHBondContact O-CB 3.24Å; V37-C41 PolarHBondContact O-N 3.08Å; V37-C41 PolarHBondContact O-SG 3.39Å; V38-C41 PolarHBondContact O-N 3.3Å; C41-T44 PolarHBondContact O-OG1 2.9Å; C41-T44 VanDerWaalsContact O-OG1 3.09Å; C41-G45 PolarHBondContact O-N 3.35Å; C41-F69 HydrophobicContact CB-CE1 4.14Å; C41-F69 HydrophobicContact CB-CZ 4.08Å
42	T	87.2	Confident	84.4	Confident	24 Å²	24	72.1 Å²	72.1	15%	0.147	39%	0.386	C	S	.	.	H	α-helix	trans	-66.5	-40.9	175.1	-60.2	0	0	0	0	111.2	V38 S39 V40 G45 A46 F70 S73	V38-T42 WeakPolarHBondContact O-CB 3.44Å; V38-T42 PolarHBondContact O-N 3.39Å; V38-T42 PolarHBondContact O-OG1 3.13Å; S39-T42 PolarHBondContact O-N 3.08Å; V40-T42 VanDerWaalsContact C-N 3.34Å; V40-T42 PolarHBondContact O-N 2.85Å; T42-G45 PolarHBondContact O-N 2.93Å; T42-A46 WeakPolarHBondContact O-CB 3.35Å; T42-A46 PolarHBondContact O-N 3.26Å; T42-F70 HydrophobicContact CG2-CE2 4.33Å; T42-S73 WeakPolarHBondContact OG1-CB 3.28Å
43	A	86.4	Confident	83.4	Confident	61 Å²	61	70.9 Å²	70.9	50%	0.504	39%	0.393	S	S	.	.	H	α-helix	trans	-65.8	-44.2	178.9	0	0	0	0	0	112.1	S39 V40 A46 W47	S39-A43 WeakPolarHBondContact O-CB 3.46Å; S39-A43 PolarHBondContact O-N 2.92Å; V40-A43 PolarHBondContact O-N 3.19Å; A43-A46 PolarHBondContact O-N 3.12Å; A43-W47 WeakPolarHBondContact O-CB 3.25Å; A43-W47 PolarHBondContact O-N 2.99Å
44	T	85.9	Confident	82.5	Confident	66 Å²	66	69.1 Å²	69.1	41%	0.405	39%	0.386	S	S	.	.	H	α-helix	trans	-69	-39.4	176.3	55.8	0	0	0	0	111.8	V40 C41 W47 N48	V40-T44 HydrophobicContact CG1-CG2 4.44Å; V40-T44 WeakPolarHBondContact O-CG2 3.45Å; V40-T44 PolarHBondContact O-N 3.23Å; V40-T44 PolarHBondContact O-OG1 3.48Å; V40-T44 VanDerWaalsContact O-OG1 3.1Å; C41-T44 PolarHBondContact O-OG1 2.9Å; C41-T44 VanDerWaalsContact O-OG1 3.09Å; T44-W47 PolarHBondContact O-N 3.48Å; T44-N48 PolarHBondContact O-N 3.18Å; T44-N48 PolarHBondContact O-ND2 3.46Å
45	G	83.9	Confident	81.2	Confident	5 Å²	5	66.7 Å²	66.7	5%	0.052	37%	0.374	C	S	.	.	H	α-helix	trans	-61.7	-43.4	173.2	0	0	0	0	0	112.5	C41 T42 N48 W49	C41-G45 PolarHBondContact O-N 3.35Å; T42-G45 PolarHBondContact O-N 2.93Å; G45-N48 PolarHBondContact O-N 3.23Å; G45-W49 WeakPolarHBondContact O-CB 2.86Å; G45-W49 PolarHBondContact O-N 2.91Å
46	A	83.1	Confident	79.9	Confident	34 Å²	34	73.2 Å²	73.2	28%	0.281	40%	0.403	S	S	.	.	H	α-helix	trans	-65.1	-42.1	176.3	0	0	0	0	0	111.8	T42 A43 W49 L50 F70	T42-A46 WeakPolarHBondContact O-CB 3.35Å; T42-A46 PolarHBondContact O-N 3.26Å; A43-A46 PolarHBondContact O-N 3.12Å; A46-W49 WeakPolarHBondContact O-CB 3.44Å; A46-W49 PolarHBondContact O-N 3.47Å; A46-L50 WeakPolarHBondContact O-CB 3.43Å; A46-L50 PolarHBondContact O-N 3.36Å; A46-F70 HydrophobicContact CB-CD2 4.12Å; A46-F70 HydrophobicContact CB-CE2 3.73Å
47	W	81.1	Confident	78.6	Confident	170 Å²	170	76 Å²	76	64%	0.644	41%	0.411	S	S	*	.	H	α-helix	trans	-60.7	-47.4	176.7	-177.5	-93.7	0	0	0	111.9	A43 T44 W49 L50 I51	A43-W47 WeakPolarHBondContact O-CB 3.25Å; A43-W47 PolarHBondContact O-N 2.99Å; T44-W47 PolarHBondContact O-N 3.48Å; W47-W49 VanDerWaalsContact C-N 3.31Å; W47-W49 PolarHBondContact O-N 2.73Å; W47-L50 PolarHBondContact O-N 2.96Å; W47-I51 HydrophobicContact CD2-CD1 4.05Å; W47-I51 HydrophobicContact CG-CD1 4.28Å; W47-I51 HydrophobicContact CZ2-CD1 3.69Å; W47-I51 PolarHBondContact O-N 3.29Å
48	N	80.2	Confident	77.7	Confident	106 Å²	106	75.3 Å²	75.3	57%	0.567	41%	0.408	S	S	*	.	H	α-helix	trans	-62.4	-38.4	175.6	-77.4	-37.1	0	0	0	112.2	T44 G45 D52	T44-N48 PolarHBondContact O-N 3.18Å; T44-N48 PolarHBondContact O-ND2 3.46Å; G45-N48 PolarHBondContact O-N 3.23Å; N48-D52 PolarHBondContact O-N 3.05Å
49	W	78.7	Confident	77.1	Confident	47 Å²	47	78.3 Å²	78.3	18%	0.178	43%	0.43	C	S	.	.	H	α-helix	trans	-66.1	-39.5	176.1	-177.1	70.3	0	0	0	112.9	G45 A46 W47 T55 F60 S63 H67 F70	G45-W49 WeakPolarHBondContact O-CB 2.86Å; G45-W49 PolarHBondContact O-N 2.91Å; A46-W49 WeakPolarHBondContact O-CB 3.44Å; A46-W49 PolarHBondContact O-N 3.47Å; W47-W49 VanDerWaalsContact C-N 3.31Å; W47-W49 PolarHBondContact O-N 2.73Å; W49-T55 HydrophobicContact CD2-CG2 3.96Å; W49-T55 HydrophobicContact CG-CG2 4.42Å; W49-T55 HydrophobicContact CH2-CG2 4.11Å; W49-T55 HydrophobicContact CZ2-CG2 3.42Å; W49-T55 VanDerWaalsContact CZ2-CG2 3.42Å; W49-T55 PolarHBondContact O-OG1 3.25Å; W49-F60 HydrophobicContact CH2-CD2 4.09Å; W49-F60 AromaticContact CH2-CE2 3.87Å; W49-F60 HydrophobicContact CH2-CE2 3.87Å; W49-F60 AromaticContact CZ2-CD2 3.92Å; W49-F60 HydrophobicContact CZ2-CD2 3.92Å; W49-F60 AromaticContact CZ2-CE2 3.92Å; W49-F60 HydrophobicContact CZ2-CE2 3.92Å; W49-S63 PolarHBondContact NE1-OG 2.97Å; W49-H67 AromaticContact CD1-CD2 3.43Å; W49-H67 VanDerWaalsContact CD1-CD2 3.43Å; W49-H67 AromaticContact CD1-CG 3.82Å; W49-F70 HydrophobicContact CG-CD1 4.41Å
50	L	78.1	Confident	76.1	Confident	128 Å²	128	81.6 Å²	81.6	67%	0.67	44%	0.437	S	S	*	.	H	α-helix	trans	-73.7	-29.9	-176.1	-153.5	99.4	0	0	0	113.3	A46 W47	A46-L50 WeakPolarHBondContact O-CB 3.43Å; A46-L50 PolarHBondContact O-N 3.36Å; W47-L50 PolarHBondContact O-N 2.96Å
51	I	78.1	Confident	75.1	Confident	105 Å²	105	83.3 Å²	83.3	54%	0.538	44%	0.443	S	S	.	.	H	α-helix	trans	-84.5	-17.2	179.5	-69.7	176.8	0	0	0	111.9	W47 P53	W47-I51 HydrophobicContact CD2-CD1 4.05Å; W47-I51 HydrophobicContact CG-CD1 4.28Å; W47-I51 HydrophobicContact CZ2-CD1 3.69Å; W47-I51 PolarHBondContact O-N 3.29Å; I51-P53 VanDerWaalsContact O-CD 3.29Å; I51-P53 WeakPolarHBondContact O-CD 3.47Å
52	D	75	Confident	74.2	Confident	43 Å²	43	85 Å²	85	23%	0.23	46%	0.455	C	S	.	.			trans	-69.6	116.4	-178.9	-168.9	-24.4	0	0	0	110.9	N48 D54 T55 H67	N48-D52 PolarHBondContact O-N 3.05Å; D52-D54 PolarHBondContact O-N 2.94Å; D52-D54 PolarHBondContact OD1-N 2.98Å; D52-T55 WeakPolarHBondContact CB-OG1 3.23Å; D52-T55 VanDerWaalsContact O-CB 3.3Å; D52-T55 WeakPolarHBondContact O-CB 3.34Å; D52-T55 PolarHBondContact O-N 3.44Å; D52-T55 PolarHBondContact O-OG1 3.27Å; D52-H67 IonicContact OD2-CE1 3.12Å; D52-H67 PolarHBondContact OD2-CE1 3.11Å; D52-H67 IonicContact OD2-NE2 3.34Å; D52-H67 PolarHBondContact OD2-NE2 3.3Å
53	P	67.1	Low	73.4	Confident	89 Å²	89	84 Å²	84	58%	0.578	45%	0.448	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68	-16.5	-178	28.6	-35.9	0	0	0	113.5	I51	I51-P53 VanDerWaalsContact O-CD 3.29Å; I51-P53 WeakPolarHBondContact O-CD 3.47Å
54	D	65.8	Low	72.6	Confident	80 Å²	80	82.6 Å²	82.6	43%	0.428	43%	0.432	S	S	.	.	T	Hydrogen-bonded Turn	trans	-84.6	-18.5	177.1	-71.6	-29.2	0	0	0	112.5	D52 Q56 K57 V58	D52-D54 PolarHBondContact O-N 2.94Å; D52-D54 PolarHBondContact OD1-N 2.98Å; D54-Q56 PolarHBondContact O-N 3.38Å; D54-K57 PolarHBondContact O-N 3.25Å; D54-K57 IonicContact OD1-NZ 2.77Å; D54-K57 PolarHBondContact OD1-NZ 3.44Å; D54-V58 WeakPolarHBondContact O-CG2 3.43Å; D54-V58 PolarHBondContact O-N 2.97Å
55	T	61.3	Low	71.8	Confident	20 Å²	20	90.3 Å²	90.3	12%	0.123	45%	0.454	C	S	.	.	T	Hydrogen-bonded Turn	trans	-56.7	-31.7	173.2	-57.6	0	0	0	0	112.7	W49 D52 K57	W49-T55 HydrophobicContact CD2-CG2 3.96Å; W49-T55 HydrophobicContact CG-CG2 4.42Å; W49-T55 HydrophobicContact CH2-CG2 4.11Å; W49-T55 HydrophobicContact CZ2-CG2 3.42Å; W49-T55 VanDerWaalsContact CZ2-CG2 3.42Å; W49-T55 PolarHBondContact O-OG1 3.25Å; D52-T55 WeakPolarHBondContact CB-OG1 3.23Å; D52-T55 VanDerWaalsContact O-CB 3.3Å; D52-T55 WeakPolarHBondContact O-CB 3.34Å; D52-T55 PolarHBondContact O-N 3.44Å; D52-T55 PolarHBondContact O-OG1 3.27Å; T55-K57 VanDerWaalsContact C-N 3.35Å
56	Q	58.6	Low	71.2	Confident	184 Å²	184	95.4 Å²	95.4	86%	0.86	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79	-15.8	178.1	-65.1	-168.5	-2.2	0	0	113.9	D54	D54-Q56 PolarHBondContact O-N 3.38Å
57	K	62.4	Low	70.9	Confident	155 Å²	155	95.5 Å²	95.5	67%	0.674	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.4	-22.4	-174.5	-59.9	179.1	-164.6	151.6	0	113	D54 T55	D54-K57 PolarHBondContact O-N 3.25Å; D54-K57 IonicContact OD1-NZ 2.77Å; D54-K57 PolarHBondContact OD1-NZ 3.44Å; T55-K57 VanDerWaalsContact C-N 3.35Å
58	V	68.5	Low	70.6	Confident	70 Å²	70	91 Å²	91	42%	0.424	47%	0.467	S	S	.	.	S	Bend	trans	-106.9	151.7	-178.7	-65.7	0	0	0	0	111.6	D54	D54-V58 WeakPolarHBondContact O-CG2 3.43Å; D54-V58 PolarHBondContact O-N 2.97Å
59	S	74.2	Confident	70.4	Confident	83 Å²	83	91.5 Å²	91.5	58%	0.58	47%	0.465	S	S	*	.			trans	-58.2	146.5	173.9	-176.3	0	0	0	0	110.9	L61 S62 S63	S59-L61 VanDerWaalsContact C-N 3.26Å; S59-L61 PolarHBondContact O-N 3.44Å; S59-L61 VanDerWaalsContact O-N 3.15Å; S59-S62 WeakPolarHBondContact O-CA 3.34Å; S59-S62 WeakPolarHBondContact O-CB 3.28Å; S59-S62 PolarHBondContact O-N 2.97Å; S59-S63 PolarHBondContact O-N 2.95Å
60	F	67.6	Low	70.4	Confident	124 Å²	124	90.6 Å²	90.6	54%	0.544	46%	0.462	S	S	.	.	H	α-helix	trans	-50.9	-42.1	-175.8	178.9	-108.3	0	0	0	113.4	W49 S63 L64	W49-F60 HydrophobicContact CH2-CD2 4.09Å; W49-F60 AromaticContact CH2-CE2 3.87Å; W49-F60 HydrophobicContact CH2-CE2 3.87Å; W49-F60 AromaticContact CZ2-CD2 3.92Å; W49-F60 HydrophobicContact CZ2-CD2 3.92Å; W49-F60 AromaticContact CZ2-CE2 3.92Å; W49-F60 HydrophobicContact CZ2-CE2 3.92Å; F60-S63 PolarHBondContact O-N 3.29Å; F60-L64 HydrophobicContact CD1-CD1 3.66Å; F60-L64 HydrophobicContact CE1-CD1 3.31Å; F60-L64 HydrophobicContact CE1-CG 4.37Å; F60-L64 HydrophobicContact CE2-CD1 4.28Å; F60-L64 HydrophobicContact CG-CD1 4.3Å; F60-L64 HydrophobicContact CZ-CD1 3.65Å; F60-L64 HydrophobicContact CZ-CG 4.31Å; F60-L64 WeakPolarHBondContact O-CG 3.28Å; F60-L64 PolarHBondContact O-N 3.47Å
61	L	67.9	Low	70.6	Confident	120 Å²	120	86.1 Å²	86.1	63%	0.628	44%	0.44	S	S	*	.	H	α-helix	trans	-67.1	-39	177.3	-69.6	173.1	0	0	0	112.2	S59 S63 L64 W65	S59-L61 VanDerWaalsContact C-N 3.26Å; S59-L61 PolarHBondContact O-N 3.44Å; S59-L61 VanDerWaalsContact O-N 3.15Å; L61-S63 VanDerWaalsContact C-N 3.35Å; L61-L64 HydrophobicContact CD2-CD1 4.35Å; L61-L64 PolarHBondContact O-N 3.47Å; L61-W65 VanDerWaalsContact O-CD1 3.31Å; L61-W65 PolarHBondContact O-N 2.99Å
62	S	66.9	Low	70.9	Confident	71 Å²	71	86.1 Å²	86.1	50%	0.497	44%	0.44	S	S	.	.	H	α-helix	trans	-67.5	-37.4	176.1	-56.5	0	0	0	0	111.6	S59 W65 N66	S59-S62 WeakPolarHBondContact O-CA 3.34Å; S59-S62 WeakPolarHBondContact O-CB 3.28Å; S59-S62 PolarHBondContact O-N 2.97Å; S62-W65 PolarHBondContact O-N 3.46Å; S62-N66 PolarHBondContact O-N 3.44Å; S62-N66 VanDerWaalsContact O-N 3.16Å
63	S	70.1	Confident	71.3	Confident	2 Å²	2	84.7 Å²	84.7	1%	0.014	43%	0.434	C	S	.	.	H	α-helix	trans	-65.9	-42.1	174.3	-170.7	0	0	0	0	112.4	W49 S59 F60 L61 W65 N66 H67	W49-S63 PolarHBondContact NE1-OG 2.97Å; S59-S63 PolarHBondContact O-N 2.95Å; F60-S63 PolarHBondContact O-N 3.29Å; L61-S63 VanDerWaalsContact C-N 3.35Å; S63-W65 VanDerWaalsContact C-N 3.27Å; S63-W65 PolarHBondContact O-N 3.28Å; S63-N66 WeakPolarHBondContact O-CB 3.41Å; S63-N66 PolarHBondContact O-N 3.26Å; S63-H67 PolarHBondContact O-CD2 3.17Å; S63-H67 VanDerWaalsContact O-CD2 3.32Å; S63-H67 PolarHBondContact O-N 2.77Å; S63-H67 VanDerWaalsContact O-N 3.11Å
64	L	69.7	Low	72.1	Confident	32 Å²	32	82.6 Å²	82.6	17%	0.168	42%	0.42	C	S	.	.	H	α-helix	trans	-58.4	-37.7	174.2	-83.1	159.6	0	0	0	112.6	F60 L61 N66 F70 T71	F60-L64 HydrophobicContact CD1-CD1 3.66Å; F60-L64 HydrophobicContact CE1-CD1 3.31Å; F60-L64 HydrophobicContact CE1-CG 4.37Å; F60-L64 HydrophobicContact CE2-CD1 4.28Å; F60-L64 HydrophobicContact CG-CD1 4.3Å; F60-L64 HydrophobicContact CZ-CD1 3.65Å; F60-L64 HydrophobicContact CZ-CG 4.31Å; F60-L64 WeakPolarHBondContact O-CG 3.28Å; F60-L64 PolarHBondContact O-N 3.47Å; L61-L64 HydrophobicContact CD2-CD1 4.35Å; L61-L64 PolarHBondContact O-N 3.47Å; L64-N66 VanDerWaalsContact C-N 3.33Å; L64-F70 HydrophobicContact CD2-CD1 4.04Å; L64-F70 HydrophobicContact CD2-CE1 3.98Å; L64-T71 HydrophobicContact CD2-CG2 4.5Å; L64-T71 WeakPolarHBondContact CD2-OG1 3.46Å; L64-T71 PolarHBondContact O-OG1 2.94Å
65	W	69	Low	73.1	Confident	229 Å²	229	83.7 Å²	83.7	87%	0.867	43%	0.425	S	S	*	.	H	α-helix	trans	-68.6	-31.5	174	-88.9	84.7	0	0	0	112.9	L61 S62 S63	L61-W65 VanDerWaalsContact O-CD1 3.31Å; L61-W65 PolarHBondContact O-N 2.99Å; S62-W65 PolarHBondContact O-N 3.46Å; S63-W65 VanDerWaalsContact C-N 3.27Å; S63-W65 PolarHBondContact O-N 3.28Å
66	N	72.2	Confident	74.3	Confident	111 Å²	111	85.3 Å²	85.3	59%	0.594	44%	0.435	S	S	*	.	H	α-helix	trans	-76.1	-23.2	179.6	-157.4	53.5	0	0	0	113.3	S62 S63 L64 P68	S62-N66 PolarHBondContact O-N 3.44Å; S62-N66 VanDerWaalsContact O-N 3.16Å; S63-N66 WeakPolarHBondContact O-CB 3.41Å; S63-N66 PolarHBondContact O-N 3.26Å; L64-N66 VanDerWaalsContact C-N 3.33Å; N66-P68 WeakPolarHBondContact O-CD 3.28Å
67	H	76.1	Confident	75.5	Confident	36 Å²	36	79.6 Å²	79.6	17%	0.167	41%	0.41	C	S	.	.			trans	-114.4	72.6	178	-62.4	-82.6	0	0	0	112.1	W49 D52 S63 F69 F70 T71	W49-H67 AromaticContact CD1-CD2 3.43Å; W49-H67 VanDerWaalsContact CD1-CD2 3.43Å; W49-H67 AromaticContact CD1-CG 3.82Å; D52-H67 IonicContact OD2-CE1 3.12Å; D52-H67 PolarHBondContact OD2-CE1 3.11Å; D52-H67 IonicContact OD2-NE2 3.34Å; D52-H67 PolarHBondContact OD2-NE2 3.3Å; S63-H67 PolarHBondContact O-CD2 3.17Å; S63-H67 VanDerWaalsContact O-CD2 3.32Å; S63-H67 PolarHBondContact O-N 2.77Å; S63-H67 VanDerWaalsContact O-N 3.11Å; H67-F69 PolarHBondContact O-N 3.04Å; H67-F69 VanDerWaalsContact O-N 3.17Å; H67-F70 HydrophobicContact CB-CB 4.3Å; H67-F70 PolarHBondContact O-N 3.24Å; H67-F70 VanDerWaalsContact O-N 3.17Å; H67-T71 PolarHBondContact O-N 3.27Å; H67-T71 VanDerWaalsContact O-N 3.15Å; H67-T71 PolarHBondContact O-OG1 3.01Å
68	P	75.1	Confident	76.7	Confident	75 Å²	75	76.2 Å²	76.2	49%	0.487	40%	0.399	S	S	.	.	H	α-helix	trans	-60.8	-30.2	-175.8	24.1	-34.2	0	0	0	112.9	N66 T71 I72	N66-P68 WeakPolarHBondContact O-CD 3.28Å; P68-T71 PolarHBondContact O-N 3.09Å; P68-I72 HydrophobicContact CB-CD1 4.43Å; P68-I72 VanDerWaalsContact O-CB 3.29Å; P68-I72 WeakPolarHBondContact O-CB 3.11Å; P68-I72 WeakPolarHBondContact O-CD1 3.32Å; P68-I72 WeakPolarHBondContact O-CG1 3.36Å; P68-I72 PolarHBondContact O-N 3.1Å
69	F	76.6	Confident	77.6	Confident	118 Å²	118	75.6 Å²	75.6	52%	0.518	40%	0.401	S	S	.	.	H	α-helix	trans	-64.6	-42	178.3	-168.8	-96.7	0	0	0	112.7	C41 H67 S73	C41-F69 HydrophobicContact CB-CE1 4.14Å; C41-F69 HydrophobicContact CB-CZ 4.08Å; H67-F69 PolarHBondContact O-N 3.04Å; H67-F69 VanDerWaalsContact O-N 3.17Å; F69-S73 WeakPolarHBondContact O-CB 3.34Å; F69-S73 PolarHBondContact O-N 3.35Å; F69-S73 PolarHBondContact O-OG 3.23Å
70	F	78	Confident	78.2	Confident	28 Å²	28	72.6 Å²	72.6	12%	0.123	38%	0.378	C	S	.	.	H	α-helix	trans	-69.1	-46.5	176.1	174.4	-113.8	0	0	0	110.7	T42 A46 W49 L64 H67 I72 S73 C74	T42-F70 HydrophobicContact CG2-CE2 4.33Å; A46-F70 HydrophobicContact CB-CD2 4.12Å; A46-F70 HydrophobicContact CB-CE2 3.73Å; W49-F70 HydrophobicContact CG-CD1 4.41Å; L64-F70 HydrophobicContact CD2-CD1 4.04Å; L64-F70 HydrophobicContact CD2-CE1 3.98Å; H67-F70 HydrophobicContact CB-CB 4.3Å; H67-F70 PolarHBondContact O-N 3.24Å; H67-F70 VanDerWaalsContact O-N 3.17Å; F70-I72 PolarHBondContact O-N 3.01Å; F70-S73 PolarHBondContact O-N 2.87Å; F70-C74 VanDerWaalsContact O-CB 3.31Å; F70-C74 WeakPolarHBondContact O-CB 3.4Å; F70-C74 PolarHBondContact O-N 3.48Å
71	T	82.1	Confident	79	Confident	34 Å²	34	74.1 Å²	74.1	21%	0.209	39%	0.385	C	S	.	.	H	α-helix	trans	-62.8	-45.4	-178.7	-59.3	0	0	0	0	112.3	L64 H67 P68 C74 I75	L64-T71 HydrophobicContact CD2-CG2 4.5Å; L64-T71 WeakPolarHBondContact CD2-OG1 3.46Å; L64-T71 PolarHBondContact O-OG1 2.94Å; H67-T71 PolarHBondContact O-N 3.27Å; H67-T71 VanDerWaalsContact O-N 3.15Å; H67-T71 PolarHBondContact O-OG1 3.01Å; P68-T71 PolarHBondContact O-N 3.09Å; T71-C74 PolarHBondContact O-N 2.91Å; T71-I75 HydrophobicContact CG2-CD1 3.84Å; T71-I75 WeakPolarHBondContact O-CB 3.38Å; T71-I75 VanDerWaalsContact O-CG1 3.25Å; T71-I75 WeakPolarHBondContact O-CG1 3.39Å; T71-I75 PolarHBondContact O-N 2.87Å
72	I	84.2	Confident	79.9	Confident	105 Å²	105	76.6 Å²	76.6	54%	0.538	39%	0.391	S	S	.	.	H	α-helix	trans	-63.9	-42.9	177	-67.9	165.2	0	0	0	111.2	P68 F70 C74 I75 T76	P68-I72 HydrophobicContact CB-CD1 4.43Å; P68-I72 VanDerWaalsContact O-CB 3.29Å; P68-I72 WeakPolarHBondContact O-CB 3.11Å; P68-I72 WeakPolarHBondContact O-CD1 3.32Å; P68-I72 WeakPolarHBondContact O-CG1 3.36Å; P68-I72 PolarHBondContact O-N 3.1Å; F70-I72 PolarHBondContact O-N 3.01Å; I72-C74 VanDerWaalsContact C-N 3.33Å; I72-C74 PolarHBondContact O-N 3.45Å; I72-I75 PolarHBondContact O-N 3.32Å; I72-T76 VanDerWaalsContact O-CB 3.32Å; I72-T76 WeakPolarHBondContact O-CB 3.42Å; I72-T76 PolarHBondContact O-N 3.4Å; I72-T76 PolarHBondContact O-OG1 3.27Å
73	S	84.6	Confident	80.6	Confident	13 Å²	13	75.7 Å²	75.7	9%	0.091	39%	0.388	C	S	.	.	H	α-helix	trans	-64.3	-40.2	178.2	-57.1	0	0	0	0	111.3	T42 F69 F70 T76 L77	T42-S73 WeakPolarHBondContact OG1-CB 3.28Å; F69-S73 WeakPolarHBondContact O-CB 3.34Å; F69-S73 PolarHBondContact O-N 3.35Å; F69-S73 PolarHBondContact O-OG 3.23Å; F70-S73 PolarHBondContact O-N 2.87Å; S73-T76 PolarHBondContact O-N 2.93Å; S73-L77 WeakPolarHBondContact O-CB 3.37Å; S73-L77 PolarHBondContact O-N 3.46Å
74	C	83.4	Confident	81.2	Confident	44 Å²	44	76.9 Å²	76.9	30%	0.297	40%	0.4	S	S	.	.	H	α-helix	trans	-66.8	-45.5	177.1	-156.6	0	0	0	0	111.9	F70 T71 I72 T76 L77 I78	F70-C74 VanDerWaalsContact O-CB 3.31Å; F70-C74 WeakPolarHBondContact O-CB 3.4Å; F70-C74 PolarHBondContact O-N 3.48Å; T71-C74 PolarHBondContact O-N 2.91Å; I72-C74 VanDerWaalsContact C-N 3.33Å; I72-C74 PolarHBondContact O-N 3.45Å; C74-T76 VanDerWaalsContact C-N 3.32Å; C74-T76 PolarHBondContact O-N 2.87Å; C74-L77 PolarHBondContact O-N 3.39Å; C74-I78 VanDerWaalsContact O-CG1 3.29Å; C74-I78 WeakPolarHBondContact O-CG1 3.42Å; C74-I78 PolarHBondContact O-N 3.37Å
75	I	86.5	Confident	81.9	Confident	103 Å²	103	75.9 Å²	75.9	53%	0.528	40%	0.395	S	S	.	.	H	α-helix	trans	-61.3	-42.4	175	-69.1	167.5	0	0	0	110.8	T71 I72 L77 I78 A79	T71-I75 HydrophobicContact CG2-CD1 3.84Å; T71-I75 WeakPolarHBondContact O-CB 3.38Å; T71-I75 VanDerWaalsContact O-CG1 3.25Å; T71-I75 WeakPolarHBondContact O-CG1 3.39Å; T71-I75 PolarHBondContact O-N 2.87Å; I72-I75 PolarHBondContact O-N 3.32Å; I75-L77 VanDerWaalsContact C-N 3.33Å; I75-L77 PolarHBondContact O-N 2.96Å; I75-I78 PolarHBondContact O-N 3.32Å; I75-A79 WeakPolarHBondContact O-CB 3.24Å; I75-A79 PolarHBondContact O-N 3.01Å
76	T	85.6	Confident	82.3	Confident	55 Å²	55	71.5 Å²	71.5	34%	0.337	38%	0.384	S	S	.	.	H	α-helix	trans	-62.6	-43	177.7	-57.4	0	0	0	0	110.6	V38 I72 S73 C74 A79 L80	V38-T76 HydrophobicContact CG1-CG2 4.32Å; V38-T76 HydrophobicContact CG2-CG2 4.03Å; I72-T76 VanDerWaalsContact O-CB 3.32Å; I72-T76 WeakPolarHBondContact O-CB 3.42Å; I72-T76 PolarHBondContact O-N 3.4Å; I72-T76 PolarHBondContact O-OG1 3.27Å; S73-T76 PolarHBondContact O-N 2.93Å; C74-T76 VanDerWaalsContact C-N 3.32Å; C74-T76 PolarHBondContact O-N 2.87Å; T76-A79 PolarHBondContact O-N 2.66Å; T76-L80 HydrophobicContact CG2-CD1 4.12Å; T76-L80 HydrophobicContact CG2-CG 4.43Å; T76-L80 WeakPolarHBondContact O-CB 3.14Å; T76-L80 VanDerWaalsContact O-CG 3.22Å; T76-L80 WeakPolarHBondContact O-CG 3.37Å; T76-L80 PolarHBondContact O-N 3.3Å
77	L	85.3	Confident	82.5	Confident	63 Å²	63	74.3 Å²	74.3	33%	0.33	39%	0.391	S	S	.	.	H	α-helix	trans	-63.7	-42.1	177.6	-164.4	146.7	0	0	0	111.7	V38 S73 C74 I75 L80 F81	V38-L77 HydrophobicContact CG1-CB 3.97Å; V38-L77 HydrophobicContact CG1-CD1 4.26Å; V38-L77 HydrophobicContact CG1-CG 4.44Å; S73-L77 WeakPolarHBondContact O-CB 3.37Å; S73-L77 PolarHBondContact O-N 3.46Å; C74-L77 PolarHBondContact O-N 3.39Å; I75-L77 VanDerWaalsContact C-N 3.33Å; I75-L77 PolarHBondContact O-N 2.96Å; L77-L80 PolarHBondContact O-N 2.93Å; L77-F81 WeakPolarHBondContact O-CB 3.28Å; L77-F81 PolarHBondContact O-N 2.92Å
78	I	87.2	Confident	82.6	Confident	85 Å²	85	78.3 Å²	78.3	44%	0.436	41%	0.405	S	S	.	.	H	α-helix	trans	-61.9	-47.3	174	-68.1	166.3	0	0	0	110.7	C74 I75 L80 F81 F82	C74-I78 VanDerWaalsContact O-CG1 3.29Å; C74-I78 WeakPolarHBondContact O-CG1 3.42Å; C74-I78 PolarHBondContact O-N 3.37Å; I75-I78 PolarHBondContact O-N 3.32Å; I78-L80 VanDerWaalsContact C-N 3.34Å; I78-L80 PolarHBondContact O-N 3.03Å; I78-F81 WeakPolarHBondContact O-CB 3.45Å; I78-F81 PolarHBondContact O-N 3.28Å; I78-F81 VanDerWaalsContact O-N 3.13Å; I78-F82 HydrophobicContact CG2-CD2 3.68Å; I78-F82 HydrophobicContact CG2-CE2 3.58Å; I78-F82 VanDerWaalsContact O-CD2 3.27Å; I78-F82 WeakPolarHBondContact O-CD2 3.49Å; I78-F82 PolarHBondContact O-N 3.44Å
79	A	86.9	Confident	82.8	Confident	57 Å²	57	75.5 Å²	75.5	47%	0.471	39%	0.386	S	S	.	.	H	α-helix	trans	-61.1	-42	178.2	0	0	0	0	0	112.1	I75 T76 F81 F82 A83	I75-A79 WeakPolarHBondContact O-CB 3.24Å; I75-A79 PolarHBondContact O-N 3.01Å; T76-A79 PolarHBondContact O-N 2.66Å; A79-F81 VanDerWaalsContact C-N 3.3Å; A79-F81 PolarHBondContact O-N 2.87Å; A79-F82 PolarHBondContact O-N 3.39Å; A79-A83 VanDerWaalsContact O-CB 3.28Å; A79-A83 WeakPolarHBondContact O-CB 3.3Å; A79-A83 PolarHBondContact O-N 2.94Å
80	L	86.1	Confident	82.9	Confident	20 Å²	20	71.8 Å²	71.8	11%	0.105	37%	0.373	C	S	.	.	H	α-helix	trans	-63.9	-36	175.1	-70	172	0	0	0	112	W31 I34 L35 V38 T76 L77 I78 A83 G84 I85	W31-L80 HydrophobicContact CE3-CD2 4.42Å; W31-L80 HydrophobicContact CZ3-CD2 3.79Å; I34-L80 HydrophobicContact CG2-CD1 3.96Å; I34-L80 HydrophobicContact CG2-CD2 4.35Å; L35-L80 HydrophobicContact CD2-CD1 4.49Å; V38-L80 HydrophobicContact CB-CD1 4.41Å; V38-L80 HydrophobicContact CG1-CD1 4.38Å; V38-L80 HydrophobicContact CG2-CD1 4.02Å; T76-L80 HydrophobicContact CG2-CD1 4.12Å; T76-L80 HydrophobicContact CG2-CG 4.43Å; T76-L80 WeakPolarHBondContact O-CB 3.14Å; T76-L80 VanDerWaalsContact O-CG 3.22Å; T76-L80 WeakPolarHBondContact O-CG 3.37Å; T76-L80 PolarHBondContact O-N 3.3Å; L77-L80 PolarHBondContact O-N 2.93Å; I78-L80 VanDerWaalsContact C-N 3.34Å; I78-L80 PolarHBondContact O-N 3.03Å; L80-A83 PolarHBondContact O-N 3.42Å; L80-G84 PolarHBondContact O-N 3.42Å; L80-I85 HydrophobicContact CB-CD1 4.15Å; L80-I85 HydrophobicContact CB-CG2 4.46Å; L80-I85 HydrophobicContact CD1-CD1 4.43Å; L80-I85 HydrophobicContact CD2-CD1 3.93Å; L80-I85 HydrophobicContact CG-CD1 4.39Å; L80-I85 WeakPolarHBondContact O-CB 3.29Å; L80-I85 VanDerWaalsContact O-CG2 3.3Å; L80-I85 WeakPolarHBondContact O-CG2 3.34Å; L80-I85 PolarHBondContact O-N 3.17Å
81	F	86	Confident	83	Confident	155 Å²	155	72 Å²	72	68%	0.68	38%	0.38	S	S	*	.	H	α-helix	trans	-63.7	-49.8	175.3	-168.6	-97.6	0	0	0	111.4	L77 I78 A79 A83 G84	L77-F81 WeakPolarHBondContact O-CB 3.28Å; L77-F81 PolarHBondContact O-N 2.92Å; I78-F81 WeakPolarHBondContact O-CB 3.45Å; I78-F81 PolarHBondContact O-N 3.28Å; I78-F81 VanDerWaalsContact O-N 3.13Å; A79-F81 VanDerWaalsContact C-N 3.3Å; A79-F81 PolarHBondContact O-N 2.87Å; F81-A83 VanDerWaalsContact C-N 3.34Å; F81-A83 PolarHBondContact O-N 3.27Å; F81-G84 PolarHBondContact O-N 2.97Å
82	F	85.4	Confident	82.7	Confident	172 Å²	172	70.9 Å²	70.9	75%	0.754	37%	0.373	S	S	*	.	H	α-helix	trans	-65.3	-33.9	176.2	-78.8	-72.3	0	0	0	113.2	I78 A79 G84	I78-F82 HydrophobicContact CG2-CD2 3.68Å; I78-F82 HydrophobicContact CG2-CE2 3.58Å; I78-F82 VanDerWaalsContact O-CD2 3.27Å; I78-F82 WeakPolarHBondContact O-CD2 3.49Å; I78-F82 PolarHBondContact O-N 3.44Å; A79-F82 PolarHBondContact O-N 3.39Å; F82-G84 PolarHBondContact O-N 3.48Å
83	A	83.2	Confident	82.4	Confident	52 Å²	52	67.9 Å²	67.9	43%	0.43	36%	0.361	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67	-1.3	173.2	0	0	0	0	0	113.6	A79 L80 F81	A79-A83 VanDerWaalsContact O-CB 3.28Å; A79-A83 WeakPolarHBondContact O-CB 3.3Å; A79-A83 PolarHBondContact O-N 2.94Å; L80-A83 PolarHBondContact O-N 3.42Å; F81-A83 VanDerWaalsContact C-N 3.34Å; F81-A83 PolarHBondContact O-N 3.27Å
84	G	82.1	Confident	82.4	Confident	27 Å²	27	71.1 Å²	71.1	28%	0.278	38%	0.377	S	S	.	.	T	Hydrogen-bonded Turn	trans	74.2	35.2	172.6	0	0	0	0	0	112.8	L80 F81 F82 H86 K87 R88	L80-G84 PolarHBondContact O-N 3.42Å; F81-G84 PolarHBondContact O-N 2.97Å; F82-G84 PolarHBondContact O-N 3.48Å; G84-H86 PolarHBondContact O-N 2.74Å; G84-H86 VanDerWaalsContact O-N 3.12Å; G84-K87 PolarHBondContact O-N 2.81Å; G84-R88 PolarHBondContact O-N 2.89Å
85	I	83.3	Confident	82.4	Confident	11 Å²	11	71 Å²	71	6%	0.056	37%	0.373	C	S	.	.	H	α-helix	trans	-55.7	-31.6	-177.4	-163.1	152.4	0	0	0	113.2	W31 L35 L80 K87 R88 V89	W31-I85 HydrophobicContact CB-CD1 4.41Å; W31-I85 HydrophobicContact CB-CG1 4.33Å; W31-I85 HydrophobicContact CD2-CD1 4.34Å; W31-I85 HydrophobicContact CE3-CD1 3.48Å; W31-I85 VanDerWaalsContact CE3-CD1 3.48Å; W31-I85 HydrophobicContact CE3-CG1 4.07Å; W31-I85 HydrophobicContact CZ3-CD1 4.13Å; L35-I85 HydrophobicContact CD1-CD1 3.89Å; L35-I85 HydrophobicContact CD1-CG1 3.81Å; L35-I85 HydrophobicContact CD1-CG2 4.21Å; L35-I85 HydrophobicContact CD2-CD1 3.65Å; L35-I85 HydrophobicContact CD2-CG1 4.26Å; L35-I85 HydrophobicContact CD2-CG2 4.01Å; L35-I85 HydrophobicContact CG-CD1 3.43Å; L35-I85 VanDerWaalsContact CG-CD1 3.43Å; L35-I85 HydrophobicContact CG-CG1 3.95Å; L35-I85 HydrophobicContact CG-CG2 4.5Å; L80-I85 HydrophobicContact CB-CD1 4.15Å; L80-I85 HydrophobicContact CB-CG2 4.46Å; L80-I85 HydrophobicContact CD1-CD1 4.43Å; L80-I85 HydrophobicContact CD2-CD1 3.93Å; L80-I85 HydrophobicContact CG-CD1 4.39Å; L80-I85 WeakPolarHBondContact O-CB 3.29Å; L80-I85 VanDerWaalsContact O-CG2 3.3Å; L80-I85 WeakPolarHBondContact O-CG2 3.34Å; L80-I85 PolarHBondContact O-N 3.17Å; I85-K87 VanDerWaalsContact C-N 3.29Å; I85-K87 PolarHBondContact O-N 3Å; I85-R88 PolarHBondContact O-N 3.17Å; I85-V89 HydrophobicContact CG1-CG1 4.07Å; I85-V89 WeakPolarHBondContact O-CG2 3.36Å; I85-V89 PolarHBondContact O-N 3.32Å
86	H	77.9	Confident	82.3	Confident	137 Å²	137	66.1 Å²	66.1	63%	0.634	35%	0.348	S	S	*	.	H	α-helix	trans	-56	-41.8	174.3	-170.1	-88.2	0	0	0	112	G84 V90	G84-H86 PolarHBondContact O-N 2.74Å; G84-H86 VanDerWaalsContact O-N 3.12Å; H86-V90 WeakPolarHBondContact O-CB 3.48Å; H86-V90 WeakPolarHBondContact O-CG2 3.18Å; H86-V90 PolarHBondContact O-N 3.5Å
87	K	76.4	Confident	82.3	Confident	171 Å²	171	65.6 Å²	65.6	74%	0.743	35%	0.349	S	S	*	.	H	α-helix	trans	-68.6	-37.3	175.7	-65	-159.7	-179	-175.9	0	111.6	G84 I85 A91	G84-K87 PolarHBondContact O-N 2.81Å; I85-K87 VanDerWaalsContact C-N 3.29Å; I85-K87 PolarHBondContact O-N 3Å; K87-A91 VanDerWaalsContact O-CB 3.3Å; K87-A91 WeakPolarHBondContact O-CB 3.31Å; K87-A91 PolarHBondContact O-N 3.48Å
88	R	77.9	Confident	82.3	Confident	119 Å²	119	71.3 Å²	71.3	45%	0.449	37%	0.366	S	S	.	.	H	α-helix	trans	-70.4	-33.5	-177.8	-60.3	-175.4	-178.2	-137.9	-4.4	113.2	T28 W31 G84 I85	T28-R88 PolarHBondContact OG1-O 2.81Å; W31-R88 HydrophobicContact CG-CB 4.27Å; G84-R88 PolarHBondContact O-N 2.89Å; I85-R88 PolarHBondContact O-N 3.17Å
89	V	79.5	Confident	82.2	Confident	17 Å²	17	68.5 Å²	68.5	10%	0.103	35%	0.354	C	S	.	.	H	α-helix	trans	-87.5	-16.7	-179.6	-59.5	0	0	0	0	114.3	T28 W31 R32 L35 I85	T28-V89 VanDerWaalsContact CG2-O 3.28Å; T28-V89 WeakPolarHBondContact CG2-O 3.33Å; W31-V89 HydrophobicContact CB-CG1 3.66Å; R32-V89 HydrophobicContact CG-CB 4Å; R32-V89 HydrophobicContact CG-CG1 3.87Å; R32-V89 PolarHBondContact NE-O 3.17Å; R32-V89 PolarHBondContact NH2-O 3.2Å; L35-V89 HydrophobicContact CD1-CG1 4.03Å; I85-V89 HydrophobicContact CG1-CG1 4.07Å; I85-V89 WeakPolarHBondContact O-CG2 3.36Å; I85-V89 PolarHBondContact O-N 3.32Å
90	V	78.9	Confident	82.3	Confident	40 Å²	40	69.1 Å²	69.1	24%	0.242	34%	0.344	C	S	.	.	H	α-helix	trans	-108.2	-13	-177.3	-167.9	0	0	0	0	112.4	H86 S93 I94	H86-V90 WeakPolarHBondContact O-CB 3.48Å; H86-V90 WeakPolarHBondContact O-CG2 3.18Å; H86-V90 PolarHBondContact O-N 3.5Å; V90-S93 WeakPolarHBondContact CA-OG 3.22Å; V90-S93 PolarHBondContact O-N 3.41Å; V90-S93 PolarHBondContact O-OG 2.97Å; V90-I94 HydrophobicContact CB-CD1 4.08Å; V90-I94 HydrophobicContact CG1-CD1 3.64Å; V90-I94 HydrophobicContact CG1-CG1 3.82Å; V90-I94 WeakPolarHBondContact O-CG1 3.47Å; V90-I94 PolarHBondContact O-N 3.34Å
91	A	79.4	Confident	82.4	Confident	32 Å²	32	72.5 Å²	72.5	26%	0.264	37%	0.365	S	S	.	.	H	α-helix	trans	-52.1	-48.6	-179.2	0	0	0	0	0	114.7	K87 S93 I94 I95	K87-A91 VanDerWaalsContact O-CB 3.3Å; K87-A91 WeakPolarHBondContact O-CB 3.31Å; K87-A91 PolarHBondContact O-N 3.48Å; A91-S93 PolarHBondContact O-N 2.93Å; A91-I94 PolarHBondContact O-N 3.4Å; A91-I95 WeakPolarHBondContact O-CD1 3.32Å; A91-I95 WeakPolarHBondContact O-CG1 3.3Å; A91-I95 PolarHBondContact O-N 3.23Å
92	P	76.5	Confident	82.4	Confident	10 Å²	10	69.2 Å²	69.2	7%	0.065	36%	0.358	C	S	.	.	H	α-helix	trans	-64.2	-42.3	-179.9	-17.1	29	0	0	0	112.4	L24 T28 I94 I95 A96	L24-P92 HydrophobicContact CB-CG 4.17Å; T28-P92 HydrophobicContact CG2-CG 3.83Å; T28-P92 WeakPolarHBondContact OG1-CD 3.37Å; T28-P92 WeakPolarHBondContact OG1-CG 3.35Å; P92-I94 VanDerWaalsContact C-N 3.32Å; P92-I94 PolarHBondContact O-N 3.47Å; P92-I95 PolarHBondContact O-N 3.31Å; P92-A96 PolarHBondContact O-N 2.89Å
93	S	78.4	Confident	82.4	Confident	42 Å²	42	61.6 Å²	61.6	29%	0.294	33%	0.325	S	S	.	.	H	α-helix	trans	-66.3	-33	177.5	43.3	0	0	0	0	112.8	V90 A91 A97	V90-S93 WeakPolarHBondContact CA-OG 3.22Å; V90-S93 PolarHBondContact O-N 3.41Å; V90-S93 PolarHBondContact O-OG 2.97Å; A91-S93 PolarHBondContact O-N 2.93Å; S93-A97 VanDerWaalsContact O-CB 3.23Å; S93-A97 WeakPolarHBondContact O-CB 3.37Å; S93-A97 PolarHBondContact O-N 3.45Å
94	I	83.5	Confident	82.6	Confident	81 Å²	81	61.2 Å²	61.2	42%	0.415	32%	0.322	S	S	.	.	H	α-helix	trans	-66.8	-47	173.9	-73.1	156.6	0	0	0	109.9	V90 A91 P92 A97 R98	V90-I94 HydrophobicContact CB-CD1 4.08Å; V90-I94 HydrophobicContact CG1-CD1 3.64Å; V90-I94 HydrophobicContact CG1-CG1 3.82Å; V90-I94 WeakPolarHBondContact O-CG1 3.47Å; V90-I94 PolarHBondContact O-N 3.34Å; A91-I94 PolarHBondContact O-N 3.4Å; P92-I94 VanDerWaalsContact C-N 3.32Å; P92-I94 PolarHBondContact O-N 3.47Å; I94-A97 PolarHBondContact O-N 3.47Å; I94-R98 HydrophobicContact CG2-CG 4.3Å; I94-R98 VanDerWaalsContact O-CG 3.28Å; I94-R98 WeakPolarHBondContact O-CG 3.45Å; I94-R98 PolarHBondContact O-N 3.46Å
95	I	83.8	Confident	82.7	Confident	43 Å²	43	67.2 Å²	67.2	22%	0.221	34%	0.343	C	S	.	.	H	α-helix	trans	-60.7	-49.6	179.8	-66.1	156.4	0	0	0	110.1	Y20 L24 A91 P92 A97 R98 C99	Y20-I95 HydrophobicContact CD1-CD1 4.47Å; Y20-I95 HydrophobicContact CD1-CG2 4.49Å; Y20-I95 HydrophobicContact CE1-CD1 3.81Å; L24-I95 HydrophobicContact CD1-CD1 3.57Å; A91-I95 WeakPolarHBondContact O-CD1 3.32Å; A91-I95 WeakPolarHBondContact O-CG1 3.3Å; A91-I95 PolarHBondContact O-N 3.23Å; P92-I95 PolarHBondContact O-N 3.31Å; I95-A97 VanDerWaalsContact C-N 3.31Å; I95-A97 PolarHBondContact O-N 3.25Å; I95-R98 PolarHBondContact O-N 3.43Å; I95-C99 PolarHBondContact O-N 2.94Å; I95-C99 PolarHBondContact O-SG 2.73Å
96	A	83.9	Confident	82.6	Confident	0 Å²	0	74 Å²	74	0%	0	37%	0.369	C	S	.	.	H	α-helix	trans	-57.5	-43.8	176.2	0	0	0	0	0	111.7	I21 P92 R98 C99 R100	I21-A96 HydrophobicContact CD1-CB 4.49Å; P92-A96 PolarHBondContact O-N 2.89Å; A96-R98 PolarHBondContact O-N 3.12Å; A96-C99 PolarHBondContact O-N 3.13Å; A96-R100 VanDerWaalsContact O-CG 3.3Å; A96-R100 WeakPolarHBondContact O-CG 3.28Å; A96-R100 PolarHBondContact O-N 2.96Å
97	A	85.6	Confident	83	Confident	43 Å²	43	71.2 Å²	71.2	36%	0.355	36%	0.358	S	S	.	.	H	α-helix	trans	-62.8	-41.5	176.9	0	0	0	0	0	113.1	S93 I94 I95 R100 T101	S93-A97 VanDerWaalsContact O-CB 3.23Å; S93-A97 WeakPolarHBondContact O-CB 3.37Å; S93-A97 PolarHBondContact O-N 3.45Å; I94-A97 PolarHBondContact O-N 3.47Å; I95-A97 VanDerWaalsContact C-N 3.31Å; I95-A97 PolarHBondContact O-N 3.25Å; A97-R100 WeakPolarHBondContact O-CB 3.32Å; A97-R100 PolarHBondContact O-N 3.26Å; A97-T101 PolarHBondContact O-N 3.12Å; A97-T101 VanDerWaalsContact O-N 3.12Å; A97-T101 PolarHBondContact O-OG1 2.79Å
98	R	86.6	Confident	83.5	Confident	183 Å²	183	64.1 Å²	64.1	69%	0.691	33%	0.328	S	S	*	.	H	α-helix	trans	-65.3	-42.2	176.4	-65.6	-62.6	-179.9	-170	-0.2	111.5	I94 I95 A96 R100 T101 V102	I94-R98 HydrophobicContact CG2-CG 4.3Å; I94-R98 VanDerWaalsContact O-CG 3.28Å; I94-R98 WeakPolarHBondContact O-CG 3.45Å; I94-R98 PolarHBondContact O-N 3.46Å; I95-R98 PolarHBondContact O-N 3.43Å; A96-R98 PolarHBondContact O-N 3.12Å; R98-R100 VanDerWaalsContact C-N 3.32Å; R98-R100 PolarHBondContact O-N 3.29Å; R98-T101 PolarHBondContact O-N 3.32Å; R98-V102 PolarHBondContact O-N 3.32Å
99	C	85.7	Confident	84	Confident	26 Å²	26	59.4 Å²	59.4	18%	0.176	31%	0.313	C	S	.	.	H	α-helix	trans	-60.2	-42.3	173.4	-70.8	0	0	0	0	111.5	L17 I95 A96 T101 V102 L103	L17-C99 HydrophobicContact CD2-CB 4.46Å; I95-C99 PolarHBondContact O-N 2.94Å; I95-C99 PolarHBondContact O-SG 2.73Å; A96-C99 PolarHBondContact O-N 3.13Å; C99-T101 VanDerWaalsContact C-N 3.31Å; C99-T101 PolarHBondContact O-N 3.04Å; C99-V102 PolarHBondContact O-N 3.05Å; C99-L103 WeakPolarHBondContact O-CB 3.3Å; C99-L103 VanDerWaalsContact O-CG 3.24Å; C99-L103 WeakPolarHBondContact O-CG 3.29Å; C99-L103 PolarHBondContact O-N 3.15Å
100	R	87.6	Confident	84.3	Confident	71 Å²	71	58.6 Å²	58.6	27%	0.268	31%	0.309	S	S	.	.	H	α-helix	trans	-59.3	-38	175.4	-72	173.7	-172.3	126.4	12.7	113.1	A96 A97 R98 A104 C110 D111 D112	A96-R100 VanDerWaalsContact O-CG 3.3Å; A96-R100 WeakPolarHBondContact O-CG 3.28Å; A96-R100 PolarHBondContact O-N 2.96Å; A97-R100 WeakPolarHBondContact O-CB 3.32Å; A97-R100 PolarHBondContact O-N 3.26Å; R98-R100 VanDerWaalsContact C-N 3.32Å; R98-R100 PolarHBondContact O-N 3.29Å; R100-A104 VanDerWaalsContact O-CB 3.27Å; R100-A104 WeakPolarHBondContact O-CB 3.35Å; R100-A104 PolarHBondContact O-N 2.66Å; R100-C110 PolarHBondContact NE-O 3.32Å; R100-C110 PolarHBondContact NH2-O 3Å; R100-D111 PolarHBondContact NH2-O 2.94Å; R100-D112 IonicContact CZ-OD1 3.35Å; R100-D112 IonicContact NH1-OD1 3.08Å; R100-D112 PolarHBondContact NH1-OD1 3.22Å; R100-D112 VanDerWaalsContact NH1-OD1 3.08Å; R100-D112 IonicContact NH2-OD1 2.7Å; R100-D112 PolarHBondContact NH2-OD1 3.34Å
101	T	88.3	Confident	84.7	Confident	90 Å²	90	58.8 Å²	58.8	55%	0.552	31%	0.308	S	S	*	.	H	α-helix	trans	-61.5	-46.2	177.8	-54.3	0	0	0	0	111.2	A97 R98 C99 A104	A97-T101 PolarHBondContact O-N 3.12Å; A97-T101 VanDerWaalsContact O-N 3.12Å; A97-T101 PolarHBondContact O-OG1 2.79Å; R98-T101 PolarHBondContact O-N 3.32Å; C99-T101 VanDerWaalsContact C-N 3.31Å; C99-T101 PolarHBondContact O-N 3.04Å; T101-A104 PolarHBondContact O-N 3Å
102	V	86.3	Confident	84.8	Confident	87 Å²	87	61.7 Å²	61.7	53%	0.527	32%	0.32	S	S	.	.	H	α-helix	trans	-69.7	-44.4	178.4	-179.8	0	0	0	0	111.1	R98 C99 A104 E105 Y106	R98-V102 PolarHBondContact O-N 3.32Å; C99-V102 PolarHBondContact O-N 3.05Å; V102-A104 PolarHBondContact O-N 3.32Å; V102-E105 PolarHBondContact O-N 3.46Å; V102-Y106 WeakPolarHBondContact O-CD2 3.48Å
103	L	86.1	Confident	85.1	Confident	11 Å²	11	64.6 Å²	64.6	6%	0.058	34%	0.337	C	S	.	.	H	α-helix	trans	-63.9	-27.7	179.1	-71.4	170.5	0	0	0	112.7	F13 C99 E105 Y106 N107 M108 C110 L116	F13-L103 HydrophobicContact CE1-CD2 4.26Å; C99-L103 WeakPolarHBondContact O-CB 3.3Å; C99-L103 VanDerWaalsContact O-CG 3.24Å; C99-L103 WeakPolarHBondContact O-CG 3.29Å; C99-L103 PolarHBondContact O-N 3.15Å; L103-E105 VanDerWaalsContact C-N 3.25Å; L103-E105 PolarHBondContact O-N 3.43Å; L103-Y106 PolarHBondContact O-N 3.11Å; L103-N107 PolarHBondContact O-N 2.88Å; L103-M108 CarbonylContact C-O 3.57Å; L103-M108 HydrophobicContact CB-CB 4Å; L103-M108 HydrophobicContact CD2-CB 4.14Å; L103-M108 HydrophobicContact CD2-CE 3.94Å; L103-M108 CarbonylContact O-C 3.47Å; L103-M108 WeakPolarHBondContact O-CA 3.13Å; L103-M108 PolarHBondContact O-N 3.44Å; L103-M108 VanDerWaalsContact O-O 3.06Å; L103-C110 HydrophobicContact CD1-CB 3.84Å; L103-L116 HydrophobicContact CD1-CD2 3.76Å; L103-L116 HydrophobicContact CD2-CD2 3.65Å; L103-L116 HydrophobicContact CG-CD2 4.37Å
104	A	85.9	Confident	85.3	Confident	45 Å²	45	62.6 Å²	62.6	37%	0.372	32%	0.323	S	S	.	.	H	α-helix	trans	-62.2	-32.4	178.6	0	0	0	0	0	112.6	R100 T101 V102 Y106 N107 M108	R100-A104 VanDerWaalsContact O-CB 3.27Å; R100-A104 WeakPolarHBondContact O-CB 3.35Å; R100-A104 PolarHBondContact O-N 2.66Å; T101-A104 PolarHBondContact O-N 3Å; V102-A104 PolarHBondContact O-N 3.32Å; A104-Y106 PolarHBondContact O-N 2.88Å; A104-N107 PolarHBondContact O-N 2.9Å; A104-N107 VanDerWaalsContact O-N 3.13Å; A104-M108 WeakPolarHBondContact CA-O 3.46Å; A104-M108 PolarHBondContact N-O 2.85Å
105	E	85.6	Confident	85.4	Confident	153 Å²	153	64.4 Å²	64.4	72%	0.715	33%	0.328	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62	-25.8	175.5	-62.6	-178.7	-177.2	0	0	112.1	V102 L103	V102-E105 PolarHBondContact O-N 3.46Å; L103-E105 VanDerWaalsContact C-N 3.25Å; L103-E105 PolarHBondContact O-N 3.43Å
106	Y	81.7	Confident	85.6	Confident	153 Å²	153	63.6 Å²	63.6	60%	0.6	32%	0.324	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.6	14.1	179.6	-59.3	-84.7	0	0	0	113.5	V102 L103 A104 M108	V102-Y106 WeakPolarHBondContact O-CD2 3.48Å; L103-Y106 PolarHBondContact O-N 3.11Å; A104-Y106 PolarHBondContact O-N 2.88Å; Y106-M108 VanDerWaalsContact CB-CE 3.41Å; Y106-M108 HydrophobicContact CG-CE 4.04Å; Y106-M108 PolarHBondContact O-N 2.94Å
107	N	85.1	Confident	85.6	Confident	78 Å²	78	67.6 Å²	67.6	42%	0.417	35%	0.345	S	S	.	.	T	Hydrogen-bonded Turn	trans	56.5	34	-170.8	-63.5	-66.1	0	0	0	113.3	L103 A104 K119	L103-N107 PolarHBondContact O-N 2.88Å; A104-N107 PolarHBondContact O-N 2.9Å; A104-N107 VanDerWaalsContact O-N 3.13Å; N107-K119 WeakPolarHBondContact O-CB 3.39Å; N107-K119 PolarHBondContact O-N 3.19Å
108	M	86.6	Confident	85.5	Confident	22 Å²	22	72.1 Å²	72.1	11%	0.108	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	167.5	176.1	-63.7	-173.5	-72.2	0	0	110.6	L10 L103 A104 Y106 L116 I117 L118	L10-M108 HydrophobicContact CD1-CE 3.91Å; L10-M108 HydrophobicContact CD1-SD 3.9Å; L10-M108 HydrophobicContact CD2-SD 3.9Å; L103-M108 CarbonylContact C-O 3.57Å; L103-M108 HydrophobicContact CB-CB 4Å; L103-M108 HydrophobicContact CD2-CB 4.14Å; L103-M108 HydrophobicContact CD2-CE 3.94Å; L103-M108 CarbonylContact O-C 3.47Å; L103-M108 WeakPolarHBondContact O-CA 3.13Å; L103-M108 PolarHBondContact O-N 3.44Å; L103-M108 VanDerWaalsContact O-O 3.06Å; A104-M108 WeakPolarHBondContact CA-O 3.46Å; A104-M108 PolarHBondContact N-O 2.85Å; Y106-M108 VanDerWaalsContact CB-CE 3.41Å; Y106-M108 HydrophobicContact CG-CE 4.04Å; Y106-M108 PolarHBondContact O-N 2.94Å; M108-L116 HydrophobicContact SD-CD2 4.46Å; M108-I117 CarbonylContact C-O 3.47Å; M108-I117 WeakPolarHBondContact CA-O 3.45Å; M108-L118 HydrophobicContact CG-CD2 4.02Å; M108-L118 HydrophobicContact SD-CD2 4.43Å
109	S	88.5	Confident	85.2	Confident	20 Å²	20	68.4 Å²	68.4	14%	0.14	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149	175.9	171.9	-156	0	0	0	0	109.1	L116 I117	S109-L116 CarbonylContact O-C 3.42Å; S109-L116 WeakPolarHBondContact O-CA 3.45Å; S109-I117 PolarHBondContact N-O 3.36Å; S109-I117 PolarHBondContact O-N 3.16Å
110	C	87	Confident	84.6	Confident	1 Å²	1	72.9 Å²	72.9	1%	0.007	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.2	152	170.6	66	0	0	0	0	110.5	L17 R100 L103 K115	L17-C110 HydrophobicContact CD2-CB 4.17Å; R100-C110 PolarHBondContact NE-O 3.32Å; R100-C110 PolarHBondContact NH2-O 3Å; L103-C110 HydrophobicContact CD1-CB 3.84Å; C110-K115 CarbonylContact C-O 3.17Å; C110-K115 WeakPolarHBondContact CA-O 3.44Å; C110-K115 WeakPolarHBondContact CB-O 3.47Å
111	D	86.4	Confident	83.5	Confident	43 Å²	43	80 Å²	80	23%	0.23	41%	0.407	C	S	.	.			trans	-76.9	-179.6	173.5	73.3	4.5	0	0	0	111.6	R100 T113 G114 K115 I117	R100-D111 PolarHBondContact NH2-O 2.94Å; D111-T113 PolarHBondContact O-N 3.36Å; D111-T113 VanDerWaalsContact OD1-C 3.31Å; D111-T113 VanDerWaalsContact OD1-CA 3.28Å; D111-T113 WeakPolarHBondContact OD1-CA 3.25Å; D111-T113 WeakPolarHBondContact OD1-CB 3.29Å; D111-T113 PolarHBondContact OD1-N 3.38Å; D111-T113 PolarHBondContact OD1-OG1 2.87Å; D111-T113 PolarHBondContact OD2-OG1 3.18Å; D111-G114 PolarHBondContact O-N 3.45Å; D111-G114 PolarHBondContact OD1-N 2.77Å; D111-K115 PolarHBondContact N-O 3.38Å; D111-K115 WeakPolarHBondContact OD1-CB 3.27Å; D111-K115 PolarHBondContact OD1-N 2.97Å; D111-K115 WeakPolarHBondContact OD2-CB 3.14Å; D111-I117 HydrophobicContact CB-CD1 4.28Å
112	D	82.5	Confident	82.4	Confident	94 Å²	94	80.2 Å²	80.2	50%	0.503	41%	0.409	S	S	.	.	T	Hydrogen-bonded Turn	trans	-76.6	-1	176.9	-67.5	-37.2	0	0	0	113	I21 R100	I21-D112 VanDerWaalsContact CG2-O 3.28Å; I21-D112 WeakPolarHBondContact CG2-O 3.48Å; R100-D112 IonicContact CZ-OD1 3.35Å; R100-D112 IonicContact NH1-OD1 3.08Å; R100-D112 PolarHBondContact NH1-OD1 3.22Å; R100-D112 VanDerWaalsContact NH1-OD1 3.08Å; R100-D112 IonicContact NH2-OD1 2.7Å; R100-D112 PolarHBondContact NH2-OD1 3.34Å
113	T	82.3	Confident	81	Confident	71 Å²	71	83.6 Å²	83.6	44%	0.436	42%	0.424	S	S	.	.	T	Hydrogen-bonded Turn	trans	-99	-14.4	174.9	79.8	0	0	0	0	112.6	T18 D111	T18-T113 WeakPolarHBondContact CA-O 3.39Å; D111-T113 PolarHBondContact O-N 3.36Å; D111-T113 VanDerWaalsContact OD1-C 3.31Å; D111-T113 VanDerWaalsContact OD1-CA 3.28Å; D111-T113 WeakPolarHBondContact OD1-CA 3.25Å; D111-T113 WeakPolarHBondContact OD1-CB 3.29Å; D111-T113 PolarHBondContact OD1-N 3.38Å; D111-T113 PolarHBondContact OD1-OG1 2.87Å; D111-T113 PolarHBondContact OD2-OG1 3.18Å
114	G	81.8	Confident	79.6	Confident	0 Å²	0	91.1 Å²	91.1	0%	0	46%	0.463	C	S	.	.	S	Bend	trans	102.5	1.6	-178.5	0	0	0	0	0	115	T18 D111	T18-G114 PolarHBondContact OG1-O 2.93Å; D111-G114 PolarHBondContact O-N 3.45Å; D111-G114 PolarHBondContact OD1-N 2.77Å
115	K	86.6	Confident	77.5	Confident	119 Å²	119	101.2 Å²	101.2	52%	0.517	50%	0.502	S	S	.	.			trans	-72.2	135.5	177.9	-159.6	-174.4	179.8	177.1	0	110.8	E14 C110 D111	E14-K115 WeakPolarHBondContact OE1-CG 3.34Å; C110-K115 CarbonylContact C-O 3.17Å; C110-K115 WeakPolarHBondContact CA-O 3.44Å; C110-K115 WeakPolarHBondContact CB-O 3.47Å; D111-K115 PolarHBondContact N-O 3.38Å; D111-K115 WeakPolarHBondContact OD1-CB 3.27Å; D111-K115 PolarHBondContact OD1-N 2.97Å; D111-K115 WeakPolarHBondContact OD2-CB 3.14Å
116	L	86.6	Confident	77.1	Confident	25 Å²	25	98.6 Å²	98.6	13%	0.131	49%	0.492	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.6	146.7	178.4	-75.4	132	0	0	0	112.1	L10 F13 E14 L103 M108 S109	L10-L116 HydrophobicContact CG-CD1 4.33Å; F13-L116 HydrophobicContact CD1-CD1 3.98Å; F13-L116 HydrophobicContact CD1-CD2 4.4Å; F13-L116 HydrophobicContact CE1-CD2 4.32Å; E14-L116 HydrophobicContact CB-CD1 3.38Å; E14-L116 HydrophobicContact CG-CD1 3.63Å; E14-L116 HydrophobicContact CG-CG 4.35Å; E14-L116 PolarHBondContact OE1-N 2.97Å; L103-L116 HydrophobicContact CD1-CD2 3.76Å; L103-L116 HydrophobicContact CD2-CD2 3.65Å; L103-L116 HydrophobicContact CG-CD2 4.37Å; M108-L116 HydrophobicContact SD-CD2 4.46Å; S109-L116 CarbonylContact O-C 3.42Å; S109-L116 WeakPolarHBondContact O-CA 3.45Å
117	I	85.9	Confident	76.9	Confident	85 Å²	85	95.7 Å²	95.7	44%	0.436	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	118.9	177.9	-56.4	171.7	0	0	0	107.3	M108 S109 D111	M108-I117 CarbonylContact C-O 3.47Å; M108-I117 WeakPolarHBondContact CA-O 3.45Å; S109-I117 PolarHBondContact N-O 3.36Å; S109-I117 PolarHBondContact O-N 3.16Å; D111-I117 HydrophobicContact CB-CD1 4.28Å
118	L	82.8	Confident	76.4	Confident	138 Å²	138	96.7 Å²	96.7	72%	0.723	49%	0.49	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.3	127.3	171.2	-81	145.6	0	0	0	109.3	M108	M108-L118 HydrophobicContact CG-CD2 4.02Å; M108-L118 HydrophobicContact SD-CD2 4.43Å
119	K	80.3	Confident	75.8	Confident	105 Å²	105	101.1 Å²	101.1	46%	0.457	51%	0.512	S	S	.	.	P	Polyproline II helix	trans	-82.5	142.3	171	-63.8	-174.3	178.2	179.1	0	109.1	N107	N107-K119 WeakPolarHBondContact O-CB 3.39Å; N107-K119 PolarHBondContact O-N 3.19Å
120	P	73.7	Confident	75	Confident	119 Å²	119	106.2 Å²	106.2	77%	0.773	54%	0.535	S	S	*	.	P	Polyproline II helix	trans	-58.9	141.9	172.6	23.7	-31	0	0	0	109.7
121	R	64.2	Low	74.2	Confident	222 Å²	222	113.2 Å²	113.2	84%	0.838	57%	0.571	S	S	*	*	P	Polyproline II helix	trans	-56.9	135.1	174.2	-76.1	-178.8	177.6	178.5	-1	108.6	N123	R121-N123 PolarHBondContact O-N 3.42Å; R121-N123 VanDerWaalsContact O-N 3.08Å
122	P	64.4	Low	73.4	Confident	93 Å²	93	118.2 Å²	118.2	60%	0.604	60%	0.595	S	S	*	*	P	Polyproline II helix	trans	-58.6	119.6	173.8	23.3	-30.3	0	0	0	107.9	I124	P122-I124 PolarHBondContact O-N 3.15Å
123	N	57.3	Low	72.7	Confident	158 Å²	158	120.1 Å²	120.1	85%	0.845	60%	0.602	S	S	*	*			trans	-62.1	109.6	170.7	-88.3	-30.4	0	0	0	106.5	R121 Q125	R121-N123 PolarHBondContact O-N 3.42Å; R121-N123 VanDerWaalsContact O-N 3.08Å; N123-Q125 PolarHBondContact O-N 2.91Å; N123-Q125 VanDerWaalsContact O-N 3.08Å
124	I	55.6	Low	71.9	Confident	170 Å²	170	124.2 Å²	124.2	87%	0.872	62%	0.616	S	S	*	*			trans	-65.9	107.5	168.4	-60	156.1	0	0	0	104.5	P122	P122-I124 PolarHBondContact O-N 3.15Å
125	Q	43.3	Very low	71	Confident	256 Å²	256	135.5 Å²	135.5	100%	1.196	67%	0.672	S	S	*	*			trans	-98	0	174.1	-148.1	178.8	-21.6	0	0	108.9	N123	N123-Q125 PolarHBondContact O-N 2.91Å; N123-Q125 VanDerWaalsContact O-N 3.08Å

Retrieved 125 of 125 residues in 36.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).