M4AZX3_XIPMA Loading...

Splicing factor 3B subunit 5

AlphaFold DB , UniProt , Accession M4AZX3, Species XIPMA (Xiphophorus maculatus, Southern platyfish), Gene n/a, Length 86 aa.

						>M4AZX3_XIPMA|M4AZX3
MTDRYNIHSQLEHLQSKYIGTGHADTSKWEWLVNQHRDSYCSYMGHFDLLNYFSVAENESKARVRFNLMEKMLQPCGPPADKPDDA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.4	Low	73.4	Confident	162 Å²	162	117 Å²	117	80%	0.798	58%	0.575	S	S	*	*				0	-44.3	0	-141.6	179.8	-118.7	0	0	110	D3 R4 Y5	M1-D3 PolarHBondContact O-N 3.43Å; M1-R4 PolarHBondContact O-N 3.26Å; M1-Y5 HydrophobicContact CG-CE2 4.18Å; M1-Y5 VanDerWaalsContact O-CD2 3.27Å; M1-Y5 WeakPolarHBondContact O-CD2 3.43Å
2	T	69.3	Low	74.5	Confident	114 Å²	114	117.8 Å²	117.8	70%	0.699	58%	0.576	S	S	*	*	H	α-helix	trans	-53	-41.2	173.6	-39.6	0	0	0	0	114.6	R4 Y5 N6	T2-R4 VanDerWaalsContact C-N 3.32Å; T2-R4 PolarHBondContact O-N 3.48Å; T2-Y5 PolarHBondContact O-N 2.98Å; T2-N6 PolarHBondContact O-N 3.2Å; T2-N6 VanDerWaalsContact O-N 3.07Å
3	D	67.1	Low	75.7	Confident	120 Å²	120	117.8 Å²	117.8	64%	0.642	57%	0.574	S	S	*	*	H	α-helix	trans	-64.6	-33.9	-178.8	-55	-54.5	0	0	0	113.3	M1 N6 I7	M1-D3 PolarHBondContact O-N 3.43Å; D3-N6 PolarHBondContact O-N 3.29Å; D3-I7 WeakPolarHBondContact O-CD1 3.32Å; D3-I7 VanDerWaalsContact O-CG1 3.28Å; D3-I7 WeakPolarHBondContact O-CG1 3.36Å; D3-I7 PolarHBondContact O-N 2.76Å
4	R	63.1	Low	76.8	Confident	172 Å²	172	115.2 Å²	115.2	65%	0.649	56%	0.564	S	S	*	*	H	α-helix	trans	-68.2	-40.9	176.4	-77	-164.8	-80.5	162	-5.6	111.8	M1 T2 N6 I7 H8	M1-R4 PolarHBondContact O-N 3.26Å; T2-R4 VanDerWaalsContact C-N 3.32Å; T2-R4 PolarHBondContact O-N 3.48Å; R4-N6 VanDerWaalsContact C-N 3.3Å; R4-N6 PolarHBondContact O-N 3.37Å; R4-I7 PolarHBondContact O-N 3.19Å; R4-H8 PolarHBondContact O-CD2 3.17Å; R4-H8 PolarHBondContact O-N 2.92Å; R4-H8 VanDerWaalsContact O-N 3.12Å
5	Y	67.8	Low	77.8	Confident	167 Å²	167	111.6 Å²	111.6	66%	0.655	55%	0.545	S	S	*	.	H	α-helix	trans	-64.6	-35.6	174.9	-71.6	-71.7	0	0	0	112.3	M1 T2 H8 S9	M1-Y5 HydrophobicContact CG-CE2 4.18Å; M1-Y5 VanDerWaalsContact O-CD2 3.27Å; M1-Y5 WeakPolarHBondContact O-CD2 3.43Å; T2-Y5 PolarHBondContact O-N 2.98Å; Y5-H8 PolarHBondContact O-N 3.3Å; Y5-S9 PolarHBondContact O-N 2.65Å; Y5-S9 VanDerWaalsContact O-N 3.14Å
6	N	76.5	Confident	78.5	Confident	86 Å²	86	110.5 Å²	110.5	46%	0.46	55%	0.552	S	S	.	*	H	α-helix	trans	-65.2	-41.1	175	-165.4	-11.5	0	0	0	111.7	T2 D3 R4 S9 Q10	T2-N6 PolarHBondContact O-N 3.2Å; T2-N6 VanDerWaalsContact O-N 3.07Å; D3-N6 PolarHBondContact O-N 3.29Å; R4-N6 VanDerWaalsContact C-N 3.3Å; R4-N6 PolarHBondContact O-N 3.37Å; N6-S9 PolarHBondContact O-N 3.02Å; N6-Q10 WeakPolarHBondContact O-CG 3.44Å; N6-Q10 PolarHBondContact O-N 3.48Å; N6-Q10 PolarHBondContact OD1-NE2 3.38Å
7	I	73.9	Confident	79.5	Confident	104 Å²	104	111.4 Å²	111.4	53%	0.533	55%	0.552	S	S	.	*	H	α-helix	trans	-62.4	-43.8	176.4	-68.1	163	0	0	0	111.6	D3 R4 Q10 L11	D3-I7 WeakPolarHBondContact O-CD1 3.32Å; D3-I7 VanDerWaalsContact O-CG1 3.28Å; D3-I7 WeakPolarHBondContact O-CG1 3.36Å; D3-I7 PolarHBondContact O-N 2.76Å; R4-I7 PolarHBondContact O-N 3.19Å; I7-Q10 PolarHBondContact O-N 3.4Å; I7-L11 PolarHBondContact O-N 2.92Å
8	H	76.6	Confident	80.4	Confident	115 Å²	115	112.1 Å²	112.1	53%	0.532	55%	0.548	S	S	.	.	H	α-helix	trans	-62.2	-44.7	177.7	-72.9	-65.5	0	0	0	112	R4 Y5 Q10 L11 E12	R4-H8 PolarHBondContact O-CD2 3.17Å; R4-H8 PolarHBondContact O-N 2.92Å; R4-H8 VanDerWaalsContact O-N 3.12Å; Y5-H8 PolarHBondContact O-N 3.3Å; H8-Q10 VanDerWaalsContact C-N 3.33Å; H8-Q10 PolarHBondContact O-N 2.93Å; H8-L11 PolarHBondContact O-N 3.39Å; H8-E12 WeakPolarHBondContact O-CG 3.44Å; H8-E12 PolarHBondContact O-N 3.3Å
9	S	81.8	Confident	81.2	Confident	72 Å²	72	114.5 Å²	114.5	50%	0.503	56%	0.562	S	S	.	*	H	α-helix	trans	-62.5	-38.2	177.2	-178.9	0	0	0	0	112.8	Y5 N6 H13	Y5-S9 PolarHBondContact O-N 2.65Å; Y5-S9 VanDerWaalsContact O-N 3.14Å; N6-S9 PolarHBondContact O-N 3.02Å; S9-H13 WeakPolarHBondContact O-CB 3.36Å; S9-H13 PolarHBondContact O-N 3.09Å
10	Q	84.5	Confident	81.8	Confident	110 Å²	110	110.1 Å²	110.1	51%	0.514	55%	0.547	S	S	.	.	H	α-helix	trans	-66.4	-39	175.7	-73.2	176.4	48.3	0	0	112.4	N6 I7 H8 H13 L14	N6-Q10 WeakPolarHBondContact O-CG 3.44Å; N6-Q10 PolarHBondContact O-N 3.48Å; N6-Q10 PolarHBondContact OD1-NE2 3.38Å; I7-Q10 PolarHBondContact O-N 3.4Å; H8-Q10 VanDerWaalsContact C-N 3.33Å; H8-Q10 PolarHBondContact O-N 2.93Å; Q10-H13 WeakPolarHBondContact O-CB 3.1Å; Q10-H13 PolarHBondContact O-N 3.28Å; Q10-L14 WeakPolarHBondContact O-CG 2.93Å; Q10-L14 PolarHBondContact O-N 2.92Å
11	L	86.1	Confident	82.5	Confident	65 Å²	65	107.3 Å²	107.3	34%	0.34	54%	0.536	S	S	.	.	H	α-helix	trans	-69.4	-43.3	178.7	-171.2	133.3	0	0	0	111.5	I7 H8 H13 L14 Q15 H23	I7-L11 PolarHBondContact O-N 2.92Å; H8-L11 PolarHBondContact O-N 3.39Å; L11-H13 VanDerWaalsContact C-N 3.29Å; L11-H13 PolarHBondContact O-N 3.36Å; L11-L14 PolarHBondContact O-N 3.02Å; L11-Q15 HydrophobicContact CD2-CG 4.33Å; L11-Q15 WeakPolarHBondContact O-CG 3.47Å; L11-Q15 PolarHBondContact O-N 2.94Å; L11-H23 HydrophobicContact CD2-CB 4.3Å
12	E	87.4	Confident	84	Confident	126 Å²	126	101 Å²	101	59%	0.589	51%	0.513	S	S	*	.	H	α-helix	trans	-60.3	-40	172.6	-72.6	175.4	178.5	0	0	111.7	H8 L14 Q15 S16	H8-E12 WeakPolarHBondContact O-CG 3.44Å; H8-E12 PolarHBondContact O-N 3.3Å; E12-L14 PolarHBondContact O-N 3.45Å; E12-Q15 PolarHBondContact O-N 3.09Å; E12-S16 PolarHBondContact O-N 3.05Å
13	H	89.6	Confident	85	Confident	118 Å²	118	99.4 Å²	99.4	55%	0.546	50%	0.498	S	S	.	.	H	α-helix	trans	-59.5	-46.4	174.4	-178.1	65.8	0	0	0	111.5	S9 Q10 L11 S16 K17	S9-H13 WeakPolarHBondContact O-CB 3.36Å; S9-H13 PolarHBondContact O-N 3.09Å; Q10-H13 WeakPolarHBondContact O-CB 3.1Å; Q10-H13 PolarHBondContact O-N 3.28Å; L11-H13 VanDerWaalsContact C-N 3.29Å; L11-H13 PolarHBondContact O-N 3.36Å; H13-S16 PolarHBondContact O-N 3.11Å; H13-S16 PolarHBondContact O-OG 3.38Å; H13-K17 PolarHBondContact O-N 2.91Å
14	L	91.6	Very high	86.2	Confident	82 Å²	82	98.7 Å²	98.7	43%	0.429	51%	0.508	S	S	.	.	H	α-helix	trans	-62.8	-44.2	177	-75	168	0	0	0	112.1	Q10 L11 E12 S16 K17 Y18 T21	Q10-L14 WeakPolarHBondContact O-CG 2.93Å; Q10-L14 PolarHBondContact O-N 2.92Å; L11-L14 PolarHBondContact O-N 3.02Å; E12-L14 PolarHBondContact O-N 3.45Å; L14-S16 VanDerWaalsContact C-N 3.3Å; L14-S16 PolarHBondContact O-N 3.24Å; L14-K17 PolarHBondContact O-N 3.15Å; L14-Y18 HydrophobicContact CD2-CD2 4.1Å; L14-Y18 HydrophobicContact CD2-CE2 4.19Å; L14-Y18 PolarHBondContact O-N 3.31Å; L14-T21 HydrophobicContact CB-CG2 4.36Å
15	Q	90.9	Very high	87.5	Confident	61 Å²	61	97 Å²	97	29%	0.285	51%	0.512	S	S	.	.	H	α-helix	trans	-62.1	-36.5	177.8	-72.2	176.2	-31.3	0	0	112.6	L11 E12 T21 H23	L11-Q15 HydrophobicContact CD2-CG 4.33Å; L11-Q15 WeakPolarHBondContact O-CG 3.47Å; L11-Q15 PolarHBondContact O-N 2.94Å; E12-Q15 PolarHBondContact O-N 3.09Å; Q15-T21 HydrophobicContact CG-CG2 4.17Å; Q15-H23 PolarHBondContact NE2-CD2 3.31Å
16	S	89.6	Confident	88.7	Confident	94 Å²	94	90.7 Å²	90.7	66%	0.657	49%	0.491	S	S	*	.	H	α-helix	trans	-69.6	-32.1	175.9	73.3	0	0	0	0	113.3	E12 H13 L14	E12-S16 PolarHBondContact O-N 3.05Å; H13-S16 PolarHBondContact O-N 3.11Å; H13-S16 PolarHBondContact O-OG 3.38Å; L14-S16 VanDerWaalsContact C-N 3.3Å; L14-S16 PolarHBondContact O-N 3.24Å
17	K	95.4	Very high	89.5	Confident	126 Å²	126	89 Å²	89	55%	0.548	49%	0.486	S	S	.	.	H	α-helix	trans	-86.6	-38	-177.3	-172.1	175.6	179.4	-169.7	0	112.8	H13 L14	H13-K17 PolarHBondContact O-N 2.91Å; L14-K17 PolarHBondContact O-N 3.15Å
18	Y	95.7	Very high	90.4	Very high	124 Å²	124	92.2 Å²	92.2	49%	0.486	50%	0.496	S	S	.	.	S	Bend	trans	-123	93.6	-174.4	-59.2	-69.5	0	0	0	109.3	L14 G20 T21	L14-Y18 HydrophobicContact CD2-CD2 4.1Å; L14-Y18 HydrophobicContact CD2-CE2 4.19Å; L14-Y18 PolarHBondContact O-N 3.31Å; Y18-G20 PolarHBondContact O-N 2.74Å; Y18-T21 WeakPolarHBondContact CB-OG1 3.48Å; Y18-T21 WeakPolarHBondContact O-CB 3.13Å; Y18-T21 PolarHBondContact O-N 3.46Å; Y18-T21 VanDerWaalsContact O-N 3.14Å; Y18-T21 PolarHBondContact O-OG1 3.37Å
19	I	95.6	Very high	91.3	Very high	157 Å²	157	90.3 Å²	90.3	81%	0.805	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.1	131.3	175.4	-57.5	172.9	0	0	0	108.5
20	G	93.8	Very high	91.8	Very high	26 Å²	26	90.7 Å²	90.7	27%	0.268	48%	0.478	S	S	.	.	T	Hydrogen-bonded Turn	trans	97.5	-4.3	-176.6	0	0	0	0	0	114.9	Y18 G22	Y18-G20 PolarHBondContact O-N 2.74Å; G20-G22 PolarHBondContact O-N 2.92Å; G20-G22 VanDerWaalsContact O-N 3.09Å
21	T	95	Very high	92.3	Very high	52 Å²	52	92 Å²	92	32%	0.319	48%	0.479	S	S	.	.			trans	-62.5	111.3	172.1	-55.9	0	0	0	0	110.5	L14 Q15 Y18	L14-T21 HydrophobicContact CB-CG2 4.36Å; Q15-T21 HydrophobicContact CG-CG2 4.17Å; Y18-T21 WeakPolarHBondContact CB-OG1 3.48Å; Y18-T21 WeakPolarHBondContact O-CB 3.13Å; Y18-T21 PolarHBondContact O-N 3.46Å; Y18-T21 VanDerWaalsContact O-N 3.14Å; Y18-T21 PolarHBondContact O-OG1 3.37Å
22	G	92.1	Very high	92.9	Very high	31 Å²	31	91.8 Å²	91.8	32%	0.32	48%	0.477	S	S	.	.			trans	-76.4	170.9	179.9	0	0	0	0	0	114.3	G20	G20-G22 PolarHBondContact O-N 2.92Å; G20-G22 VanDerWaalsContact O-N 3.09Å
23	H	91.8	Very high	93.3	Very high	79 Å²	79	86.1 Å²	86.1	37%	0.366	45%	0.451	S	S	.	.			trans	-139.9	175.3	172.1	58.1	97.5	0	0	0	109.7	L11 Q15 D25 T26	L11-H23 HydrophobicContact CD2-CB 4.3Å; Q15-H23 PolarHBondContact NE2-CD2 3.31Å; H23-D25 VanDerWaalsContact CE1-C 3.45Å; H23-D25 PolarHBondContact ND1-N 2.98Å; H23-D25 IonicContact ND1-OD2 3.82Å; H23-D25 PolarHBondContact O-N 2.87Å; H23-D25 VanDerWaalsContact O-N 3.16Å; H23-T26 PolarHBondContact CD2-OG1 3.19Å; H23-T26 PolarHBondContact CE1-N 2.97Å; H23-T26 PolarHBondContact N-OG1 2.89Å; H23-T26 PolarHBondContact NE2-OG1 3.45Å; H23-T26 WeakPolarHBondContact O-CB 3.45Å; H23-T26 PolarHBondContact O-N 3.27Å; H23-T26 VanDerWaalsContact O-N 3.08Å; H23-T26 PolarHBondContact O-OG1 3.36Å; H23-T26 VanDerWaalsContact O-OG1 3.1Å
24	A	90.9	Very high	93.6	Very high	105 Å²	105	82.1 Å²	82.1	87%	0.868	43%	0.434	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.7	-30.4	-175.5	0	0	0	0	0	113.6
25	D	90.8	Very high	93.9	Very high	136 Å²	136	82 Å²	82	73%	0.727	43%	0.431	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.1	11.2	-178.8	-43.2	-64.2	0	0	0	113.3	H23 S27	H23-D25 VanDerWaalsContact CE1-C 3.45Å; H23-D25 PolarHBondContact ND1-N 2.98Å; H23-D25 IonicContact ND1-OD2 3.82Å; H23-D25 PolarHBondContact O-N 2.87Å; H23-D25 VanDerWaalsContact O-N 3.16Å; D25-S27 PolarHBondContact O-N 3.47Å
26	T	92.7	Very high	94.3	Very high	35 Å²	35	82.4 Å²	82.4	22%	0.215	43%	0.433	C	S	.	.			trans	-63	120.1	176.1	-62.9	0	0	0	0	110	H23 E30 W31	H23-T26 PolarHBondContact CD2-OG1 3.19Å; H23-T26 PolarHBondContact CE1-N 2.97Å; H23-T26 PolarHBondContact N-OG1 2.89Å; H23-T26 PolarHBondContact NE2-OG1 3.45Å; H23-T26 WeakPolarHBondContact O-CB 3.45Å; H23-T26 PolarHBondContact O-N 3.27Å; H23-T26 VanDerWaalsContact O-N 3.08Å; H23-T26 PolarHBondContact O-OG1 3.36Å; H23-T26 VanDerWaalsContact O-OG1 3.1Å; T26-E30 HydrophobicContact CG2-CB 3.87Å; T26-W31 HydrophobicContact CG2-CB 4.24Å
27	S	93.6	Very high	94.7	Very high	50 Å²	50	82 Å²	82	35%	0.35	42%	0.417	S	S	.	.			trans	-68.5	157.2	179.2	68.6	0	0	0	0	111.4	D25 W29 E30 W31	D25-S27 PolarHBondContact O-N 3.47Å; S27-W29 PolarHBondContact O-N 3.43Å; S27-E30 WeakPolarHBondContact CB-OE2 3.48Å; S27-E30 PolarHBondContact N-OE2 3.19Å; S27-E30 PolarHBondContact O-N 3.47Å; S27-E30 VanDerWaalsContact OG-CD 3.26Å; S27-E30 VanDerWaalsContact OG-CG 3.25Å; S27-E30 WeakPolarHBondContact OG-CG 3.11Å; S27-E30 PolarHBondContact OG-N 3.02Å; S27-E30 PolarHBondContact OG-OE2 2.93Å; S27-W31 PolarHBondContact O-N 3.42Å
28	K	92.8	Very high	94.8	Very high	172 Å²	172	81 Å²	81	75%	0.748	42%	0.417	S	S	*	.	H	α-helix	trans	-53.9	-37.7	172.8	178.6	-178.8	173.8	-175.3	0	111.9	L32	K28-L32 HydrophobicContact CD-CD1 4.49Å; K28-L32 HydrophobicContact CG-CD1 3.88Å; K28-L32 HydrophobicContact CG-CG 4.46Å; K28-L32 WeakPolarHBondContact O-CB 3.38Å; K28-L32 VanDerWaalsContact O-CG 3.31Å; K28-L32 WeakPolarHBondContact O-CG 3.49Å; K28-L32 PolarHBondContact O-N 3.29Å
29	W	94.8	Very high	94.9	Very high	76 Å²	76	77.1 Å²	77.1	29%	0.288	41%	0.409	S	S	.	.	H	α-helix	trans	-67.7	-47.3	-179.2	-177.1	92.3	0	0	0	111.5	S27 W31 L32 V33 G77 P78 P79	S27-W29 PolarHBondContact O-N 3.43Å; W29-W31 VanDerWaalsContact C-N 3.32Å; W29-W31 PolarHBondContact O-N 3.11Å; W29-L32 PolarHBondContact O-N 3.36Å; W29-V33 HydrophobicContact CH2-CG2 4.4Å; W29-V33 HydrophobicContact CZ2-CG2 4.34Å; W29-V33 HydrophobicContact CZ3-CG1 4.43Å; W29-V33 PolarHBondContact O-N 2.81Å; W29-G77 WeakPolarHBondContact CZ2-O 3.35Å; W29-G77 PolarHBondContact NE1-O 3.04Å; W29-P78 PolarHBondContact NE1-O 3.25Å; W29-P79 HydrophobicContact CD2-CB 3.78Å; W29-P79 HydrophobicContact CE3-CB 3.98Å; W29-P79 HydrophobicContact CG-CB 4.24Å; W29-P79 HydrophobicContact CH2-CB 4.33Å; W29-P79 HydrophobicContact CH2-CG 4.4Å; W29-P79 HydrophobicContact CZ2-CB 4.13Å; W29-P79 HydrophobicContact CZ2-CG 4.31Å; W29-P79 HydrophobicContact CZ3-CB 4.25Å
30	E	94.2	Very high	95	Very high	79 Å²	79	71.4 Å²	71.4	37%	0.369	38%	0.377	S	S	.	.	H	α-helix	trans	-61.4	-40.9	176.8	-70.1	161.1	141.5	0	0	111.7	T26 S27 V33 N34	T26-E30 HydrophobicContact CG2-CB 3.87Å; S27-E30 WeakPolarHBondContact CB-OE2 3.48Å; S27-E30 PolarHBondContact N-OE2 3.19Å; S27-E30 PolarHBondContact O-N 3.47Å; S27-E30 VanDerWaalsContact OG-CD 3.26Å; S27-E30 VanDerWaalsContact OG-CG 3.25Å; S27-E30 WeakPolarHBondContact OG-CG 3.11Å; S27-E30 PolarHBondContact OG-N 3.02Å; S27-E30 PolarHBondContact OG-OE2 2.93Å; E30-V33 WeakPolarHBondContact O-CG1 3.42Å; E30-V33 PolarHBondContact O-N 3.49Å; E30-N34 PolarHBondContact O-N 2.9Å; E30-N34 PolarHBondContact O-ND2 3.02Å; E30-N34 VanDerWaalsContact O-ND2 3.17Å
31	W	94.9	Very high	95.2	Very high	139 Å²	139	73.2 Å²	73.2	53%	0.527	39%	0.385	S	S	.	.	H	α-helix	trans	-64.6	-42.1	176.8	-174.5	-113.2	0	0	0	112.5	T26 S27 W29 Q35	T26-W31 HydrophobicContact CG2-CB 4.24Å; S27-W31 PolarHBondContact O-N 3.42Å; W29-W31 VanDerWaalsContact C-N 3.32Å; W29-W31 PolarHBondContact O-N 3.11Å; W31-Q35 WeakPolarHBondContact O-CG 3.4Å; W31-Q35 PolarHBondContact O-N 2.91Å; W31-Q35 PolarHBondContact O-NE2 3Å
32	L	97	Very high	95.3	Very high	59 Å²	59	73 Å²	73	31%	0.309	39%	0.385	S	S	.	.	H	α-helix	trans	-70.2	-38.4	178.4	-75.7	170.8	0	0	0	112.3	K28 W29 N34 Q35 H36	K28-L32 HydrophobicContact CD-CD1 4.49Å; K28-L32 HydrophobicContact CG-CD1 3.88Å; K28-L32 HydrophobicContact CG-CG 4.46Å; K28-L32 WeakPolarHBondContact O-CB 3.38Å; K28-L32 VanDerWaalsContact O-CG 3.31Å; K28-L32 WeakPolarHBondContact O-CG 3.49Å; K28-L32 PolarHBondContact O-N 3.29Å; W29-L32 PolarHBondContact O-N 3.36Å; L32-N34 VanDerWaalsContact C-N 3.3Å; L32-N34 PolarHBondContact O-N 3.02Å; L32-Q35 PolarHBondContact O-N 3.24Å; L32-H36 PolarHBondContact O-N 3.49Å; L32-H36 PolarHBondContact O-ND1 3.33Å
33	V	96.8	Very high	95.6	Very high	8 Å²	8	74.8 Å²	74.8	5%	0.048	38%	0.383	C	S	.	.	H	α-helix	trans	-63.2	-40.2	-179.9	94.3	0	0	0	0	110.9	W29 E30 H36 R37 P75	W29-V33 HydrophobicContact CH2-CG2 4.4Å; W29-V33 HydrophobicContact CZ2-CG2 4.34Å; W29-V33 HydrophobicContact CZ3-CG1 4.43Å; W29-V33 PolarHBondContact O-N 2.81Å; E30-V33 WeakPolarHBondContact O-CG1 3.42Å; E30-V33 PolarHBondContact O-N 3.49Å; V33-H36 PolarHBondContact O-N 3.33Å; V33-R37 WeakPolarHBondContact O-CG 3.34Å; V33-R37 PolarHBondContact O-N 3.49Å; V33-P75 HydrophobicContact CG2-CG 3.59Å
34	N	96.8	Very high	95.8	Very high	34 Å²	34	72.5 Å²	72.5	18%	0.182	37%	0.373	C	S	.	.	H	α-helix	trans	-65.1	-47.7	176.6	-72.5	-32.9	0	0	0	111.2	E30 L32 H36 R37 D38	E30-N34 PolarHBondContact O-N 2.9Å; E30-N34 PolarHBondContact O-ND2 3.02Å; E30-N34 VanDerWaalsContact O-ND2 3.17Å; L32-N34 VanDerWaalsContact C-N 3.3Å; L32-N34 PolarHBondContact O-N 3.02Å; N34-H36 VanDerWaalsContact C-N 3.33Å; N34-H36 PolarHBondContact O-N 3.43Å; N34-R37 PolarHBondContact O-N 2.87Å; N34-D38 WeakPolarHBondContact O-CB 3.34Å; N34-D38 VanDerWaalsContact O-CG 3.3Å; N34-D38 PolarHBondContact O-N 3.18Å
35	Q	97.6	Very high	96	Very high	79 Å²	79	70.5 Å²	70.5	37%	0.369	36%	0.363	S	S	.	.	H	α-helix	trans	-58.4	-41.4	176.9	-75.3	170.6	87.9	0	0	113.4	W31 L32 D38 S39	W31-Q35 WeakPolarHBondContact O-CG 3.4Å; W31-Q35 PolarHBondContact O-N 2.91Å; W31-Q35 PolarHBondContact O-NE2 3Å; L32-Q35 PolarHBondContact O-N 3.24Å; Q35-D38 PolarHBondContact O-N 2.98Å; Q35-S39 WeakPolarHBondContact O-CB 3.15Å; Q35-S39 PolarHBondContact O-N 3.37Å; Q35-S39 PolarHBondContact O-OG 2.99Å
36	H	97.9	Very high	96.4	Very high	70 Å²	70	69 Å²	69	32%	0.324	35%	0.351	S	S	.	.	H	α-helix	trans	-67	-41.4	178.3	-76.8	74.3	0	0	0	111.4	L32 V33 N34 S39 Y40 P75 C76	L32-H36 PolarHBondContact O-N 3.49Å; L32-H36 PolarHBondContact O-ND1 3.33Å; V33-H36 PolarHBondContact O-N 3.33Å; N34-H36 VanDerWaalsContact C-N 3.33Å; N34-H36 PolarHBondContact O-N 3.43Å; H36-S39 PolarHBondContact O-N 3.35Å; H36-Y40 WeakPolarHBondContact O-CD2 3.42Å; H36-Y40 VanDerWaalsContact O-CG 3.24Å; H36-Y40 PolarHBondContact O-N 3.21Å; H36-P75 HydrophobicContact CB-CB 3.66Å; H36-P75 HydrophobicContact CB-CG 3.76Å; H36-C76 PolarHBondContact ND1-SG 3.42Å
37	R	97.9	Very high	96.5	Very high	86 Å²	86	72.8 Å²	72.8	33%	0.325	37%	0.365	S	S	.	.	H	α-helix	trans	-63.8	-44	176	-73.9	175.3	175.4	172.6	2.4	111.6	V33 N34 S39 Y40 C41 M72 L73 P75	V33-R37 WeakPolarHBondContact O-CG 3.34Å; V33-R37 PolarHBondContact O-N 3.49Å; N34-R37 PolarHBondContact O-N 2.87Å; R37-S39 VanDerWaalsContact C-N 3.32Å; R37-S39 PolarHBondContact O-N 3.14Å; R37-Y40 PolarHBondContact O-N 2.98Å; R37-C41 PolarHBondContact O-N 3.33Å; R37-C41 PolarHBondContact O-SG 2.92Å; R37-C41 VanDerWaalsContact O-SG 3.33Å; R37-M72 HydrophobicContact CB-CE 4.27Å; R37-M72 HydrophobicContact CG-CE 4.41Å; R37-M72 PolarHBondContact NE-O 3.18Å; R37-M72 PolarHBondContact NH2-O 3.45Å; R37-L73 PolarHBondContact NH2-O 3.07Å; R37-P75 HydrophobicContact CG-CG 4.46Å
38	D	97.9	Very high	96.7	Very high	103 Å²	103	76.6 Å²	76.6	55%	0.551	38%	0.381	S	S	*	.	H	α-helix	trans	-62.2	-41.3	176.3	-70.2	-11.4	0	0	0	111.6	N34 Q35 C41 S42	N34-D38 WeakPolarHBondContact O-CB 3.34Å; N34-D38 VanDerWaalsContact O-CG 3.3Å; N34-D38 PolarHBondContact O-N 3.18Å; Q35-D38 PolarHBondContact O-N 2.98Å; D38-C41 PolarHBondContact O-N 3.4Å; D38-S42 WeakPolarHBondContact O-CB 3.29Å; D38-S42 PolarHBondContact O-N 3.41Å
39	S	97.9	Very high	97	Very high	44 Å²	44	71.6 Å²	71.6	31%	0.308	36%	0.362	S	S	.	.	H	α-helix	trans	-60.5	-48.6	175	-59.9	0	0	0	0	111.2	Q35 H36 R37 C41 S42 Y43	Q35-S39 WeakPolarHBondContact O-CB 3.15Å; Q35-S39 PolarHBondContact O-N 3.37Å; Q35-S39 PolarHBondContact O-OG 2.99Å; H36-S39 PolarHBondContact O-N 3.35Å; R37-S39 VanDerWaalsContact C-N 3.32Å; R37-S39 PolarHBondContact O-N 3.14Å; S39-C41 PolarHBondContact O-N 3.5Å; S39-S42 WeakPolarHBondContact O-CB 3.48Å; S39-S42 PolarHBondContact O-N 2.91Å; S39-Y43 WeakPolarHBondContact O-CD1 3.38Å; S39-Y43 WeakPolarHBondContact O-CD2 3.38Å; S39-Y43 PolarHBondContact O-N 3.42Å
40	Y	97.9	Very high	97.1	Very high	37 Å²	37	68 Å²	68	15%	0.145	35%	0.348	C	S	.	.	H	α-helix	trans	-62.8	-41	177.3	-61.5	-27.2	0	0	0	112.8	H36 R37 S42 Y43 M44 L68 K71 M72 P75	H36-Y40 WeakPolarHBondContact O-CD2 3.42Å; H36-Y40 VanDerWaalsContact O-CG 3.24Å; H36-Y40 PolarHBondContact O-N 3.21Å; R37-Y40 PolarHBondContact O-N 2.98Å; Y40-S42 VanDerWaalsContact C-N 3.33Å; Y40-S42 PolarHBondContact O-N 3.02Å; Y40-Y43 AromaticContact CD1-CD2 3.98Å; Y40-Y43 HydrophobicContact CD1-CD2 3.98Å; Y40-Y43 HydrophobicContact CD1-CE2 4.11Å; Y40-Y43 PolarHBondContact O-N 3.17Å; Y40-M44 WeakPolarHBondContact O-CE 3.34Å; Y40-M44 WeakPolarHBondContact O-CG 3.41Å; Y40-M44 PolarHBondContact O-N 3.24Å; Y40-L68 HydrophobicContact CD1-CD2 3.73Å; Y40-L68 HydrophobicContact CE1-CD2 4.21Å; Y40-L68 HydrophobicContact CG-CD2 4.31Å; Y40-K71 HydrophobicContact CD2-CB 4.26Å; Y40-K71 HydrophobicContact CE2-CB 3.57Å; Y40-M72 HydrophobicContact CD2-CG 4.12Å; Y40-P75 HydrophobicContact CE2-CB 3.88Å
41	C	97.4	Very high	97.3	Very high	64 Å²	64	65.9 Å²	65.9	43%	0.432	34%	0.34	S	S	.	.	H	α-helix	trans	-58.2	-45.5	173.1	-74.1	0	0	0	0	111.5	R37 D38 S39 M44 G45 M72	R37-C41 PolarHBondContact O-N 3.33Å; R37-C41 PolarHBondContact O-SG 2.92Å; R37-C41 VanDerWaalsContact O-SG 3.33Å; D38-C41 PolarHBondContact O-N 3.4Å; S39-C41 PolarHBondContact O-N 3.5Å; C41-M44 PolarHBondContact O-N 3.25Å; C41-G45 PolarHBondContact O-N 3.32Å; C41-M72 VanDerWaalsContact SG-CE 3.53Å
42	S	97.8	Very high	97.4	Very high	46 Å²	46	67.3 Å²	67.3	32%	0.322	35%	0.346	S	S	.	.	H	α-helix	trans	-61.6	-46.6	176.6	-173.8	0	0	0	0	111.2	D38 S39 Y40 M44 G45 H46	D38-S42 WeakPolarHBondContact O-CB 3.29Å; D38-S42 PolarHBondContact O-N 3.41Å; S39-S42 WeakPolarHBondContact O-CB 3.48Å; S39-S42 PolarHBondContact O-N 2.91Å; Y40-S42 VanDerWaalsContact C-N 3.33Å; Y40-S42 PolarHBondContact O-N 3.02Å; S42-M44 VanDerWaalsContact C-N 3.29Å; S42-M44 PolarHBondContact O-N 3.01Å; S42-G45 PolarHBondContact O-N 3.49Å; S42-G45 VanDerWaalsContact O-N 3.15Å; S42-H46 PolarHBondContact O-CD2 3.1Å; S42-H46 PolarHBondContact O-N 3.45Å; S42-H46 PolarHBondContact OG-CD2 2.9Å; S42-H46 PolarHBondContact OG-NE2 3.26Å
43	Y	97.8	Very high	97.5	Very high	70 Å²	70	66.9 Å²	66.9	28%	0.275	34%	0.342	S	S	.	.	H	α-helix	trans	-61	-36.8	178.7	-57.2	-18	0	0	0	112.7	S39 Y40 L49 L50 F53 L68	S39-Y43 WeakPolarHBondContact O-CD1 3.38Å; S39-Y43 WeakPolarHBondContact O-CD2 3.38Å; S39-Y43 PolarHBondContact O-N 3.42Å; Y40-Y43 AromaticContact CD1-CD2 3.98Å; Y40-Y43 HydrophobicContact CD1-CD2 3.98Å; Y40-Y43 HydrophobicContact CD1-CE2 4.11Å; Y40-Y43 PolarHBondContact O-N 3.17Å; Y43-L49 HydrophobicContact CD1-CD2 3.98Å; Y43-L49 HydrophobicContact CE1-CD2 4.24Å; Y43-L50 WeakPolarHBondContact O-CB 3.35Å; Y43-F53 AromaticContact CD1-CE2 3.63Å; Y43-F53 HydrophobicContact CD1-CE2 3.63Å; Y43-F53 HydrophobicContact CD1-CZ 4.06Å; Y43-F53 AromaticContact CD2-CE2 3.78Å; Y43-F53 HydrophobicContact CD2-CE2 3.78Å; Y43-F53 HydrophobicContact CD2-CZ 4.2Å; Y43-F53 HydrophobicContact CE1-CE2 4.16Å; Y43-F53 HydrophobicContact CE1-CZ 4.12Å; Y43-F53 HydrophobicContact CE2-CE2 4.31Å; Y43-F53 HydrophobicContact CE2-CZ 4.27Å; Y43-F53 HydrophobicContact CG-CD2 4.28Å; Y43-F53 AromaticContact CG-CE2 3.42Å; Y43-F53 HydrophobicContact CG-CE2 3.42Å; Y43-F53 VanDerWaalsContact CG-CE2 3.42Å; Y43-F53 HydrophobicContact CG-CZ 4.11Å; Y43-L68 HydrophobicContact CD2-CD2 4.31Å
44	M	95.9	Very high	97.5	Very high	31 Å²	31	67 Å²	67	15%	0.153	34%	0.343	C	S	.	.	H	α-helix	trans	-76.2	-32.9	176.4	-69	-173.8	-72.2	0	0	113.1	Y40 C41 S42 L68 M69 M72	Y40-M44 WeakPolarHBondContact O-CE 3.34Å; Y40-M44 WeakPolarHBondContact O-CG 3.41Å; Y40-M44 PolarHBondContact O-N 3.24Å; C41-M44 PolarHBondContact O-N 3.25Å; S42-M44 VanDerWaalsContact C-N 3.29Å; S42-M44 PolarHBondContact O-N 3.01Å; M44-L68 HydrophobicContact CG-CB 3.98Å; M44-L68 HydrophobicContact CG-CD1 3.66Å; M44-L68 HydrophobicContact CG-CG 4.49Å; M44-L68 HydrophobicContact SD-CB 3.89Å; M44-M69 HydrophobicContact CE-CG 4.49Å; M44-M69 HydrophobicContact CE-SD 3.68Å; M44-M69 HydrophobicContact SD-CG 3.79Å; M44-M69 HydrophobicContact SD-SD 3.64Å; M44-M69 VanDerWaalsContact SD-SD 3.64Å; M44-M72 HydrophobicContact CE-SD 3.85Å
45	G	95.9	Very high	97.6	Very high	63 Å²	63	71 Å²	71	65%	0.649	37%	0.368	S	S	*	.	H	α-helix	trans	-79.3	-34.9	-177.8	0	0	0	0	0	114.3	C41 S42	C41-G45 PolarHBondContact O-N 3.32Å; S42-G45 PolarHBondContact O-N 3.49Å; S42-G45 VanDerWaalsContact O-N 3.15Å
46	H	98.1	Very high	97.6	Very high	103 Å²	103	70.8 Å²	70.8	48%	0.477	38%	0.38	S	S	.	.			trans	-91.1	114.4	178.8	-63.1	-70.1	0	0	0	111.3	S42 D48 L49 L50	S42-H46 PolarHBondContact O-CD2 3.1Å; S42-H46 PolarHBondContact O-N 3.45Å; S42-H46 PolarHBondContact OG-CD2 2.9Å; S42-H46 PolarHBondContact OG-NE2 3.26Å; H46-D48 VanDerWaalsContact C-N 3.31Å; H46-D48 PolarHBondContact O-N 3.15Å; H46-L49 HydrophobicContact CB-CB 4.09Å; H46-L49 HydrophobicContact CB-CD1 3.58Å; H46-L49 HydrophobicContact CB-CG 4.45Å; H46-L49 PolarHBondContact O-N 2.9Å; H46-L50 PolarHBondContact O-N 3.48Å
47	F	96.4	Very high	97.5	Very high	116 Å²	116	72 Å²	72	51%	0.509	39%	0.386	S	S	.	.	H	α-helix	trans	-60.4	-38.2	-175.1	-166.3	-100.6	0	0	0	113.2	L50 N51	F47-L50 PolarHBondContact O-N 3.42Å; F47-N51 WeakPolarHBondContact CD1-ND2 3.48Å; F47-N51 WeakPolarHBondContact CE1-ND2 3.5Å; F47-N51 WeakPolarHBondContact O-CB 3.26Å; F47-N51 PolarHBondContact O-N 3.19Å; F47-N51 PolarHBondContact O-ND2 2.88Å; F47-N51 VanDerWaalsContact O-ND2 3.17Å; F47-N51 PolarHBondContact O-OD1 3.36Å
48	D	97.9	Very high	97.5	Very high	130 Å²	130	74.9 Å²	74.9	70%	0.695	41%	0.408	S	S	*	.	H	α-helix	trans	-70.1	-38.7	-179.1	-62.1	-35.3	0	0	0	112.5	H46 N51 Y52	H46-D48 VanDerWaalsContact C-N 3.31Å; H46-D48 PolarHBondContact O-N 3.15Å; D48-N51 PolarHBondContact O-N 3.09Å; D48-Y52 WeakPolarHBondContact O-CB 3.39Å; D48-Y52 PolarHBondContact O-N 3.14Å
49	L	97.8	Very high	97.5	Very high	66 Å²	66	74.4 Å²	74.4	35%	0.346	40%	0.402	S	S	.	.	H	α-helix	trans	-65.3	-45.3	173.3	-87.1	131.3	0	0	0	111.1	Y43 H46 N51 Y52 F53	Y43-L49 HydrophobicContact CD1-CD2 3.98Å; Y43-L49 HydrophobicContact CE1-CD2 4.24Å; H46-L49 HydrophobicContact CB-CB 4.09Å; H46-L49 HydrophobicContact CB-CD1 3.58Å; H46-L49 HydrophobicContact CB-CG 4.45Å; H46-L49 PolarHBondContact O-N 2.9Å; L49-N51 VanDerWaalsContact C-N 3.28Å; L49-N51 PolarHBondContact O-N 3.18Å; L49-Y52 WeakPolarHBondContact O-CB 3.44Å; L49-Y52 PolarHBondContact O-N 3.36Å; L49-F53 HydrophobicContact CB-CE2 4.3Å; L49-F53 HydrophobicContact CD2-CE2 4.02Å; L49-F53 HydrophobicContact CD2-CZ 4.11Å; L49-F53 WeakPolarHBondContact O-CD2 3.42Å; L49-F53 PolarHBondContact O-N 3.17Å
50	L	97.8	Very high	97.5	Very high	0 Å²	0	75.6 Å²	75.6	0%	0	41%	0.411	C	S	.	.	H	α-helix	trans	-60.1	-40.9	175.9	-176.1	63.4	0	0	0	111.8	Y43 H46 F47 F53 S54 K61 V64 R65 L68	Y43-L50 WeakPolarHBondContact O-CB 3.35Å; H46-L50 PolarHBondContact O-N 3.48Å; F47-L50 PolarHBondContact O-N 3.42Å; L50-F53 PolarHBondContact O-N 3.41Å; L50-S54 WeakPolarHBondContact O-CB 3.39Å; L50-S54 PolarHBondContact O-N 3.18Å; L50-S54 PolarHBondContact O-OG 3.17Å; L50-K61 HydrophobicContact CD2-CB 4.35Å; L50-V64 HydrophobicContact CD1-CB 4.2Å; L50-V64 HydrophobicContact CD1-CG1 3.78Å; L50-R65 HydrophobicContact CD1-CG 4.01Å; L50-R65 HydrophobicContact CD2-CG 3.92Å; L50-L68 HydrophobicContact CD1-CD1 4.49Å
51	N	97.7	Very high	97.5	Very high	35 Å²	35	77.7 Å²	77.7	19%	0.187	42%	0.421	C	S	.	.	H	α-helix	trans	-61.8	-47.5	175.8	-67.7	-21.1	0	0	0	110.8	F47 D48 L49 F53 S54 V55 K61	F47-N51 WeakPolarHBondContact CD1-ND2 3.48Å; F47-N51 WeakPolarHBondContact CE1-ND2 3.5Å; F47-N51 WeakPolarHBondContact O-CB 3.26Å; F47-N51 PolarHBondContact O-N 3.19Å; F47-N51 PolarHBondContact O-ND2 2.88Å; F47-N51 VanDerWaalsContact O-ND2 3.17Å; F47-N51 PolarHBondContact O-OD1 3.36Å; D48-N51 PolarHBondContact O-N 3.09Å; L49-N51 VanDerWaalsContact C-N 3.28Å; L49-N51 PolarHBondContact O-N 3.18Å; N51-F53 VanDerWaalsContact C-N 3.34Å; N51-F53 PolarHBondContact O-N 2.84Å; N51-S54 WeakPolarHBondContact CA-OG 3.45Å; N51-S54 PolarHBondContact O-N 3.43Å; N51-S54 PolarHBondContact O-OG 2.72Å; N51-V55 WeakPolarHBondContact O-CG2 3.49Å; N51-V55 PolarHBondContact O-N 3.35Å; N51-K61 WeakPolarHBondContact OD1-CD 3.35Å; N51-K61 WeakPolarHBondContact OD1-CE 3.39Å; N51-K61 PolarHBondContact OD1-NZ 3.49Å
52	Y	98.2	Very high	97.4	Very high	169 Å²	169	78.1 Å²	78.1	66%	0.663	43%	0.429	S	S	*	.	H	α-helix	trans	-55	-49.1	178.6	-177.7	-94.5	0	0	0	111.6	D48 L49 V55 A56	D48-Y52 WeakPolarHBondContact O-CB 3.39Å; D48-Y52 PolarHBondContact O-N 3.14Å; L49-Y52 WeakPolarHBondContact O-CB 3.44Å; L49-Y52 PolarHBondContact O-N 3.36Å; Y52-V55 PolarHBondContact O-N 3.03Å; Y52-A56 WeakPolarHBondContact O-CB 3.27Å; Y52-A56 PolarHBondContact O-N 3.47Å
53	F	97.6	Very high	97.4	Very high	51 Å²	51	82.1 Å²	82.1	22%	0.224	44%	0.437	C	S	.	.	H	α-helix	trans	-65.5	-41.8	177	-61.5	-48.3	0	0	0	112.8	Y43 L49 L50 N51 V55 A56 E57 V64	Y43-F53 AromaticContact CD1-CE2 3.63Å; Y43-F53 HydrophobicContact CD1-CE2 3.63Å; Y43-F53 HydrophobicContact CD1-CZ 4.06Å; Y43-F53 AromaticContact CD2-CE2 3.78Å; Y43-F53 HydrophobicContact CD2-CE2 3.78Å; Y43-F53 HydrophobicContact CD2-CZ 4.2Å; Y43-F53 HydrophobicContact CE1-CE2 4.16Å; Y43-F53 HydrophobicContact CE1-CZ 4.12Å; Y43-F53 HydrophobicContact CE2-CE2 4.31Å; Y43-F53 HydrophobicContact CE2-CZ 4.27Å; Y43-F53 HydrophobicContact CG-CD2 4.28Å; Y43-F53 AromaticContact CG-CE2 3.42Å; Y43-F53 HydrophobicContact CG-CE2 3.42Å; Y43-F53 VanDerWaalsContact CG-CE2 3.42Å; Y43-F53 HydrophobicContact CG-CZ 4.11Å; L49-F53 HydrophobicContact CB-CE2 4.3Å; L49-F53 HydrophobicContact CD2-CE2 4.02Å; L49-F53 HydrophobicContact CD2-CZ 4.11Å; L49-F53 WeakPolarHBondContact O-CD2 3.42Å; L49-F53 PolarHBondContact O-N 3.17Å; L50-F53 PolarHBondContact O-N 3.41Å; N51-F53 VanDerWaalsContact C-N 3.34Å; N51-F53 PolarHBondContact O-N 2.84Å; F53-V55 VanDerWaalsContact C-N 3.31Å; F53-V55 PolarHBondContact O-N 2.92Å; F53-A56 PolarHBondContact O-N 2.75Å; F53-E57 WeakPolarHBondContact O-CB 3.31Å; F53-E57 PolarHBondContact O-N 2.84Å; F53-V64 HydrophobicContact CB-CG1 4.23Å
54	S	97.8	Very high	97.4	Very high	9 Å²	9	78.9 Å²	78.9	6%	0.063	42%	0.424	C	S	.	.	H	α-helix	trans	-62.8	-36.3	178.4	68.5	0	0	0	0	113.4	L50 N51 N58 E59	L50-S54 WeakPolarHBondContact O-CB 3.39Å; L50-S54 PolarHBondContact O-N 3.18Å; L50-S54 PolarHBondContact O-OG 3.17Å; N51-S54 WeakPolarHBondContact CA-OG 3.45Å; N51-S54 PolarHBondContact O-N 3.43Å; N51-S54 PolarHBondContact O-OG 2.72Å; S54-N58 WeakPolarHBondContact O-CA 3.32Å; S54-N58 PolarHBondContact O-N 3.19Å; S54-N58 VanDerWaalsContact O-N 3.09Å; S54-E59 WeakPolarHBondContact CB-O 3.44Å; S54-E59 PolarHBondContact O-N 3.46Å
55	V	97.8	Very high	97.5	Very high	118 Å²	118	83 Å²	83	72%	0.715	44%	0.438	S	S	*	.	H	α-helix	trans	-73.5	-43	176.3	173.2	0	0	0	0	110.5	N51 Y52 F53 E57 N58	N51-V55 WeakPolarHBondContact O-CG2 3.49Å; N51-V55 PolarHBondContact O-N 3.35Å; Y52-V55 PolarHBondContact O-N 3.03Å; F53-V55 VanDerWaalsContact C-N 3.31Å; F53-V55 PolarHBondContact O-N 2.92Å; V55-E57 PolarHBondContact O-N 3.4Å; V55-N58 PolarHBondContact O-N 3.35Å
56	A	98.1	Very high	97.6	Very high	75 Å²	75	85 Å²	85	62%	0.62	43%	0.429	S	S	*	.	H	α-helix	trans	-63.7	-39.2	179.5	0	0	0	0	0	112.7	Y52 F53	Y52-A56 WeakPolarHBondContact O-CB 3.27Å; Y52-A56 PolarHBondContact O-N 3.47Å; F53-A56 PolarHBondContact O-N 2.75Å
57	E	96.4	Very high	97.5	Very high	96 Å²	96	82 Å²	82	45%	0.449	42%	0.417	S	S	.	.	H	α-helix	trans	-85.5	-8.1	178.1	-65.6	-174.9	-175.1	0	0	113.3	F53 V55 E59	F53-E57 WeakPolarHBondContact O-CB 3.31Å; F53-E57 PolarHBondContact O-N 2.84Å; V55-E57 PolarHBondContact O-N 3.4Å; E57-E59 VanDerWaalsContact C-N 3.26Å; E57-E59 HydrophobicContact CB-CB 4.35Å; E57-E59 HydrophobicContact CB-CG 4.44Å; E57-E59 PolarHBondContact O-N 2.99Å
58	N	97.8	Very high	97.6	Very high	146 Å²	146	77.1 Å²	77.1	78%	0.781	40%	0.396	S	S	*	.	T	Hydrogen-bonded Turn	trans	52	43.6	-172.4	-171.3	38	0	0	0	112.9	S54 V55	S54-N58 WeakPolarHBondContact O-CA 3.32Å; S54-N58 PolarHBondContact O-N 3.19Å; S54-N58 VanDerWaalsContact O-N 3.09Å; V55-N58 PolarHBondContact O-N 3.35Å
59	E	97.6	Very high	97.5	Very high	93 Å²	93	76.2 Å²	76.2	44%	0.435	39%	0.389	S	S	.	.			trans	-124.9	154.6	-177.1	-80.9	-69.7	179.3	0	0	111	S54 E57 R63 V64	S54-E59 WeakPolarHBondContact CB-O 3.44Å; S54-E59 PolarHBondContact O-N 3.46Å; E57-E59 VanDerWaalsContact C-N 3.26Å; E57-E59 HydrophobicContact CB-CB 4.35Å; E57-E59 HydrophobicContact CB-CG 4.44Å; E57-E59 PolarHBondContact O-N 2.99Å; E59-R63 HydrophobicContact CB-CB 4.44Å; E59-R63 HydrophobicContact CB-CG 4.47Å; E59-R63 HydrophobicContact CG-CG 4.48Å; E59-R63 WeakPolarHBondContact OE2-CG 3.38Å; E59-V64 HydrophobicContact CB-CG2 4.08Å
60	S	97.8	Very high	97.5	Very high	70 Å²	70	78.8 Å²	78.8	49%	0.49	40%	0.399	S	S	.	.			trans	-63.3	146.7	176.4	73.5	0	0	0	0	111	A62 R63 V64	S60-A62 PolarHBondContact O-N 3.49Å; S60-A62 VanDerWaalsContact O-N 3.11Å; S60-R63 WeakPolarHBondContact O-CA 3.16Å; S60-R63 WeakPolarHBondContact O-CB 3.31Å; S60-R63 PolarHBondContact O-N 3.08Å; S60-R63 WeakPolarHBondContact OG-CB 3.42Å; S60-R63 PolarHBondContact OG-N 3.18Å; S60-V64 PolarHBondContact O-N 3.29Å
61	K	97	Very high	97.4	Very high	81 Å²	81	83.6 Å²	83.6	35%	0.352	42%	0.42	S	S	.	.	H	α-helix	trans	-55.1	-34	176.8	-58.3	-176.9	-167.1	-173.8	0	112.5	L50 N51 R65	L50-K61 HydrophobicContact CD2-CB 4.35Å; N51-K61 WeakPolarHBondContact OD1-CD 3.35Å; N51-K61 WeakPolarHBondContact OD1-CE 3.39Å; N51-K61 PolarHBondContact OD1-NZ 3.49Å; K61-R65 WeakPolarHBondContact O-CG 3.49Å; K61-R65 PolarHBondContact O-N 3.19Å
62	A	97.4	Very high	97.3	Very high	73 Å²	73	84 Å²	84	60%	0.603	42%	0.421	S	S	*	.	H	α-helix	trans	-65.4	-42.3	176	0	0	0	0	0	111.7	S60 R65 F66	S60-A62 PolarHBondContact O-N 3.49Å; S60-A62 VanDerWaalsContact O-N 3.11Å; A62-R65 PolarHBondContact O-N 3.39Å; A62-F66 PolarHBondContact O-N 3.35Å
63	R	97.5	Very high	97.1	Very high	129 Å²	129	82.9 Å²	82.9	49%	0.487	43%	0.426	S	S	.	.	H	α-helix	trans	-64.3	-44.7	176.1	-172.5	67.4	166.6	-169.2	1.7	111.7	E59 S60 R65 F66 N67	E59-R63 HydrophobicContact CB-CB 4.44Å; E59-R63 HydrophobicContact CB-CG 4.47Å; E59-R63 HydrophobicContact CG-CG 4.48Å; E59-R63 WeakPolarHBondContact OE2-CG 3.38Å; S60-R63 WeakPolarHBondContact O-CA 3.16Å; S60-R63 WeakPolarHBondContact O-CB 3.31Å; S60-R63 PolarHBondContact O-N 3.08Å; S60-R63 WeakPolarHBondContact OG-CB 3.42Å; S60-R63 PolarHBondContact OG-N 3.18Å; R63-R65 PolarHBondContact O-N 2.99Å; R63-F66 WeakPolarHBondContact O-CB 3.47Å; R63-F66 PolarHBondContact O-N 3.27Å; R63-N67 VanDerWaalsContact O-CG 3.23Å; R63-N67 PolarHBondContact O-N 3.28Å; R63-N67 PolarHBondContact O-OD1 3.36Å
64	V	97.8	Very high	96.8	Very high	2 Å²	2	85.2 Å²	85.2	1%	0.012	44%	0.438	C	S	.	.	H	α-helix	trans	-61.8	-43.7	176.6	177.7	0	0	0	0	111.2	L50 F53 E59 S60 F66 N67 L68	L50-V64 HydrophobicContact CD1-CB 4.2Å; L50-V64 HydrophobicContact CD1-CG1 3.78Å; F53-V64 HydrophobicContact CB-CG1 4.23Å; E59-V64 HydrophobicContact CB-CG2 4.08Å; S60-V64 PolarHBondContact O-N 3.29Å; V64-F66 VanDerWaalsContact C-N 3.34Å; V64-F66 PolarHBondContact O-N 3.16Å; V64-N67 PolarHBondContact O-N 2.71Å; V64-L68 HydrophobicContact CG1-CD1 3.98Å; V64-L68 HydrophobicContact CG1-CG 4.31Å; V64-L68 WeakPolarHBondContact O-CB 3.41Å; V64-L68 VanDerWaalsContact O-CG 3.29Å; V64-L68 WeakPolarHBondContact O-CG 3.21Å; V64-L68 PolarHBondContact O-N 2.8Å
65	R	97.4	Very high	96.7	Very high	119 Å²	119	86.2 Å²	86.2	45%	0.449	44%	0.444	S	S	.	.	H	α-helix	trans	-58.7	-44.6	174	-76.6	179.2	175.1	-170	-2.5	112.3	L50 K61 A62 R63 L68 M69	L50-R65 HydrophobicContact CD1-CG 4.01Å; L50-R65 HydrophobicContact CD2-CG 3.92Å; K61-R65 WeakPolarHBondContact O-CG 3.49Å; K61-R65 PolarHBondContact O-N 3.19Å; A62-R65 PolarHBondContact O-N 3.39Å; R63-R65 PolarHBondContact O-N 2.99Å; R65-L68 PolarHBondContact O-N 3.07Å; R65-M69 VanDerWaalsContact O-CG 3.27Å; R65-M69 WeakPolarHBondContact O-CG 3.49Å; R65-M69 PolarHBondContact O-N 3.4Å
66	F	97.8	Very high	96.6	Very high	104 Å²	104	82.5 Å²	82.5	46%	0.456	42%	0.423	S	S	.	.	H	α-helix	trans	-59.4	-49	176.6	179.7	-95.3	0	0	0	111.5	A62 R63 V64 L68 M69 E70	A62-F66 PolarHBondContact O-N 3.35Å; R63-F66 WeakPolarHBondContact O-CB 3.47Å; R63-F66 PolarHBondContact O-N 3.27Å; V64-F66 VanDerWaalsContact C-N 3.34Å; V64-F66 PolarHBondContact O-N 3.16Å; F66-L68 VanDerWaalsContact C-N 3.33Å; F66-L68 PolarHBondContact O-N 3.12Å; F66-M69 PolarHBondContact O-N 3.33Å; F66-E70 HydrophobicContact CD1-CG 4.37Å; F66-E70 HydrophobicContact CE1-CG 3.9Å; F66-E70 VanDerWaalsContact CE1-OE1 3.31Å; F66-E70 WeakPolarHBondContact CE1-OE1 3.32Å; F66-E70 WeakPolarHBondContact CE1-OE2 3.36Å; F66-E70 VanDerWaalsContact CZ-CD 3.49Å; F66-E70 HydrophobicContact CZ-CG 3.97Å; F66-E70 WeakPolarHBondContact CZ-OE1 3.25Å; F66-E70 PolarHBondContact O-N 3.36Å
67	N	97	Very high	96.3	Very high	40 Å²	40	80.1 Å²	80.1	21%	0.214	41%	0.405	C	S	.	.	H	α-helix	trans	-60.7	-40.4	178.2	-66.1	-12.2	0	0	0	112.2	R63 V64 E70 K71	R63-N67 VanDerWaalsContact O-CG 3.23Å; R63-N67 PolarHBondContact O-N 3.28Å; R63-N67 PolarHBondContact O-OD1 3.36Å; V64-N67 PolarHBondContact O-N 2.71Å; N67-E70 PolarHBondContact O-N 3.05Å; N67-K71 VanDerWaalsContact O-CG 3.26Å; N67-K71 WeakPolarHBondContact O-CG 3.28Å; N67-K71 PolarHBondContact O-N 3.45Å; N67-K71 VanDerWaalsContact O-N 3.14Å
68	L	97.2	Very high	96.1	Very high	14 Å²	14	80.1 Å²	80.1	7%	0.073	41%	0.413	C	S	.	.	H	α-helix	trans	-65.7	-40.2	177	-71	173.4	0	0	0	111.7	Y40 Y43 M44 L50 V64 R65 F66 K71 M72	Y40-L68 HydrophobicContact CD1-CD2 3.73Å; Y40-L68 HydrophobicContact CE1-CD2 4.21Å; Y40-L68 HydrophobicContact CG-CD2 4.31Å; Y43-L68 HydrophobicContact CD2-CD2 4.31Å; M44-L68 HydrophobicContact CG-CB 3.98Å; M44-L68 HydrophobicContact CG-CD1 3.66Å; M44-L68 HydrophobicContact CG-CG 4.49Å; M44-L68 HydrophobicContact SD-CB 3.89Å; L50-L68 HydrophobicContact CD1-CD1 4.49Å; V64-L68 HydrophobicContact CG1-CD1 3.98Å; V64-L68 HydrophobicContact CG1-CG 4.31Å; V64-L68 WeakPolarHBondContact O-CB 3.41Å; V64-L68 VanDerWaalsContact O-CG 3.29Å; V64-L68 WeakPolarHBondContact O-CG 3.21Å; V64-L68 PolarHBondContact O-N 2.8Å; R65-L68 PolarHBondContact O-N 3.07Å; F66-L68 VanDerWaalsContact C-N 3.33Å; F66-L68 PolarHBondContact O-N 3.12Å; L68-K71 PolarHBondContact O-N 3.21Å; L68-M72 WeakPolarHBondContact O-CG 3.47Å; L68-M72 PolarHBondContact O-N 3.04Å
69	M	96.8	Very high	95.6	Very high	111 Å²	111	76.5 Å²	76.5	55%	0.547	40%	0.398	S	S	.	.	H	α-helix	trans	-64	-43.3	175.6	-71.4	-65.7	-65.1	0	0	112.1	M44 R65 F66 K71 M72	M44-M69 HydrophobicContact CE-CG 4.49Å; M44-M69 HydrophobicContact CE-SD 3.68Å; M44-M69 HydrophobicContact SD-CG 3.79Å; M44-M69 HydrophobicContact SD-SD 3.64Å; M44-M69 VanDerWaalsContact SD-SD 3.64Å; R65-M69 VanDerWaalsContact O-CG 3.27Å; R65-M69 WeakPolarHBondContact O-CG 3.49Å; R65-M69 PolarHBondContact O-N 3.4Å; F66-M69 PolarHBondContact O-N 3.33Å; M69-K71 VanDerWaalsContact C-N 3.31Å; M69-K71 PolarHBondContact O-N 3.02Å; M69-M72 WeakPolarHBondContact O-CB 3.45Å; M69-M72 PolarHBondContact O-N 3.14Å; M69-M72 HydrophobicContact SD-SD 3.98Å
70	E	96.9	Very high	95	Very high	120 Å²	120	76.3 Å²	76.3	56%	0.561	41%	0.413	S	S	*	.	H	α-helix	trans	-62.4	-39.5	176.9	-72.2	-164.9	139.2	0	0	112	F66 N67 M72 L73	F66-E70 HydrophobicContact CD1-CG 4.37Å; F66-E70 HydrophobicContact CE1-CG 3.9Å; F66-E70 VanDerWaalsContact CE1-OE1 3.31Å; F66-E70 WeakPolarHBondContact CE1-OE1 3.32Å; F66-E70 WeakPolarHBondContact CE1-OE2 3.36Å; F66-E70 VanDerWaalsContact CZ-CD 3.49Å; F66-E70 HydrophobicContact CZ-CG 3.97Å; F66-E70 WeakPolarHBondContact CZ-OE1 3.25Å; F66-E70 PolarHBondContact O-N 3.36Å; N67-E70 PolarHBondContact O-N 3.05Å; E70-M72 PolarHBondContact O-N 2.96Å; E70-L73 PolarHBondContact O-N 3.42Å
71	K	96.1	Very high	94.1	Very high	100 Å²	100	80.2 Å²	80.2	44%	0.435	43%	0.428	S	S	.	.	H	α-helix	trans	-66.9	-13.9	178	-71.5	172.5	-178.3	178	0	113.7	Y40 N67 L68 M69 L73 P75	Y40-K71 HydrophobicContact CD2-CB 4.26Å; Y40-K71 HydrophobicContact CE2-CB 3.57Å; N67-K71 VanDerWaalsContact O-CG 3.26Å; N67-K71 WeakPolarHBondContact O-CG 3.28Å; N67-K71 PolarHBondContact O-N 3.45Å; N67-K71 VanDerWaalsContact O-N 3.14Å; L68-K71 PolarHBondContact O-N 3.21Å; M69-K71 VanDerWaalsContact C-N 3.31Å; M69-K71 PolarHBondContact O-N 3.02Å; K71-L73 VanDerWaalsContact C-N 3.32Å; K71-L73 PolarHBondContact O-N 3.39Å; K71-P75 WeakPolarHBondContact O-CB 3.34Å
72	M	95.4	Very high	92.9	Very high	43 Å²	43	83.5 Å²	83.5	21%	0.212	44%	0.442	C	S	.	.	T	Hydrogen-bonded Turn	trans	-70.2	-25.3	180	-66	-169.3	77.9	0	0	113.8	R37 Y40 C41 M44 L68 M69 E70	R37-M72 HydrophobicContact CB-CE 4.27Å; R37-M72 HydrophobicContact CG-CE 4.41Å; R37-M72 PolarHBondContact NE-O 3.18Å; R37-M72 PolarHBondContact NH2-O 3.45Å; Y40-M72 HydrophobicContact CD2-CG 4.12Å; C41-M72 VanDerWaalsContact SG-CE 3.53Å; M44-M72 HydrophobicContact CE-SD 3.85Å; L68-M72 WeakPolarHBondContact O-CG 3.47Å; L68-M72 PolarHBondContact O-N 3.04Å; M69-M72 WeakPolarHBondContact O-CB 3.45Å; M69-M72 PolarHBondContact O-N 3.14Å; M69-M72 HydrophobicContact SD-SD 3.98Å; E70-M72 PolarHBondContact O-N 2.96Å
73	L	93.5	Very high	91.3	Very high	146 Å²	146	85.7 Å²	85.7	76%	0.764	45%	0.45	S	S	*	.	S	Bend	trans	-61.2	-54.3	-175.3	-179.9	63.4	0	0	0	111	R37 E70 K71	R37-L73 PolarHBondContact NH2-O 3.07Å; E70-L73 PolarHBondContact O-N 3.42Å; K71-L73 VanDerWaalsContact C-N 3.32Å; K71-L73 PolarHBondContact O-N 3.39Å
74	Q	92.9	Very high	89.5	Confident	101 Å²	101	86.5 Å²	86.5	47%	0.472	46%	0.464	S	S	.	.			trans	-145.3	71.5	-176	-166.7	176.1	57.5	0	0	111.4	C76 G77 P78	Q74-C76 VanDerWaalsContact C-N 3.28Å; Q74-C76 PolarHBondContact O-N 2.96Å; Q74-G77 VanDerWaalsContact CD-C 3.42Å; Q74-G77 WeakPolarHBondContact CG-O 3.27Å; Q74-G77 PolarHBondContact O-N 2.94Å; Q74-P78 VanDerWaalsContact NE2-CA 3.27Å
75	P	95.4	Very high	87.7	Confident	29 Å²	29	92.7 Å²	92.7	19%	0.188	50%	0.497	C	S	.	.	T	Hydrogen-bonded Turn	trans	-68.7	-25.1	-174.1	25.8	-34.4	0	0	0	114.2	V33 H36 R37 Y40 K71	V33-P75 HydrophobicContact CG2-CG 3.59Å; H36-P75 HydrophobicContact CB-CB 3.66Å; H36-P75 HydrophobicContact CB-CG 3.76Å; R37-P75 HydrophobicContact CG-CG 4.46Å; Y40-P75 HydrophobicContact CE2-CB 3.88Å; K71-P75 WeakPolarHBondContact O-CB 3.34Å
76	C	94.2	Very high	85.3	Confident	41 Å²	41	94.5 Å²	94.5	28%	0.277	54%	0.538	S	S	.	.	T	Hydrogen-bonded Turn	trans	-109.5	15.3	-175.4	-53.9	0	0	0	0	112.9	H36 Q74	H36-C76 PolarHBondContact ND1-SG 3.42Å; Q74-C76 VanDerWaalsContact C-N 3.28Å; Q74-C76 PolarHBondContact O-N 2.96Å
77	G	92.6	Very high	84.7	Confident	25 Å²	25	94.1 Å²	94.1	26%	0.258	54%	0.542	S	S	.	.			trans	70.1	-176.8	-171.6	0	0	0	0	0	113.3	W29 Q74	W29-G77 WeakPolarHBondContact CZ2-O 3.35Å; W29-G77 PolarHBondContact NE1-O 3.04Å; Q74-G77 VanDerWaalsContact CD-C 3.42Å; Q74-G77 WeakPolarHBondContact CG-O 3.27Å; Q74-G77 PolarHBondContact O-N 2.94Å
78	P	91.8	Very high	84.1	Confident	95 Å²	95	96.9 Å²	96.9	62%	0.617	56%	0.559	S	S	*	*	S	Bend	trans	-57.9	145.7	176.3	-23.6	34.4	0	0	0	112.6	W29 Q74	W29-P78 PolarHBondContact NE1-O 3.25Å; Q74-P78 VanDerWaalsContact NE2-CA 3.27Å
79	P	88.4	Confident	83.4	Confident	70 Å²	70	101.5 Å²	101.5	46%	0.455	59%	0.586	S	S	.	*	P	Polyproline II helix	trans	-61.5	153	169.4	28.2	-33.1	0	0	0	110	W29	W29-P79 HydrophobicContact CD2-CB 3.78Å; W29-P79 HydrophobicContact CE3-CB 3.98Å; W29-P79 HydrophobicContact CG-CB 4.24Å; W29-P79 HydrophobicContact CH2-CB 4.33Å; W29-P79 HydrophobicContact CH2-CG 4.4Å; W29-P79 HydrophobicContact CZ2-CB 4.13Å; W29-P79 HydrophobicContact CZ2-CG 4.31Å; W29-P79 HydrophobicContact CZ3-CB 4.25Å
80	A	83.6	Confident	82.6	Confident	90 Å²	90	100.9 Å²	100.9	74%	0.744	59%	0.588	S	S	*	*	P	Polyproline II helix	trans	-64.3	148.5	171.7	0	0	0	0	0	110.2
81	D	78.4	Confident	81.7	Confident	151 Å²	151	99.8 Å²	99.8	81%	0.807	59%	0.59	S	S	*	*	P	Polyproline II helix	trans	-58.8	140.8	174.8	-61.3	-41.6	0	0	0	109.9
82	K	71.9	Confident	80.7	Confident	150 Å²	150	99.7 Å²	99.7	65%	0.652	60%	0.601	S	S	*	*	P	Polyproline II helix	trans	-66.5	145	178.7	-70.2	-179	-177.9	175.9	0	108.7	D84 D85	K82-D84 PolarHBondContact O-N 3.1Å; K82-D85 PolarHBondContact O-N 2.98Å; K82-D85 VanDerWaalsContact O-N 3.1Å
83	P	64.8	Low	79.6	Confident	119 Å²	119	103.8 Å²	103.8	77%	0.773	63%	0.628	S	S	*	*	G	3₁₀ helix	trans	-62	-11.9	-178	24.5	-33.8	0	0	0	114.3
84	D	60.6	Low	78.6	Confident	147 Å²	147	100.5 Å²	100.5	79%	0.786	62%	0.618	S	S	*	*	G	3₁₀ helix	trans	-86.2	-5.7	178.7	-60	-38.2	0	0	0	113.8	K82	K82-D84 PolarHBondContact O-N 3.1Å
85	D	58.8	Low	77.4	Confident	132 Å²	132	100.5 Å²	100.5	71%	0.706	63%	0.63	S	S	*	*	G	3₁₀ helix	trans	-106	17.2	-175.8	-66.4	-49.8	0	0	0	113.5	K82	K82-D85 PolarHBondContact O-N 2.98Å; K82-D85 VanDerWaalsContact O-N 3.1Å
86	A	48.1	Very low	75.7	Confident	157 Å²	157	107 Å²	107	100%	1.298	67%	0.67	S	S	*	*			trans	-123.7	0	-179.3	0	0	0	0	0	114.1

Retrieved 86 of 86 residues in 55.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).