HRK_HUMAN Loading...

Activator of apoptosis harakiri

Promotes apoptosis.

AlphaFold DB , UniProt , Accession O00198, Species HUMAN (Homo sapiens, Human), Gene HRK, Length 91 aa.

						>HRK_HUMAN|O00198|HRK
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.1	Very low	53.9	Low	246 Å²	246	133.1 Å²	133.1	100%	1.212	73%	0.727	S	S	*	*				0	121.8	0	-72.1	170.3	153.2	0	0	108.5
2	C	47.2	Very low	53.8	Low	95 Å²	95	131.5 Å²	131.5	64%	0.642	73%	0.728	S	S	*	*			trans	-80.5	128.3	179.7	-89.3	0	0	0	0	110.7	C4	C2-C4 VanDerWaalsContact C-N 3.26Å; C2-C4 PolarHBondContact O-N 3.29Å
3	P	57.2	Low	54.1	Low	108 Å²	108	131.9 Å²	131.9	70%	0.701	74%	0.74	S	S	*	*			trans	-85.3	64.2	-178.2	35.4	-34.7	0	0	0	110.5
4	C	55.4	Low	54.1	Low	14 Å²	14	128.4 Å²	128.4	10%	0.095	74%	0.736	C	S	.	*			trans	-101.6	113.6	177.8	-62.6	0	0	0	0	109.2	C2 L6 H7 C16 C18	C2-C4 VanDerWaalsContact C-N 3.26Å; C2-C4 PolarHBondContact O-N 3.29Å; C4-L6 PolarHBondContact O-N 2.88Å; C4-L6 VanDerWaalsContact O-N 3.09Å; C4-H7 PolarHBondContact O-N 2.94Å; C4-C16 VanDerWaalsContact SG-SG 3.65Å; C4-C18 HydrophobicContact CB-CB 4.37Å; C4-C18 WeakPolarHBondContact SG-CB 3.14Å
5	P	58.8	Low	54.2	Low	122 Å²	122	128 Å²	128	79%	0.792	74%	0.736	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.1	-14.6	-176.3	23.7	-32	0	0	0	113.7	H7	P5-H7 VanDerWaalsContact C-N 3.34Å
6	L	55.3	Low	54.6	Low	146 Å²	146	121.3 Å²	121.3	76%	0.764	70%	0.699	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.6	-20.3	177.5	-81.7	151.9	0	0	0	113.9	C4	C4-L6 PolarHBondContact O-N 2.88Å; C4-L6 VanDerWaalsContact O-N 3.09Å
7	H	53.8	Low	54.8	Low	117 Å²	117	119.1 Å²	119.1	54%	0.542	70%	0.699	S	S	.	*			trans	-114.4	90.9	172.8	-73.6	-76.1	0	0	0	109.1	C4 P5 G9	C4-H7 PolarHBondContact O-N 2.94Å; P5-H7 VanDerWaalsContact C-N 3.34Å; H7-G9 PolarHBondContact O-N 2.82Å
8	R	56.7	Low	55	Low	243 Å²	243	114.8 Å²	114.8	92%	0.917	68%	0.675	S	S	*	*	S	Bend	trans	-66.7	60.2	166.7	-77.1	-172.7	174.8	168	-1.6	111.5	R10	R8-R10 VanDerWaalsContact C-N 3.28Å; R8-R10 PolarHBondContact O-N 3.42Å; R8-R10 VanDerWaalsContact O-N 3.1Å
9	G	55.6	Low	54.9	Low	81 Å²	81	110.4 Å²	110.4	84%	0.835	65%	0.651	S	S	*	*	S	Bend	trans	64.7	18.1	168.5	0	0	0	0	0	116.9	H7	H7-G9 PolarHBondContact O-N 2.82Å
10	R	50.6	Low	55.1	Low	232 Å²	232	107.6 Å²	107.6	88%	0.875	64%	0.641	S	S	*	*			trans	-120.6	95.1	-179.9	-128.3	179.8	-137.1	-162.7	3.9	110.7	R8	R8-R10 VanDerWaalsContact C-N 3.28Å; R8-R10 PolarHBondContact O-N 3.42Å; R8-R10 VanDerWaalsContact O-N 3.1Å
11	G	54.3	Low	55.3	Low	60 Å²	60	104.4 Å²	104.4	62%	0.619	63%	0.631	S	S	*	*	S	Bend	trans	151.3	144.1	169.3	0	0	0	0	0	113.5
12	P	52.8	Low	55.8	Low	114 Å²	114	99.7 Å²	99.7	74%	0.74	60%	0.599	S	S	*	*			trans	-60.6	163.7	174.6	28.3	-33.7	0	0	0	110.4	A14	P12-A14 PolarHBondContact O-N 3.48Å
13	P	57.2	Low	56.4	Low	137 Å²	137	100.3 Å²	100.3	89%	0.89	60%	0.596	S	S	*	*			trans	-72.9	61.6	-173.9	33.5	-37.1	0	0	0	111.7
14	A	54.2	Low	56.6	Low	82 Å²	82	96.9 Å²	96.9	68%	0.678	58%	0.58	S	S	*	*			trans	-66.3	131.3	159.3	0	0	0	0	0	107	P12 C16	P12-A14 PolarHBondContact O-N 3.48Å; A14-C16 PolarHBondContact O-N 3.1Å
15	V	56.4	Low	56.9	Low	123 Å²	123	102.1 Å²	102.1	75%	0.745	61%	0.606	S	S	*	*			trans	-48.3	106.8	-176.9	-174.6	0	0	0	0	109.3	A17	V15-A17 PolarHBondContact O-N 3.27Å
16	C	59.4	Low	57.1	Low	21 Å²	21	105.4 Å²	105.4	14%	0.142	60%	0.603	C	S	.	*			trans	-58.9	129.3	-176.9	-178	0	0	0	0	109.1	C4 A14 C18 S19 A20	C4-C16 VanDerWaalsContact SG-SG 3.65Å; A14-C16 PolarHBondContact O-N 3.1Å; C16-C18 PolarHBondContact O-N 3.29Å; C16-S19 PolarHBondContact O-N 3.32Å; C16-S19 PolarHBondContact O-OG 3.36Å; C16-A20 PolarHBondContact O-N 3.02Å
17	A	58.5	Low	57.8	Low	83 Å²	83	101.2 Å²	101.2	69%	0.686	59%	0.586	S	S	*	*	H	α-helix	trans	-53.7	-27.4	178.2	0	0	0	0	0	112.7	V15 S19 A20 G21	V15-A17 PolarHBondContact O-N 3.27Å; A17-S19 VanDerWaalsContact C-N 3.33Å; A17-S19 PolarHBondContact O-N 3.45Å; A17-A20 WeakPolarHBondContact O-CB 3.49Å; A17-A20 PolarHBondContact O-N 2.91Å; A17-G21 PolarHBondContact O-N 2.91Å
18	C	57.9	Low	58.7	Low	42 Å²	42	98.4 Å²	98.4	28%	0.284	58%	0.579	S	S	.	*	H	α-helix	trans	-65.4	-29.6	173.9	-57.7	0	0	0	0	113.9	C4 C16 R22	C4-C18 HydrophobicContact CB-CB 4.37Å; C4-C18 WeakPolarHBondContact SG-CB 3.14Å; C16-C18 PolarHBondContact O-N 3.29Å; C18-R22 PolarHBondContact O-N 3.41Å
19	S	53.9	Low	59.7	Low	31 Å²	31	89.3 Å²	89.3	22%	0.217	56%	0.556	C	S	.	*	H	α-helix	trans	-75.3	-34.3	172.6	63.3	0	0	0	0	111.3	C16 A17 G21 R22 L23	C16-S19 PolarHBondContact O-N 3.32Å; C16-S19 PolarHBondContact O-OG 3.36Å; A17-S19 VanDerWaalsContact C-N 3.33Å; A17-S19 PolarHBondContact O-N 3.45Å; S19-G21 PolarHBondContact O-N 2.86Å; S19-R22 PolarHBondContact O-N 3.05Å; S19-L23 WeakPolarHBondContact O-CB 3.3Å; S19-L23 VanDerWaalsContact O-CG 3.3Å; S19-L23 WeakPolarHBondContact O-CG 3.41Å; S19-L23 PolarHBondContact O-N 3.31Å
20	A	58.6	Low	60.9	Low	55 Å²	55	88.2 Å²	88.2	46%	0.455	54%	0.539	S	S	.	.	H	α-helix	trans	-61.3	-41.9	172	0	0	0	0	0	111.8	C16 A17 L23 G24	C16-A20 PolarHBondContact O-N 3.02Å; A17-A20 WeakPolarHBondContact O-CB 3.49Å; A17-A20 PolarHBondContact O-N 2.91Å; A20-L23 PolarHBondContact O-N 3.27Å; A20-G24 PolarHBondContact O-N 2.93Å
21	G	59.2	Low	62.4	Low	40 Å²	40	83.8 Å²	83.8	41%	0.412	53%	0.528	S	S	.	.	H	α-helix	trans	-62.3	-42.9	174	0	0	0	0	0	113.4	A17 S19 G24 L25	A17-G21 PolarHBondContact O-N 2.91Å; S19-G21 PolarHBondContact O-N 2.86Å; G21-G24 PolarHBondContact O-N 3.32Å; G21-L25 PolarHBondContact O-N 2.87Å
22	R	59.2	Low	63.9	Low	147 Å²	147	85.3 Å²	85.3	56%	0.555	52%	0.522	S	S	*	.	H	α-helix	trans	-67.8	-34.4	174.7	-69.4	-172.7	-142.7	-122.9	4.9	112.7	C18 S19 L25 R26	C18-R22 PolarHBondContact O-N 3.41Å; S19-R22 PolarHBondContact O-N 3.05Å; R22-L25 PolarHBondContact O-N 3.49Å; R22-R26 WeakPolarHBondContact O-CB 3.48Å; R22-R26 WeakPolarHBondContact O-CG 3.45Å; R22-R26 PolarHBondContact O-N 2.97Å
23	L	58.7	Low	65.4	Low	108 Å²	108	83.3 Å²	83.3	57%	0.565	51%	0.508	S	S	*	.	H	α-helix	trans	-66.8	-39.4	173.7	-76.6	163.5	0	0	0	111	S19 A20 R26 S27	S19-L23 WeakPolarHBondContact O-CB 3.3Å; S19-L23 VanDerWaalsContact O-CG 3.3Å; S19-L23 WeakPolarHBondContact O-CG 3.41Å; S19-L23 PolarHBondContact O-N 3.31Å; A20-L23 PolarHBondContact O-N 3.27Å; L23-R26 PolarHBondContact O-N 3.47Å; L23-S27 WeakPolarHBondContact O-CB 3.42Å; L23-S27 PolarHBondContact O-N 2.98Å; L23-S27 PolarHBondContact O-OG 3.17Å
24	G	61.6	Low	66.8	Low	36 Å²	36	78.8 Å²	78.8	37%	0.371	48%	0.482	S	S	.	.	H	α-helix	trans	-64.2	-39.4	172.4	0	0	0	0	0	113.5	A20 G21 S27 S28	A20-G24 PolarHBondContact O-N 2.93Å; G21-G24 PolarHBondContact O-N 3.32Å; G24-S27 WeakPolarHBondContact CA-OG 3.4Å; G24-S27 PolarHBondContact O-OG 2.99Å; G24-S28 WeakPolarHBondContact O-CB 3.4Å; G24-S28 PolarHBondContact O-N 2.92Å; G24-S28 PolarHBondContact O-OG 3.22Å
25	L	61.4	Low	68.4	Low	124 Å²	124	77.7 Å²	77.7	65%	0.649	47%	0.473	S	S	*	.	H	α-helix	trans	-68.5	-38	172.4	-87.5	146	0	0	0	112.5	G21 R22 S28 A29	G21-L25 PolarHBondContact O-N 2.87Å; R22-L25 PolarHBondContact O-N 3.49Å; L25-S28 PolarHBondContact O-OG 2.89Å; L25-A29 VanDerWaalsContact O-CB 3.25Å; L25-A29 WeakPolarHBondContact O-CB 3.41Å; L25-A29 PolarHBondContact O-N 3.44Å
26	R	64.7	Low	70	Confident	192 Å²	192	79.7 Å²	79.7	73%	0.725	47%	0.467	S	S	*	.	H	α-helix	trans	-69	-39.3	174.4	-82.1	-177	165.2	-174.6	-4.1	111.7	R22 L23 A30	R22-R26 WeakPolarHBondContact O-CB 3.48Å; R22-R26 WeakPolarHBondContact O-CG 3.45Å; R22-R26 PolarHBondContact O-N 2.97Å; L23-R26 PolarHBondContact O-N 3.47Å; R26-A30 VanDerWaalsContact O-CB 3.23Å; R26-A30 WeakPolarHBondContact O-CB 3.43Å; R26-A30 PolarHBondContact O-N 3.42Å
27	S	68.5	Low	71.6	Confident	58 Å²	58	84 Å²	84	41%	0.406	49%	0.488	S	S	.	.	H	α-helix	trans	-68.4	-40.9	177.4	65.6	0	0	0	0	111.1	L23 G24 A30 Q31	L23-S27 WeakPolarHBondContact O-CB 3.42Å; L23-S27 PolarHBondContact O-N 2.98Å; L23-S27 PolarHBondContact O-OG 3.17Å; G24-S27 WeakPolarHBondContact CA-OG 3.4Å; G24-S27 PolarHBondContact O-OG 2.99Å; S27-A30 PolarHBondContact O-N 3.22Å; S27-Q31 WeakPolarHBondContact O-CB 3.45Å; S27-Q31 VanDerWaalsContact O-CG 3.26Å; S27-Q31 WeakPolarHBondContact O-CG 3.43Å; S27-Q31 PolarHBondContact O-N 3.41Å
28	S	73.5	Confident	73.2	Confident	57 Å²	57	87.1 Å²	87.1	40%	0.399	49%	0.486	S	S	.	.	H	α-helix	trans	-65.8	-41.9	175	69.9	0	0	0	0	112.2	G24 L25 A30 Q31 L32	G24-S28 WeakPolarHBondContact O-CB 3.4Å; G24-S28 PolarHBondContact O-N 2.92Å; G24-S28 PolarHBondContact O-OG 3.22Å; L25-S28 PolarHBondContact O-OG 2.89Å; S28-A30 PolarHBondContact O-N 3.15Å; S28-Q31 PolarHBondContact O-N 3.32Å; S28-L32 WeakPolarHBondContact O-CB 3.31Å; S28-L32 PolarHBondContact O-N 3.16Å
29	A	77.3	Confident	74.7	Confident	52 Å²	52	87.9 Å²	87.9	43%	0.43	50%	0.495	S	S	.	.	H	α-helix	trans	-64.5	-38.5	174.3	0	0	0	0	0	112.5	L25 L32 T33	L25-A29 VanDerWaalsContact O-CB 3.25Å; L25-A29 WeakPolarHBondContact O-CB 3.41Å; L25-A29 PolarHBondContact O-N 3.44Å; A29-L32 PolarHBondContact O-N 2.93Å; A29-T33 WeakPolarHBondContact O-CB 3.45Å; A29-T33 PolarHBondContact O-N 3.49Å; A29-T33 PolarHBondContact O-OG1 2.82Å
30	A	80.4	Confident	76.5	Confident	59 Å²	59	91 Å²	91	49%	0.488	51%	0.509	S	S	.	.	H	α-helix	trans	-66.3	-42.2	175	0	0	0	0	0	111.5	R26 S27 S28 T33 A34	R26-A30 VanDerWaalsContact O-CB 3.23Å; R26-A30 WeakPolarHBondContact O-CB 3.43Å; R26-A30 PolarHBondContact O-N 3.42Å; S27-A30 PolarHBondContact O-N 3.22Å; S28-A30 PolarHBondContact O-N 3.15Å; A30-T33 PolarHBondContact O-N 2.91Å; A30-A34 VanDerWaalsContact O-CB 3.3Å; A30-A34 WeakPolarHBondContact O-CB 3.3Å; A30-A34 PolarHBondContact O-N 3.35Å
31	Q	83	Confident	78	Confident	138 Å²	138	90.1 Å²	90.1	65%	0.645	51%	0.506	S	S	*	.	H	α-helix	trans	-63	-42.9	174.9	-75.6	172.8	-14.7	0	0	111.8	S27 S28 A34 A35	S27-Q31 WeakPolarHBondContact O-CB 3.45Å; S27-Q31 VanDerWaalsContact O-CG 3.26Å; S27-Q31 WeakPolarHBondContact O-CG 3.43Å; S27-Q31 PolarHBondContact O-N 3.41Å; S28-Q31 PolarHBondContact O-N 3.32Å; Q31-A34 PolarHBondContact O-N 2.88Å; Q31-A35 WeakPolarHBondContact O-CB 3.26Å; Q31-A35 PolarHBondContact O-N 2.74Å
32	L	85.7	Confident	79.5	Confident	92 Å²	92	93.3 Å²	93.3	48%	0.482	51%	0.513	S	S	.	.	H	α-helix	trans	-65.9	-40.9	177.7	-173.7	139.1	0	0	0	111.7	S28 A29 A35 R36	S28-L32 WeakPolarHBondContact O-CB 3.31Å; S28-L32 PolarHBondContact O-N 3.16Å; A29-L32 PolarHBondContact O-N 2.93Å; L32-A35 PolarHBondContact O-N 3.47Å; L32-R36 VanDerWaalsContact CD2-CZ 3.46Å; L32-R36 WeakPolarHBondContact O-CG 3.5Å; L32-R36 PolarHBondContact O-N 3.19Å
33	T	83.9	Confident	81	Confident	73 Å²	73	90.2 Å²	90.2	45%	0.448	51%	0.505	S	S	.	.	H	α-helix	trans	-63.9	-43.7	172.8	-54.6	0	0	0	0	111.1	A29 A30 A35 R36 L37	A29-T33 WeakPolarHBondContact O-CB 3.45Å; A29-T33 PolarHBondContact O-N 3.49Å; A29-T33 PolarHBondContact O-OG1 2.82Å; A30-T33 PolarHBondContact O-N 2.91Å; T33-A35 VanDerWaalsContact C-N 3.32Å; T33-A35 PolarHBondContact O-N 3.05Å; T33-R36 PolarHBondContact O-N 3.15Å; T33-L37 HydrophobicContact CG2-CD1 4.27Å; T33-L37 WeakPolarHBondContact O-CG 3.41Å; T33-L37 PolarHBondContact O-N 3.06Å
34	A	87.2	Confident	82.6	Confident	42 Å²	42	89.9 Å²	89.9	35%	0.347	50%	0.503	S	S	.	.	H	α-helix	trans	-62.3	-38.6	176.5	0	0	0	0	0	112.1	A30 Q31 L37 K38	A30-A34 VanDerWaalsContact O-CB 3.3Å; A30-A34 WeakPolarHBondContact O-CB 3.3Å; A30-A34 PolarHBondContact O-N 3.35Å; Q31-A34 PolarHBondContact O-N 2.88Å; A34-L37 PolarHBondContact O-N 3.39Å; A34-K38 WeakPolarHBondContact O-CG 3.33Å; A34-K38 PolarHBondContact O-N 3.46Å
35	A	87.9	Confident	83.9	Confident	59 Å²	59	94.3 Å²	94.3	49%	0.488	51%	0.514	S	S	.	.	H	α-helix	trans	-64.3	-42	174.8	0	0	0	0	0	111.8	Q31 L32 T33 K38 A39	Q31-A35 WeakPolarHBondContact O-CB 3.26Å; Q31-A35 PolarHBondContact O-N 2.74Å; L32-A35 PolarHBondContact O-N 3.47Å; T33-A35 VanDerWaalsContact C-N 3.32Å; T33-A35 PolarHBondContact O-N 3.05Å; A35-K38 PolarHBondContact O-N 2.8Å; A35-A39 PolarHBondContact O-N 3.02Å
36	R	90.3	Very high	85.1	Confident	165 Å²	165	94.2 Å²	94.2	62%	0.623	51%	0.511	S	S	*	.	H	α-helix	trans	-63	-42.7	174.5	-71.7	175.1	177.8	-178.4	-0.6	112.1	L32 T33 A39 L40	L32-R36 VanDerWaalsContact CD2-CZ 3.46Å; L32-R36 WeakPolarHBondContact O-CG 3.5Å; L32-R36 PolarHBondContact O-N 3.19Å; T33-R36 PolarHBondContact O-N 3.15Å; R36-A39 PolarHBondContact O-N 2.85Å; R36-L40 WeakPolarHBondContact O-CG 3.45Å; R36-L40 PolarHBondContact O-N 3.43Å
37	L	92	Very high	86.2	Confident	111 Å²	111	91.4 Å²	91.4	58%	0.581	50%	0.5	S	S	*	.	H	α-helix	trans	-65.4	-38.7	176.9	-69.6	174.7	0	0	0	112	T33 A34 L40 G41	T33-L37 HydrophobicContact CG2-CD1 4.27Å; T33-L37 WeakPolarHBondContact O-CG 3.41Å; T33-L37 PolarHBondContact O-N 3.06Å; A34-L37 PolarHBondContact O-N 3.39Å; L37-L40 PolarHBondContact O-N 3.3Å; L37-G41 PolarHBondContact O-N 3.48Å
38	K	91.8	Very high	87	Confident	149 Å²	149	91.3 Å²	91.3	65%	0.648	50%	0.497	S	S	*	.	H	α-helix	trans	-61.9	-46.6	172.6	-76.7	175.3	-179.1	176.4	0	111.6	A34 A35 L40 G41 D42	A34-K38 WeakPolarHBondContact O-CG 3.33Å; A34-K38 PolarHBondContact O-N 3.46Å; A35-K38 PolarHBondContact O-N 2.8Å; K38-L40 VanDerWaalsContact C-N 3.32Å; K38-L40 PolarHBondContact O-N 3.44Å; K38-G41 CarbonylContact O-C 3.03Å; K38-G41 WeakPolarHBondContact O-CA 3.4Å; K38-G41 PolarHBondContact O-N 2.84Å; K38-D42 PolarHBondContact O-N 3.36Å
39	A	89.3	Confident	87.6	Confident	57 Å²	57	92.8 Å²	92.8	47%	0.471	50%	0.499	S	S	.	.	H	α-helix	trans	-59	-41.4	177.4	0	0	0	0	0	112.5	A35 R36 D42 E43	A35-A39 PolarHBondContact O-N 3.02Å; R36-A39 PolarHBondContact O-N 2.85Å; A39-D42 PolarHBondContact O-N 3.47Å; A39-E43 WeakPolarHBondContact O-CB 3.36Å; A39-E43 PolarHBondContact O-N 3.39Å
40	L	91.8	Very high	87.7	Confident	96 Å²	96	98.2 Å²	98.2	50%	0.503	51%	0.508	S	S	.	.	H	α-helix	trans	-64.5	-39.4	173.2	-71.8	171.6	0	0	0	112.1	R36 L37 K38 E43 L44	R36-L40 WeakPolarHBondContact O-CG 3.45Å; R36-L40 PolarHBondContact O-N 3.43Å; L37-L40 PolarHBondContact O-N 3.3Å; K38-L40 VanDerWaalsContact C-N 3.32Å; K38-L40 PolarHBondContact O-N 3.44Å; L40-E43 PolarHBondContact O-N 3.37Å; L40-L44 WeakPolarHBondContact O-CB 3.47Å; L40-L44 VanDerWaalsContact O-CG 3.29Å; L40-L44 WeakPolarHBondContact O-CG 3.5Å; L40-L44 PolarHBondContact O-N 3.29Å
41	G	90.7	Very high	87.8	Confident	38 Å²	38	101.9 Å²	101.9	39%	0.392	51%	0.509	S	S	.	.	H	α-helix	trans	-60.7	-44.9	174	0	0	0	0	0	112.6	L37 K38 L44 H45	L37-G41 PolarHBondContact O-N 3.48Å; K38-G41 CarbonylContact O-C 3.03Å; K38-G41 WeakPolarHBondContact O-CA 3.4Å; K38-G41 PolarHBondContact O-N 2.84Å; G41-L44 PolarHBondContact O-N 2.97Å; G41-H45 WeakPolarHBondContact O-CB 3.29Å; G41-H45 PolarHBondContact O-N 2.95Å
42	D	91.4	Very high	87.5	Confident	106 Å²	106	104 Å²	104	57%	0.567	51%	0.511	S	S	*	.	H	α-helix	trans	-66.2	-40.8	178.2	-69.3	-31.4	0	0	0	111.6	K38 A39 H45 Q46	K38-D42 PolarHBondContact O-N 3.36Å; A39-D42 PolarHBondContact O-N 3.47Å; D42-H45 WeakPolarHBondContact O-CB 3.45Å; D42-H45 PolarHBondContact O-N 3.23Å; D42-Q46 WeakPolarHBondContact O-CG 3.43Å; D42-Q46 PolarHBondContact O-N 3.49Å
43	E	90.9	Very high	87.1	Confident	82 Å²	82	105.4 Å²	105.4	38%	0.383	51%	0.51	S	S	.	.	H	α-helix	trans	-63	-44.2	175.3	-168.5	-175.4	174.3	0	0	111.5	A39 L40 H45 Q46 R47	A39-E43 WeakPolarHBondContact O-CB 3.36Å; A39-E43 PolarHBondContact O-N 3.39Å; L40-E43 PolarHBondContact O-N 3.37Å; E43-H45 VanDerWaalsContact C-N 3.3Å; E43-H45 PolarHBondContact O-N 2.78Å; E43-Q46 PolarHBondContact O-N 3.32Å; E43-R47 WeakPolarHBondContact O-CB 3.19Å; E43-R47 WeakPolarHBondContact O-CG 3.29Å; E43-R47 PolarHBondContact O-N 3.1Å; E43-R47 IonicContact OE1-CZ 3.26Å; E43-R47 VanDerWaalsContact OE1-CZ 3.26Å; E43-R47 IonicContact OE1-NE 3.29Å; E43-R47 PolarHBondContact OE1-NE 3.33Å; E43-R47 IonicContact OE1-NH2 2.67Å; E43-R47 PolarHBondContact OE1-NH2 2.99Å
44	L	91.3	Very high	86.6	Confident	101 Å²	101	104.8 Å²	104.8	53%	0.529	51%	0.513	S	S	.	.	H	α-helix	trans	-63.1	-37.6	174.8	-73.6	173.9	0	0	0	111.8	L40 G41 T48	L40-L44 WeakPolarHBondContact O-CB 3.47Å; L40-L44 VanDerWaalsContact O-CG 3.29Å; L40-L44 WeakPolarHBondContact O-CG 3.5Å; L40-L44 PolarHBondContact O-N 3.29Å; G41-L44 PolarHBondContact O-N 2.97Å; L44-T48 VanDerWaalsContact O-CB 3.31Å; L44-T48 WeakPolarHBondContact O-CB 3.47Å; L44-T48 PolarHBondContact O-N 3.46Å; L44-T48 PolarHBondContact O-OG1 3.43Å
45	H	89	Confident	85.5	Confident	130 Å²	130	110.4 Å²	110.4	60%	0.602	53%	0.525	S	S	*	.	H	α-helix	trans	-63.5	-48.8	175.5	-171.6	83.4	0	0	0	111	G41 D42 E43 R47 T48 M49	G41-H45 WeakPolarHBondContact O-CB 3.29Å; G41-H45 PolarHBondContact O-N 2.95Å; D42-H45 WeakPolarHBondContact O-CB 3.45Å; D42-H45 PolarHBondContact O-N 3.23Å; E43-H45 VanDerWaalsContact C-N 3.3Å; E43-H45 PolarHBondContact O-N 2.78Å; H45-R47 PolarHBondContact O-N 3.5Å; H45-T48 CarbonylContact O-C 3.56Å; H45-T48 PolarHBondContact O-N 2.88Å; H45-T48 VanDerWaalsContact O-N 3.16Å; H45-M49 PolarHBondContact O-N 2.96Å
46	Q	87.2	Confident	84.2	Confident	122 Å²	122	112.4 Å²	112.4	57%	0.57	54%	0.535	S	S	*	.	H	α-helix	trans	-60.3	-46.5	176.3	-74.8	-175.4	-14.8	0	0	112.1	D42 E43 T48 M49 W50	D42-Q46 WeakPolarHBondContact O-CG 3.43Å; D42-Q46 PolarHBondContact O-N 3.49Å; E43-Q46 PolarHBondContact O-N 3.32Å; Q46-T48 VanDerWaalsContact C-N 3.25Å; Q46-T48 PolarHBondContact O-N 3.01Å; Q46-M49 WeakPolarHBondContact O-CB 3.44Å; Q46-M49 PolarHBondContact O-N 3.49Å; Q46-M49 VanDerWaalsContact O-N 3.15Å; Q46-W50 PolarHBondContact O-N 3.38Å
47	R	87	Confident	82.7	Confident	132 Å²	132	115.5 Å²	115.5	50%	0.498	55%	0.547	S	S	.	.	H	α-helix	trans	-59.3	-38	175.4	-73.2	178.8	-178.2	-166	2.7	111.9	E43 H45 R51	E43-R47 WeakPolarHBondContact O-CB 3.19Å; E43-R47 WeakPolarHBondContact O-CG 3.29Å; E43-R47 PolarHBondContact O-N 3.1Å; E43-R47 IonicContact OE1-CZ 3.26Å; E43-R47 VanDerWaalsContact OE1-CZ 3.26Å; E43-R47 IonicContact OE1-NE 3.29Å; E43-R47 PolarHBondContact OE1-NE 3.33Å; E43-R47 IonicContact OE1-NH2 2.67Å; E43-R47 PolarHBondContact OE1-NH2 2.99Å; H45-R47 PolarHBondContact O-N 3.5Å; R47-R51 WeakPolarHBondContact O-CB 3.45Å; R47-R51 WeakPolarHBondContact O-CG 3.4Å; R47-R51 PolarHBondContact O-N 3.29Å; R47-R51 PolarHBondContact O-NE 2.83Å
48	T	86.1	Confident	81	Confident	57 Å²	57	120.1 Å²	120.1	35%	0.35	56%	0.557	S	S	.	*	H	α-helix	trans	-70.1	-40	176.7	-58.4	0	0	0	0	111.2	L44 H45 Q46 R51 R52	L44-T48 VanDerWaalsContact O-CB 3.31Å; L44-T48 WeakPolarHBondContact O-CB 3.47Å; L44-T48 PolarHBondContact O-N 3.46Å; L44-T48 PolarHBondContact O-OG1 3.43Å; H45-T48 CarbonylContact O-C 3.56Å; H45-T48 PolarHBondContact O-N 2.88Å; H45-T48 VanDerWaalsContact O-N 3.16Å; Q46-T48 VanDerWaalsContact C-N 3.25Å; Q46-T48 PolarHBondContact O-N 3.01Å; T48-R51 PolarHBondContact O-N 2.89Å; T48-R52 WeakPolarHBondContact O-CG 3.29Å; T48-R52 PolarHBondContact O-N 3.34Å
49	M	85.3	Confident	79.1	Confident	87 Å²	87	117.6 Å²	117.6	43%	0.429	56%	0.564	S	S	.	*	H	α-helix	trans	-61.6	-46.3	175.6	-163.6	-166	-160.7	0	0	111.4	H45 Q46 R52 R53	H45-M49 PolarHBondContact O-N 2.96Å; Q46-M49 WeakPolarHBondContact O-CB 3.44Å; Q46-M49 PolarHBondContact O-N 3.49Å; Q46-M49 VanDerWaalsContact O-N 3.15Å; M49-R52 PolarHBondContact O-N 2.67Å; M49-R53 VanDerWaalsContact CE-NH2 3.27Å; M49-R53 WeakPolarHBondContact O-CG 3.26Å; M49-R53 PolarHBondContact O-N 2.84Å
50	W	80.6	Confident	77.4	Confident	166 Å²	166	119.2 Å²	119.2	63%	0.629	57%	0.569	S	S	*	*	H	α-helix	trans	-61.3	-43.5	174.6	-74.7	118.7	0	0	0	112.3	Q46 R52 R53 A54	Q46-W50 PolarHBondContact O-N 3.38Å; W50-R52 PolarHBondContact O-N 3.42Å; W50-R53 PolarHBondContact O-N 3.39Å; W50-A54 WeakPolarHBondContact O-CB 3.3Å; W50-A54 PolarHBondContact O-N 2.92Å
51	R	81.2	Confident	75.7	Confident	137 Å²	137	118.8 Å²	118.8	52%	0.517	58%	0.58	S	S	.	*	H	α-helix	trans	-62.3	-40	174.9	-80.9	-173.1	-86.2	-149.4	1.6	112.7	R47 T48 A54 R55	R47-R51 WeakPolarHBondContact O-CB 3.45Å; R47-R51 WeakPolarHBondContact O-CG 3.4Å; R47-R51 PolarHBondContact O-N 3.29Å; R47-R51 PolarHBondContact O-NE 2.83Å; T48-R51 PolarHBondContact O-N 2.89Å; R51-A54 PolarHBondContact O-N 3.03Å; R51-R55 WeakPolarHBondContact O-CB 3.43Å; R51-R55 WeakPolarHBondContact O-CG 3.36Å; R51-R55 PolarHBondContact O-N 3.22Å
52	R	77	Confident	74.1	Confident	181 Å²	181	123.7 Å²	123.7	68%	0.683	61%	0.605	S	S	*	*	H	α-helix	trans	-65.5	-43.3	175	-74.2	-175.5	-168.6	-130.7	6	111.6	T48 M49 W50 A54 R55 S56	T48-R52 WeakPolarHBondContact O-CG 3.29Å; T48-R52 PolarHBondContact O-N 3.34Å; M49-R52 PolarHBondContact O-N 2.67Å; W50-R52 PolarHBondContact O-N 3.42Å; R52-A54 VanDerWaalsContact C-N 3.34Å; R52-A54 PolarHBondContact O-N 3.35Å; R52-R55 CarbonylContact O-C 3.59Å; R52-R55 PolarHBondContact O-N 2.92Å; R52-S56 PolarHBondContact O-N 3.03Å
53	R	78.2	Confident	72.1	Confident	122 Å²	122	122 Å²	122	46%	0.46	61%	0.612	S	S	.	*	H	α-helix	trans	-62.8	-38	174.2	-74.5	178.9	177.9	169.6	-2.2	112.5	M49 W50 S56 R57	M49-R53 VanDerWaalsContact CE-NH2 3.27Å; M49-R53 WeakPolarHBondContact O-CG 3.26Å; M49-R53 PolarHBondContact O-N 2.84Å; W50-R53 PolarHBondContact O-N 3.39Å; R53-S56 PolarHBondContact O-N 3.28Å; R53-S56 PolarHBondContact O-OG 3.45Å; R53-R57 PolarHBondContact O-N 3.08Å
54	A	72.5	Confident	70.6	Confident	61 Å²	61	122.5 Å²	122.5	50%	0.504	63%	0.63	S	S	.	*	H	α-helix	trans	-67.4	-40.3	174.9	0	0	0	0	0	111.7	W50 R51 R52 R57 R58	W50-A54 WeakPolarHBondContact O-CB 3.3Å; W50-A54 PolarHBondContact O-N 2.92Å; R51-A54 PolarHBondContact O-N 3.03Å; R52-A54 VanDerWaalsContact C-N 3.34Å; R52-A54 PolarHBondContact O-N 3.35Å; A54-R57 PolarHBondContact O-N 3.45Å; A54-R58 PolarHBondContact O-N 3.1Å
55	R	64.6	Low	69.2	Low	160 Å²	160	125.6 Å²	125.6	60%	0.604	65%	0.647	S	S	*	*	H	α-helix	trans	-68.7	-31.3	173.4	-74.5	-177.3	-164.3	169.9	2.8	113	R51 R52 R57 R58	R51-R55 WeakPolarHBondContact O-CB 3.43Å; R51-R55 WeakPolarHBondContact O-CG 3.36Å; R51-R55 PolarHBondContact O-N 3.22Å; R52-R55 CarbonylContact O-C 3.59Å; R52-R55 PolarHBondContact O-N 2.92Å; R55-R57 PolarHBondContact O-N 2.98Å; R55-R58 CarbonylContact O-C 3.57Å; R55-R58 PolarHBondContact O-N 3.47Å; R55-R58 VanDerWaalsContact O-N 3.1Å
56	S	61	Low	68.1	Low	100 Å²	100	121.8 Å²	121.8	70%	0.699	63%	0.633	S	S	*	*	H	α-helix	trans	-67.6	-22.3	175.6	75.6	0	0	0	0	112.4	R52 R53	R52-S56 PolarHBondContact O-N 3.03Å; R53-S56 PolarHBondContact O-N 3.28Å; R53-S56 PolarHBondContact O-OG 3.45Å
57	R	58.8	Low	67.4	Low	230 Å²	230	122.6 Å²	122.6	87%	0.868	65%	0.647	S	S	*	*	H	α-helix	trans	-85.8	-15.3	171.2	-69.9	-171.6	-173.9	-179.7	1.6	114.2	R53 A54 R55	R53-R57 PolarHBondContact O-N 3.08Å; A54-R57 PolarHBondContact O-N 3.45Å; R55-R57 PolarHBondContact O-N 2.98Å
58	R	54.8	Low	67	Low	209 Å²	209	122.6 Å²	122.6	79%	0.789	65%	0.648	S	S	*	*	S	Bend	trans	-132.1	87.2	176.6	-71.2	-176.8	-174	173.7	1.6	107.2	A54 R55 P60	A54-R58 PolarHBondContact O-N 3.1Å; R55-R58 CarbonylContact O-C 3.57Å; R55-R58 PolarHBondContact O-N 3.47Å; R55-R58 VanDerWaalsContact O-N 3.1Å; R58-P60 WeakPolarHBondContact O-CD 3.34Å
59	A	53.1	Low	66.7	Low	96 Å²	96	126.4 Å²	126.4	79%	0.793	66%	0.656	S	S	*	*			trans	-46.3	109.8	169.9	0	0	0	0	0	107.9	A61	A59-A61 PolarHBondContact O-N 2.96Å
60	P	53.9	Low	66.6	Low	91 Å²	91	126.7 Å²	126.7	59%	0.591	66%	0.664	S	S	*	*			trans	-75.4	120.6	176.2	23.4	-15.6	0	0	0	105.3	R58	R58-P60 WeakPolarHBondContact O-CD 3.34Å
61	A	55.3	Low	66.9	Low	87 Å²	87	127.8 Å²	127.8	72%	0.719	67%	0.668	S	S	*	*			trans	-46.4	128.5	165.5	0	0	0	0	0	108.1	A59 G63	A59-A61 PolarHBondContact O-N 2.96Å; A61-G63 VanDerWaalsContact C-N 3.31Å; A61-G63 PolarHBondContact O-N 3.36Å
62	P	55.9	Low	67.2	Low	141 Å²	141	125 Å²	125	92%	0.916	66%	0.663	S	S	*	*	S	Bend	trans	-71	93.5	177.8	30	-30.5	0	0	0	106.4
63	G	51	Low	67.6	Low	70 Å²	70	119.4 Å²	119.4	72%	0.722	65%	0.651	S	S	*	*			trans	-164.4	38.5	-163.6	0	0	0	0	0	116.3	A61	A61-G63 VanDerWaalsContact C-N 3.31Å; A61-G63 PolarHBondContact O-N 3.36Å
64	A	58.8	Low	68	Low	93 Å²	93	115.8 Å²	115.8	77%	0.769	65%	0.648	S	S	*	*			trans	175.5	93.4	153	0	0	0	0	0	108.2	P66	A64-P66 VanDerWaalsContact O-CD 3.3Å; A64-P66 WeakPolarHBondContact O-CD 3.39Å
65	L	62.7	Low	68.8	Low	166 Å²	166	114.7 Å²	114.7	87%	0.869	64%	0.638	S	S	*	*			trans	-71.4	118.9	159.1	-76	165.3	0	0	0	106.2	T67	L65-T67 PolarHBondContact O-N 2.84Å
66	P	66.1	Low	70.1	Confident	49 Å²	49	110.2 Å²	110.2	32%	0.318	64%	0.635	S	S	.	*			trans	-60.8	107.6	174.2	21.7	-29.2	0	0	0	108.6	A64 Y68 W69	A64-P66 VanDerWaalsContact O-CD 3.3Å; A64-P66 WeakPolarHBondContact O-CD 3.39Å; P66-Y68 HydrophobicContact CB-CD1 3.6Å; P66-Y68 HydrophobicContact CB-CE1 3.17Å; P66-Y68 HydrophobicContact CB-CE2 4.29Å; P66-Y68 HydrophobicContact CB-CG 4.32Å; P66-Y68 HydrophobicContact CG-CE1 4.43Å; P66-Y68 PolarHBondContact O-N 3.14Å; P66-W69 HydrophobicContact CB-CE3 4.1Å; P66-W69 HydrophobicContact CG-CB 4.43Å; P66-W69 HydrophobicContact CG-CD2 4.17Å; P66-W69 HydrophobicContact CG-CE3 3.7Å; P66-W69 HydrophobicContact CG-CG 4.5Å; P66-W69 HydrophobicContact CG-CZ3 4.34Å; P66-W69 WeakPolarHBondContact O-CB 3.38Å; P66-W69 PolarHBondContact O-N 3.37Å
67	T	71	Confident	71.5	Confident	139 Å²	139	112.4 Å²	112.4	85%	0.853	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.7	-12.6	-179.5	8.6	0	0	0	0	113.1	L65 P70	L65-T67 PolarHBondContact O-N 2.84Å; T67-P70 WeakPolarHBondContact O-CD 3.37Å
68	Y	78.8	Confident	73	Confident	133 Å²	133	106.1 Å²	106.1	52%	0.522	62%	0.621	S	S	.	*	T	Hydrogen-bonded Turn	trans	-85.9	-10.1	176.8	67.1	-96.8	0	0	0	114	P66 P70 W71 L72	P66-Y68 HydrophobicContact CB-CD1 3.6Å; P66-Y68 HydrophobicContact CB-CE1 3.17Å; P66-Y68 HydrophobicContact CB-CE2 4.29Å; P66-Y68 HydrophobicContact CB-CG 4.32Å; P66-Y68 HydrophobicContact CG-CE1 4.43Å; P66-Y68 PolarHBondContact O-N 3.14Å; Y68-P70 VanDerWaalsContact C-CD 3.44Å; Y68-W71 PolarHBondContact O-N 3.23Å; Y68-W71 VanDerWaalsContact O-N 3.17Å; Y68-L72 HydrophobicContact CD2-CD1 4.26Å; Y68-L72 HydrophobicContact CE2-CD1 4.35Å; Y68-L72 PolarHBondContact O-N 3.4Å
69	W	80.3	Confident	74.7	Confident	136 Å²	136	99 Å²	99	52%	0.515	61%	0.607	S	S	.	*	H	α-helix	trans	-58.2	-41.2	-177.4	-136.9	-110.8	0	0	0	114.2	P66 W71 L72 C73	P66-W69 HydrophobicContact CB-CE3 4.1Å; P66-W69 HydrophobicContact CG-CB 4.43Å; P66-W69 HydrophobicContact CG-CD2 4.17Å; P66-W69 HydrophobicContact CG-CE3 3.7Å; P66-W69 HydrophobicContact CG-CG 4.5Å; P66-W69 HydrophobicContact CG-CZ3 4.34Å; P66-W69 WeakPolarHBondContact O-CB 3.38Å; P66-W69 PolarHBondContact O-N 3.37Å; W69-W71 VanDerWaalsContact C-N 3.31Å; W69-W71 PolarHBondContact O-N 2.91Å; W69-L72 PolarHBondContact O-N 2.89Å; W69-C73 PolarHBondContact O-N 3.48Å; W69-C73 PolarHBondContact O-SG 3.34Å
70	P	82.1	Confident	76.5	Confident	94 Å²	94	97.5 Å²	97.5	61%	0.61	60%	0.595	S	S	*	*	H	α-helix	trans	-60.1	-42.3	176.2	-22.1	33.4	0	0	0	112	T67 Y68 C73 A74	T67-P70 WeakPolarHBondContact O-CD 3.37Å; Y68-P70 VanDerWaalsContact C-CD 3.44Å; P70-C73 PolarHBondContact O-N 3.34Å; P70-A74 WeakPolarHBondContact O-CB 3.23Å; P70-A74 PolarHBondContact O-N 3.49Å
71	W	86.9	Confident	78.2	Confident	188 Å²	188	98.1 Å²	98.1	71%	0.712	59%	0.593	S	S	*	*	H	α-helix	trans	-65	-40.8	177	-178.8	85.8	0	0	0	111.6	Y68 W69 C73 A74 A75	Y68-W71 PolarHBondContact O-N 3.23Å; Y68-W71 VanDerWaalsContact O-N 3.17Å; W69-W71 VanDerWaalsContact C-N 3.31Å; W69-W71 PolarHBondContact O-N 2.91Å; W71-C73 PolarHBondContact O-N 2.87Å; W71-A74 PolarHBondContact O-N 2.79Å; W71-A75 VanDerWaalsContact O-CB 3.3Å; W71-A75 WeakPolarHBondContact O-CB 3.4Å; W71-A75 PolarHBondContact O-N 2.92Å
72	L	88	Confident	79.9	Confident	79 Å²	79	96.4 Å²	96.4	41%	0.414	58%	0.578	S	S	.	*	H	α-helix	trans	-63.9	-41.9	178.5	-156.2	112.9	0	0	0	111.9	Y68 W69 A75 A76	Y68-L72 HydrophobicContact CD2-CD1 4.26Å; Y68-L72 HydrophobicContact CE2-CD1 4.35Å; Y68-L72 PolarHBondContact O-N 3.4Å; W69-L72 PolarHBondContact O-N 2.89Å; L72-A75 PolarHBondContact O-N 2.96Å; L72-A76 PolarHBondContact O-N 2.88Å
73	C	86.5	Confident	81.5	Confident	64 Å²	64	92.8 Å²	92.8	43%	0.432	56%	0.561	S	S	.	*	H	α-helix	trans	-64.8	-43.2	174.7	-72.4	0	0	0	0	112	W69 P70 W71 A76 Q77	W69-C73 PolarHBondContact O-N 3.48Å; W69-C73 PolarHBondContact O-SG 3.34Å; P70-C73 PolarHBondContact O-N 3.34Å; W71-C73 PolarHBondContact O-N 2.87Å; C73-A76 PolarHBondContact O-N 2.79Å; C73-Q77 PolarHBondContact O-N 3.13Å; C73-Q77 VanDerWaalsContact O-N 3.15Å
74	A	86.6	Confident	83.2	Confident	46 Å²	46	96.3 Å²	96.3	38%	0.38	55%	0.552	S	S	.	*	H	α-helix	trans	-63.1	-44.4	175.9	0	0	0	0	0	111.3	P70 W71 A76 Q77 V78	P70-A74 WeakPolarHBondContact O-CB 3.23Å; P70-A74 PolarHBondContact O-N 3.49Å; W71-A74 PolarHBondContact O-N 2.79Å; A74-A76 VanDerWaalsContact C-N 3.33Å; A74-A76 PolarHBondContact O-N 3.41Å; A74-Q77 PolarHBondContact O-N 3.2Å; A74-V78 WeakPolarHBondContact O-CB 3.41Å; A74-V78 VanDerWaalsContact O-CG2 3.26Å; A74-V78 WeakPolarHBondContact O-CG2 3.43Å; A74-V78 PolarHBondContact O-N 3Å
75	A	89.2	Confident	84.6	Confident	38 Å²	38	96 Å²	96	31%	0.314	54%	0.537	S	S	.	.	H	α-helix	trans	-60.5	-41.1	178.3	0	0	0	0	0	112.1	W71 L72 V78 A79	W71-A75 VanDerWaalsContact O-CB 3.3Å; W71-A75 WeakPolarHBondContact O-CB 3.4Å; W71-A75 PolarHBondContact O-N 2.92Å; L72-A75 PolarHBondContact O-N 2.96Å; A75-V78 PolarHBondContact O-N 3.27Å; A75-A79 VanDerWaalsContact O-CB 3.29Å; A75-A79 WeakPolarHBondContact O-CB 3.3Å; A75-A79 PolarHBondContact O-N 2.87Å
76	A	90.5	Very high	85.7	Confident	65 Å²	65	94 Å²	94	54%	0.537	53%	0.527	S	S	.	.	H	α-helix	trans	-63.1	-42.8	175.5	0	0	0	0	0	112.3	L72 C73 A74 A80	L72-A76 PolarHBondContact O-N 2.88Å; C73-A76 PolarHBondContact O-N 2.79Å; A74-A76 VanDerWaalsContact C-N 3.33Å; A74-A76 PolarHBondContact O-N 3.41Å; A76-A80 PolarHBondContact O-N 3.32Å
77	Q	91.1	Very high	86.4	Confident	147 Å²	147	94.3 Å²	94.3	69%	0.687	54%	0.539	S	S	*	.	H	α-helix	trans	-66.5	-44.3	176.1	-73	179.4	3.3	0	0	112	C73 A74 A79 A80 L81	C73-Q77 PolarHBondContact O-N 3.13Å; C73-Q77 VanDerWaalsContact O-N 3.15Å; A74-Q77 PolarHBondContact O-N 3.2Å; Q77-A79 VanDerWaalsContact C-N 3.34Å; Q77-A79 PolarHBondContact O-N 3.32Å; Q77-A80 PolarHBondContact O-N 3.34Å; Q77-L81 WeakPolarHBondContact O-CB 3.39Å; Q77-L81 PolarHBondContact O-N 3.46Å
78	V	90.2	Very high	86.7	Confident	97 Å²	97	94.3 Å²	94.3	59%	0.588	52%	0.524	S	S	*	.	H	α-helix	trans	-63	-40.1	177.9	172.3	0	0	0	0	111	A74 A75 A80 L81 A82	A74-V78 WeakPolarHBondContact O-CB 3.41Å; A74-V78 VanDerWaalsContact O-CG2 3.26Å; A74-V78 WeakPolarHBondContact O-CG2 3.43Å; A74-V78 PolarHBondContact O-N 3Å; A75-V78 PolarHBondContact O-N 3.27Å; V78-A80 PolarHBondContact O-N 3.28Å; V78-L81 PolarHBondContact O-N 2.95Å; V78-A82 WeakPolarHBondContact O-CB 3.25Å; V78-A82 PolarHBondContact O-N 3.45Å
79	A	91.1	Very high	85.9	Confident	60 Å²	60	97.8 Å²	97.8	50%	0.496	54%	0.536	S	S	.	.	H	α-helix	trans	-62.3	-43.8	177.2	0	0	0	0	0	112.2	A75 Q77 A82 A83	A75-A79 VanDerWaalsContact O-CB 3.29Å; A75-A79 WeakPolarHBondContact O-CB 3.3Å; A75-A79 PolarHBondContact O-N 2.87Å; Q77-A79 VanDerWaalsContact C-N 3.34Å; Q77-A79 PolarHBondContact O-N 3.32Å; A79-A82 PolarHBondContact O-N 2.85Å; A79-A83 WeakPolarHBondContact O-CB 3.39Å; A79-A83 PolarHBondContact O-N 3.3Å
80	A	90	Very high	84.8	Confident	65 Å²	65	98.7 Å²	98.7	54%	0.537	55%	0.55	S	S	.	*	H	α-helix	trans	-64	-42.5	176.2	0	0	0	0	0	111.9	A76 Q77 V78 A83 W84	A76-A80 PolarHBondContact O-N 3.32Å; Q77-A80 PolarHBondContact O-N 3.34Å; V78-A80 PolarHBondContact O-N 3.28Å; A80-A83 PolarHBondContact O-N 2.98Å; A80-W84 PolarHBondContact O-N 2.85Å; A80-W84 VanDerWaalsContact O-N 3.1Å
81	L	90.5	Very high	83.2	Confident	104 Å²	104	103.9 Å²	103.9	55%	0.545	57%	0.572	S	S	.	*	H	α-helix	trans	-67.8	-42.3	178.9	-163.6	153.8	0	0	0	111.5	Q77 V78 W84 L85	Q77-L81 WeakPolarHBondContact O-CB 3.39Å; Q77-L81 PolarHBondContact O-N 3.46Å; V78-L81 PolarHBondContact O-N 2.95Å; L81-W84 PolarHBondContact O-N 3.28Å; L81-L85 HydrophobicContact CD2-CD1 3.44Å; L81-L85 VanDerWaalsContact CD2-CD1 3.44Å; L81-L85 HydrophobicContact CD2-CG 3.92Å; L81-L85 WeakPolarHBondContact O-CG 3.36Å; L81-L85 PolarHBondContact O-N 3.23Å
82	A	89.7	Confident	83	Confident	50 Å²	50	99.7 Å²	99.7	41%	0.413	57%	0.565	S	S	.	*	H	α-helix	trans	-62.6	-43.2	176.2	0	0	0	0	0	111.7	V78 A79 W84 L85 L86	V78-A82 WeakPolarHBondContact O-CB 3.25Å; V78-A82 PolarHBondContact O-N 3.45Å; A79-A82 PolarHBondContact O-N 2.85Å; A82-W84 VanDerWaalsContact C-N 3.32Å; A82-W84 PolarHBondContact O-N 3.43Å; A82-L85 PolarHBondContact O-N 2.77Å; A82-L86 VanDerWaalsContact O-CB 3.29Å; A82-L86 WeakPolarHBondContact O-CB 3.41Å; A82-L86 PolarHBondContact O-N 3.09Å
83	A	89.8	Confident	82.7	Confident	66 Å²	66	100.8 Å²	100.8	55%	0.545	57%	0.573	S	S	.	*	H	α-helix	trans	-61	-41.8	175.5	0	0	0	0	0	111.9	A79 A80 L86 G87	A79-A83 WeakPolarHBondContact O-CB 3.39Å; A79-A83 PolarHBondContact O-N 3.3Å; A80-A83 PolarHBondContact O-N 2.98Å; A83-L86 PolarHBondContact O-N 3.49Å; A83-G87 PolarHBondContact O-N 3.05Å; A83-G87 VanDerWaalsContact O-N 3.08Å
84	W	87.9	Confident	82.5	Confident	144 Å²	144	102.8 Å²	102.8	55%	0.545	58%	0.581	S	S	.	*	H	α-helix	trans	-66.8	-42.9	177	-174.8	85.6	0	0	0	112.8	A80 L81 A82 G87 R88	A80-W84 PolarHBondContact O-N 2.85Å; A80-W84 VanDerWaalsContact O-N 3.1Å; L81-W84 PolarHBondContact O-N 3.28Å; A82-W84 VanDerWaalsContact C-N 3.32Å; A82-W84 PolarHBondContact O-N 3.43Å; W84-G87 PolarHBondContact O-N 2.8Å; W84-R88 VanDerWaalsContact CH2-NE 3.25Å; W84-R88 PolarHBondContact O-N 2.96Å; W84-R88 VanDerWaalsContact O-N 3.14Å
85	L	88.3	Confident	82.3	Confident	85 Å²	85	106.2 Å²	106.2	45%	0.445	59%	0.593	S	S	.	*	H	α-helix	trans	-65.3	-38.5	174.9	-75.4	178.7	0	0	0	112.3	L81 A82 G87 R88 R89	L81-L85 HydrophobicContact CD2-CD1 3.44Å; L81-L85 VanDerWaalsContact CD2-CD1 3.44Å; L81-L85 HydrophobicContact CD2-CG 3.92Å; L81-L85 WeakPolarHBondContact O-CG 3.36Å; L81-L85 PolarHBondContact O-N 3.23Å; A82-L85 PolarHBondContact O-N 2.77Å; L85-G87 VanDerWaalsContact C-N 3.31Å; L85-G87 PolarHBondContact O-N 3.25Å; L85-R88 CarbonylContact O-C 3.6Å; L85-R88 PolarHBondContact O-N 2.88Å; L85-R88 VanDerWaalsContact O-N 3.1Å; L85-R89 PolarHBondContact O-N 2.69Å
86	L	86.1	Confident	81.8	Confident	125 Å²	125	110.4 Å²	110.4	65%	0.654	61%	0.61	S	S	*	*	H	α-helix	trans	-63.1	-40.3	177.1	-162.9	76.4	0	0	0	111	A82 A83 R88 R89	A82-L86 VanDerWaalsContact O-CB 3.29Å; A82-L86 WeakPolarHBondContact O-CB 3.41Å; A82-L86 PolarHBondContact O-N 3.09Å; A83-L86 PolarHBondContact O-N 3.49Å; L86-R88 VanDerWaalsContact C-N 3.27Å; L86-R88 PolarHBondContact O-N 2.99Å; L86-R89 PolarHBondContact O-N 3.2Å
87	G	80.8	Confident	81.2	Confident	56 Å²	56	113.5 Å²	113.5	58%	0.577	62%	0.615	S	S	*	*	H	α-helix	trans	-64.3	-30.2	172.8	0	0	0	0	0	113.6	A83 W84 L85	A83-G87 PolarHBondContact O-N 3.05Å; A83-G87 VanDerWaalsContact O-N 3.08Å; W84-G87 PolarHBondContact O-N 2.8Å; L85-G87 VanDerWaalsContact C-N 3.31Å; L85-G87 PolarHBondContact O-N 3.25Å
88	R	76.2	Confident	80.5	Confident	139 Å²	139	111.1 Å²	111.1	53%	0.525	61%	0.61	S	S	.	*	H	α-helix	trans	-83.1	-18.4	176.2	-75.4	-168.1	171.2	-153.4	-1.6	114.7	W84 L85 L86 N90 L91	W84-R88 VanDerWaalsContact CH2-NE 3.25Å; W84-R88 PolarHBondContact O-N 2.96Å; W84-R88 VanDerWaalsContact O-N 3.14Å; L85-R88 CarbonylContact O-C 3.6Å; L85-R88 PolarHBondContact O-N 2.88Å; L85-R88 VanDerWaalsContact O-N 3.1Å; L86-R88 VanDerWaalsContact C-N 3.27Å; L86-R88 PolarHBondContact O-N 2.99Å; R88-N90 PolarHBondContact O-N 3.1Å; R88-L91 PolarHBondContact O-N 2.77Å; R88-L91 VanDerWaalsContact O-N 3.13Å
89	R	62	Low	79.8	Confident	205 Å²	205	112.2 Å²	112.2	77%	0.774	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.4	-5.3	177.2	-86.2	-178	154.4	172.8	-5.5	114.2	L85 L86	L85-R89 PolarHBondContact O-N 2.69Å; L86-R89 PolarHBondContact O-N 3.2Å
90	N	56.9	Low	78.9	Confident	155 Å²	155	116.5 Å²	116.5	83%	0.829	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.1	17.3	170.7	-82	-14.9	0	0	0	113.3	R88	R88-N90 PolarHBondContact O-N 3.1Å
91	L	48.3	Very low	77.9	Confident	204 Å²	204	121.2 Å²	121.2	100%	1.068	63%	0.629	S	S	*	*			trans	-110.4	0	168.3	-73.8	164.3	0	0	0	109.5	R88	R88-L91 PolarHBondContact O-N 2.77Å; R88-L91 VanDerWaalsContact O-N 3.13Å

Retrieved 91 of 91 residues in 67.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).