LSM1_HUMAN Loading...

U6 snRNA-associated Sm-like protein LSm1

Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated¹. Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation (By similarity).

AlphaFold DB , UniProt , Accession O15116, Species HUMAN (Homo sapiens, Human), Gene LSM1, Length 133 aa.

						>LSM1_HUMAN|O15116|LSM1
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.7	Low	74.7	Confident	215 Å²	215	99.2 Å²	99.2	100%	1.059	55%	0.547	S	S	*	.				0	122.5	0	-85.6	168.6	-179.1	0	0	107.5	Y3	M1-Y3 PolarHBondContact O-N 3.03Å
2	N	62.6	Low	75.8	Confident	158 Å²	158	101.5 Å²	101.5	85%	0.845	55%	0.551	S	S	*	*			trans	-74.4	102.3	170.5	-84	-9.1	0	0	0	107.2	M4	N2-M4 PolarHBondContact O-N 3.01Å
3	Y	68.2	Low	76.9	Confident	207 Å²	207	95.8 Å²	95.8	81%	0.812	52%	0.519	S	S	*	.	P	Polyproline II helix	trans	-61.4	121	170	-93.5	-91.6	0	0	0	108.9	M1	M1-Y3 PolarHBondContact O-N 3.03Å
4	M	70.7	Confident	78.1	Confident	101 Å²	101	93.8 Å²	93.8	50%	0.498	51%	0.507	S	S	.	.	P	Polyproline II helix	trans	-72.5	137.4	170.6	-66.3	-155.5	177.2	0	0	109.5	N2 A8	N2-M4 PolarHBondContact O-N 3.01Å; M4-A8 HydrophobicContact CB-CB 3.74Å; M4-A8 HydrophobicContact SD-CB 4.08Å
5	P	77.8	Confident	79.2	Confident	115 Å²	115	93.9 Å²	93.9	75%	0.747	51%	0.507	S	S	*	.	P	Polyproline II helix	trans	-75.1	144.3	-177.7	29.7	-34.3	0	0	0	112	A8	P5-A8 WeakPolarHBondContact O-CB 3.39Å; P5-A8 PolarHBondContact O-N 3.3Å
6	G	77.3	Confident	80.2	Confident	61 Å²	61	92.1 Å²	92.1	63%	0.629	49%	0.493	S	S	*	.	G	3₁₀ helix	trans	61.2	-143.2	172.6	0	0	0	0	0	112.9	A8 S9	G6-A8 PolarHBondContact O-N 3.41Å; G6-S9 PolarHBondContact O-N 3.01Å; G6-S9 VanDerWaalsContact O-N 3.09Å; G6-S9 PolarHBondContact O-OG 3.11Å
7	T	79.8	Confident	81.1	Confident	40 Å²	40	89.2 Å²	89.2	25%	0.245	48%	0.475	C	S	.	.	G	3₁₀ helix	trans	-58.8	-20.3	-176.4	-42.5	0	0	0	0	114	S9 L10 I35 D36 Q37 A39	T7-S9 PolarHBondContact O-N 2.97Å; T7-L10 HydrophobicContact CG2-CD1 4.23Å; T7-L10 WeakPolarHBondContact O-CB 3.49Å; T7-L10 PolarHBondContact O-N 3.17Å; T7-L10 VanDerWaalsContact O-N 3.11Å; T7-I35 HydrophobicContact CG2-CD1 3.55Å; T7-I35 HydrophobicContact CG2-CG1 3.84Å; T7-D36 WeakPolarHBondContact CG2-O 3.47Å; T7-Q37 PolarHBondContact OG1-O 3.2Å; T7-Q37 VanDerWaalsContact OG1-O 3.09Å; T7-A39 HydrophobicContact CG2-CB 4.5Å
8	A	78.2	Confident	81.9	Confident	34 Å²	34	84.3 Å²	84.3	28%	0.281	45%	0.449	S	S	.	.	G	3₁₀ helix	trans	-64.5	-23.9	177.3	0	0	0	0	0	113	M4 P5 G6 L10 I11	M4-A8 HydrophobicContact CB-CB 3.74Å; M4-A8 HydrophobicContact SD-CB 4.08Å; P5-A8 WeakPolarHBondContact O-CB 3.39Å; P5-A8 PolarHBondContact O-N 3.3Å; G6-A8 PolarHBondContact O-N 3.41Å; A8-L10 PolarHBondContact O-N 2.97Å; A8-I11 PolarHBondContact O-N 3.46Å
9	S	83.1	Confident	82.6	Confident	40 Å²	40	82.8 Å²	82.8	28%	0.28	44%	0.441	S	S	.	.	G	3₁₀ helix	trans	-64.6	-30.3	174.1	67.4	0	0	0	0	112.6	G6 T7 I11 E12	G6-S9 PolarHBondContact O-N 3.01Å; G6-S9 VanDerWaalsContact O-N 3.09Å; G6-S9 PolarHBondContact O-OG 3.11Å; T7-S9 PolarHBondContact O-N 2.97Å; S9-I11 PolarHBondContact O-N 3.34Å; S9-E12 PolarHBondContact O-N 2.81Å
10	L	84	Confident	83.4	Confident	20 Å²	20	78.7 Å²	78.7	11%	0.105	42%	0.419	C	S	.	.	G	3₁₀ helix	trans	-76.1	-7.5	-176	-63	172.5	0	0	0	113.1	T7 A8 E12 D13 I35 L74	T7-L10 HydrophobicContact CG2-CD1 4.23Å; T7-L10 WeakPolarHBondContact O-CB 3.49Å; T7-L10 PolarHBondContact O-N 3.17Å; T7-L10 VanDerWaalsContact O-N 3.11Å; A8-L10 PolarHBondContact O-N 2.97Å; L10-E12 PolarHBondContact O-N 3.43Å; L10-D13 WeakPolarHBondContact CD2-OD2 3.4Å; L10-D13 WeakPolarHBondContact O-CB 3.31Å; L10-D13 PolarHBondContact O-N 3.41Å; L10-D13 VanDerWaalsContact O-N 3.11Å; L10-I35 HydrophobicContact CB-CD1 3.52Å; L10-I35 HydrophobicContact CD1-CD1 3.21Å; L10-I35 HydrophobicContact CG-CD1 3.97Å; L10-L74 HydrophobicContact CD1-CD1 3.97Å; L10-L74 HydrophobicContact CD1-CD2 4.07Å; L10-L74 HydrophobicContact CD2-CD1 3.63Å; L10-L74 HydrophobicContact CD2-CD2 4.47Å; L10-L74 HydrophobicContact CD2-CG 4.13Å; L10-L74 HydrophobicContact CG-CD1 4.43Å
11	I	86.4	Confident	84	Confident	100 Å²	100	77.3 Å²	77.3	51%	0.513	41%	0.411	S	S	.	.	G	3₁₀ helix	trans	-64.5	-34	171.1	-62.4	173.1	0	0	0	110	A8 S9 D13 I14	A8-I11 PolarHBondContact O-N 3.46Å; S9-I11 PolarHBondContact O-N 3.34Å; I11-D13 PolarHBondContact O-N 3.35Å; I11-I14 HydrophobicContact CG2-CD1 4.31Å; I11-I14 WeakPolarHBondContact O-CG1 3.29Å; I11-I14 PolarHBondContact O-N 2.98Å
12	E	87.3	Confident	86	Confident	127 Å²	127	67.6 Å²	67.6	59%	0.593	36%	0.364	S	S	*	.	G	3₁₀ helix	trans	-71.2	-12.2	175.8	-60.9	-175.7	178.7	0	0	112.5	S9 L10 K16	S9-E12 PolarHBondContact O-N 2.81Å; L10-E12 PolarHBondContact O-N 3.43Å; E12-K16 WeakPolarHBondContact O-CE 3.4Å; E12-K16 PolarHBondContact O-NZ 3.2Å
13	D	90.5	Very high	87.5	Confident	27 Å²	27	66.6 Å²	66.6	14%	0.144	35%	0.348	C	S	.	.	G	3₁₀ helix	trans	-99.6	0.5	-176.3	-74	-26.4	0	0	0	113.8	L10 I11 D15 K16 H18 L32	L10-D13 WeakPolarHBondContact CD2-OD2 3.4Å; L10-D13 WeakPolarHBondContact O-CB 3.31Å; L10-D13 PolarHBondContact O-N 3.41Å; L10-D13 VanDerWaalsContact O-N 3.11Å; I11-D13 PolarHBondContact O-N 3.35Å; D13-D15 PolarHBondContact O-N 2.97Å; D13-K16 WeakPolarHBondContact O-CB 3.29Å; D13-K16 PolarHBondContact O-N 3.48Å; D13-K16 IonicContact OD1-NZ 2.71Å; D13-K16 PolarHBondContact OD1-NZ 3.47Å; D13-H18 WeakPolarHBondContact CB-CE1 3.31Å; D13-H18 IonicContact OD1-CE1 2.7Å; D13-H18 IonicContact OD2-NE2 3.41Å; D13-L32 HydrophobicContact CB-CD2 4.14Å
14	I	93.2	Very high	88.6	Confident	68 Å²	68	61.8 Å²	61.8	35%	0.349	34%	0.336	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.7	139.2	172.4	-64	174.5	0	0	0	109.5	I11 K16	I11-I14 HydrophobicContact CG2-CD1 4.31Å; I11-I14 WeakPolarHBondContact O-CG1 3.29Å; I11-I14 PolarHBondContact O-N 2.98Å; I14-K16 PolarHBondContact O-N 3.48Å; I14-K16 VanDerWaalsContact O-N 3.17Å
15	D	94.7	Very high	89.6	Confident	95 Å²	95	59.5 Å²	59.5	51%	0.508	34%	0.339	S	S	.	.	T	Hydrogen-bonded Turn	trans	64.9	5.1	-176.6	-61.9	-35.4	0	0	0	115.7	D13 L32 R33	D13-D15 PolarHBondContact O-N 2.97Å; D15-L32 WeakPolarHBondContact CA-O 3.35Å; D15-L32 PolarHBondContact N-O 2.99Å; D15-R33 WeakPolarHBondContact OD1-CD 3.44Å; D15-R33 IonicContact OD1-CZ 2.81Å; D15-R33 IonicContact OD1-NE 3.47Å; D15-R33 IonicContact OD1-NH1 2.7Å; D15-R33 PolarHBondContact OD1-NH1 3.15Å
16	K	95.2	Very high	90.5	Very high	65 Å²	65	57.3 Å²	57.3	28%	0.283	32%	0.316	S	S	.	.	S	Bend	trans	-91.6	153.1	172.3	-53.6	-168.1	-166	153.8	0	112.1	E12 D13 I14 H18 F31 L32 E76	E12-K16 WeakPolarHBondContact O-CE 3.4Å; E12-K16 PolarHBondContact O-NZ 3.2Å; D13-K16 WeakPolarHBondContact O-CB 3.29Å; D13-K16 PolarHBondContact O-N 3.48Å; D13-K16 IonicContact OD1-NZ 2.71Å; D13-K16 PolarHBondContact OD1-NZ 3.47Å; I14-K16 PolarHBondContact O-N 3.48Å; I14-K16 VanDerWaalsContact O-N 3.17Å; K16-H18 PolarHBondContact O-ND1 2.97Å; K16-F31 WeakPolarHBondContact O-CA 3.37Å; K16-L32 PolarHBondContact O-N 3.37Å; K16-E76 HydrophobicContact CB-CG 4.31Å; K16-E76 HydrophobicContact CD-CG 3.96Å; K16-E76 WeakPolarHBondContact CD-OE1 3.27Å; K16-E76 WeakPolarHBondContact CD-OE2 3.38Å; K16-E76 WeakPolarHBondContact CE-OE2 3.47Å; K16-E76 IonicContact NZ-OE2 2.8Å; K16-E76 PolarHBondContact NZ-OE2 2.8Å
17	K	95.9	Very high	91.4	Very high	44 Å²	44	55.2 Å²	55.2	19%	0.191	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.9	127.5	175.4	-164.7	177.2	178.2	-176.6	0	109.4	I29 G30 F31 I77 L79 E82	K17-I29 HydrophobicContact CD-CG2 4.46Å; K17-I29 VanDerWaalsContact CE-CG2 3.44Å; K17-I29 HydrophobicContact CG-CG2 4.31Å; K17-G30 CarbonylContact C-O 3.53Å; K17-G30 WeakPolarHBondContact CA-O 3.38Å; K17-F31 HydrophobicContact CB-CD1 4.21Å; K17-F31 HydrophobicContact CB-CE1 3.98Å; K17-F31 HydrophobicContact CB-CZ 4.44Å; K17-I77 HydrophobicContact CB-CB 4.48Å; K17-I77 HydrophobicContact CG-CB 4.42Å; K17-I77 HydrophobicContact CG-CD1 4.28Å; K17-I77 PolarHBondContact O-N 2.92Å; K17-L79 HydrophobicContact CB-CD2 4.13Å; K17-L79 HydrophobicContact CD-CD2 3.62Å; K17-E82 IonicContact NZ-OE1 3.16Å; K17-E82 PolarHBondContact NZ-OE1 3.4Å; K17-E82 IonicContact NZ-OE2 3.47Å; K17-E82 PolarHBondContact NZ-OE2 2.92Å
18	H	95.5	Very high	92.3	Very high	1 Å²	1	53.3 Å²	53.3	1%	0.005	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	143.4	-175.1	-86.5	64.1	0	0	0	111.3	D13 K16 I29 G30 G75 E76	D13-H18 WeakPolarHBondContact CB-CE1 3.31Å; D13-H18 IonicContact OD1-CE1 2.7Å; D13-H18 IonicContact OD2-NE2 3.41Å; K16-H18 PolarHBondContact O-ND1 2.97Å; H18-I29 VanDerWaalsContact O-CA 3.3Å; H18-I29 WeakPolarHBondContact O-CA 3.31Å; H18-G30 PolarHBondContact N-O 3.46Å; H18-G30 PolarHBondContact O-N 3.5Å; H18-G75 WeakPolarHBondContact CA-O 3.44Å; H18-G75 PolarHBondContact CD2-O 3.23Å; H18-E76 PolarHBondContact CD2-N 3.4Å; H18-E76 PolarHBondContact NE2-N 3.5Å
19	L	96.2	Very high	93.2	Very high	55 Å²	55	51.9 Å²	51.9	29%	0.288	27%	0.267	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	131.3	162.5	-176.1	148.5	0	0	0	108.2	T27 L28 I29 L73 L74 G75 I77	L19-T27 HydrophobicContact CD1-CG2 3.71Å; L19-T27 HydrophobicContact CD2-CG2 4Å; L19-T27 HydrophobicContact CG-CG2 3.66Å; L19-L28 CarbonylContact C-O 3.53Å; L19-L28 WeakPolarHBondContact CA-O 3.38Å; L19-I29 HydrophobicContact CB-CG1 4.43Å; L19-I29 HydrophobicContact CD1-CD1 4.44Å; L19-I29 HydrophobicContact CD1-CG1 4.36Å; L19-I29 HydrophobicContact CG-CG1 4.31Å; L19-L73 HydrophobicContact CD2-CD1 4.31Å; L19-L74 CarbonylContact O-C 3.53Å; L19-L74 WeakPolarHBondContact O-CA 3.46Å; L19-G75 PolarHBondContact N-O 3.44Å; L19-G75 PolarHBondContact O-N 3.38Å; L19-I77 HydrophobicContact CB-CD1 3.97Å; L19-I77 HydrophobicContact CB-CG1 3.98Å
20	V	96.9	Very high	93.8	Very high	0 Å²	0	50 Å²	50	0%	0	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	121.1	177.1	-176.4	0	0	0	0	108.5	L22 L28 L41 L43 V71 L74	V20-L22 HydrophobicContact CG1-CD2 4.02Å; V20-L28 HydrophobicContact CB-CB 4.37Å; V20-L28 PolarHBondContact N-O 2.84Å; V20-L28 PolarHBondContact O-N 3.48Å; V20-L41 HydrophobicContact CG1-CD1 4Å; V20-L41 HydrophobicContact CG2-CD1 3.87Å; V20-L43 HydrophobicContact CG2-CD1 3.97Å; V20-L43 HydrophobicContact CG2-CD2 4.33Å; V20-V71 HydrophobicContact CG1-CG1 4.12Å; V20-V71 HydrophobicContact CG1-CG2 4.21Å; V20-L74 HydrophobicContact CG2-CB 4.04Å
21	L	97.3	Very high	94.5	Very high	50 Å²	50	51.6 Å²	51.6	26%	0.262	26%	0.261	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	126.1	173.3	-179.7	65.5	0	0	0	109.4	V72 L73	L21-V72 HydrophobicContact CB-CB 4.48Å; L21-V72 HydrophobicContact CD2-CB 4.29Å; L21-V72 HydrophobicContact CD2-CG1 4.11Å; L21-V72 HydrophobicContact CG-CB 4.24Å; L21-V72 WeakPolarHBondContact O-CB 3.38Å; L21-V72 PolarHBondContact O-N 3.02Å; L21-L73 HydrophobicContact CB-CD1 3.76Å; L21-L73 HydrophobicContact CB-CG 3.89Å; L21-L73 HydrophobicContact CD2-CD1 4.47Å; L21-L73 HydrophobicContact CD2-CD2 4.16Å; L21-L73 HydrophobicContact CD2-CG 4.07Å; L21-L73 PolarHBondContact N-O 2.81Å
22	L	96.2	Very high	95	Very high	12 Å²	12	46.9 Å²	46.9	6%	0.063	24%	0.236	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-94.8	160	179.2	-59.5	-174.9	0	0	0	112.2	V20 D24 G25 R26 L28 V66 N70	V20-L22 HydrophobicContact CG1-CD2 4.02Å; L22-D24 VanDerWaalsContact CB-OD1 3.27Å; L22-D24 WeakPolarHBondContact CB-OD1 3.46Å; L22-D24 PolarHBondContact O-N 3.4Å; L22-G25 PolarHBondContact O-N 3.03Å; L22-R26 HydrophobicContact CB-CB 4.45Å; L22-R26 HydrophobicContact CD1-CB 4.26Å; L22-R26 PolarHBondContact N-O 3.3Å; L22-L28 HydrophobicContact CD1-CD1 3.97Å; L22-L28 HydrophobicContact CD1-CG 4.18Å; L22-L28 HydrophobicContact CG-CD1 4.5Å; L22-V66 HydrophobicContact CD2-CG1 3.58Å; L22-N70 CarbonylContact C-O 3.59Å; L22-N70 VanDerWaalsContact CA-O 3.24Å; L22-N70 WeakPolarHBondContact CA-O 3.4Å
23	R	94.2	Very high	95.4	Very high	136 Å²	136	45.6 Å²	45.6	51%	0.513	23%	0.226	S	C	.	.	T	Hydrogen-bonded Turn	trans	-60.9	-29.8	178.7	-176.6	-180	-77.8	-119.6	6.2	113.2	G25 N70 V72 D131	R23-G25 PolarHBondContact O-N 2.9Å; R23-N70 PolarHBondContact N-O 3.37Å; R23-V72 HydrophobicContact CB-CG2 4.3Å; R23-D131 IonicContact NH1-OD1 2.67Å; R23-D131 PolarHBondContact NH1-OD1 2.72Å
24	D	91.1	Very high	95.6	Very high	106 Å²	106	47.3 Å²	47.3	57%	0.567	24%	0.24	S	C	*	.	T	Hydrogen-bonded Turn	trans	-79.5	3.4	174.9	66.3	0.9	0	0	0	113.5	L22 R26	L22-D24 VanDerWaalsContact CB-OD1 3.27Å; L22-D24 WeakPolarHBondContact CB-OD1 3.46Å; L22-D24 PolarHBondContact O-N 3.4Å; D24-R26 VanDerWaalsContact CG-CD 3.5Å; D24-R26 WeakPolarHBondContact OD1-CB 3.42Å; D24-R26 WeakPolarHBondContact OD1-CD 3.21Å; D24-R26 VanDerWaalsContact OD1-CG 3.31Å; D24-R26 WeakPolarHBondContact OD1-CG 3.3Å; D24-R26 PolarHBondContact OD1-N 2.98Å; D24-R26 VanDerWaalsContact OD1-N 3.08Å; D24-R26 WeakPolarHBondContact OD2-CD 3.39Å; D24-R26 IonicContact OD2-NH1 2.85Å
25	G	92	Very high	95.6	Very high	54 Å²	54	45.5 Å²	45.5	56%	0.557	23%	0.231	S	C	*	.	S	Bend	trans	84.2	3.4	178.9	0	0	0	0	0	114.7	L22 R23	L22-G25 PolarHBondContact O-N 3.03Å; R23-G25 PolarHBondContact O-N 2.9Å
26	R	94.8	Very high	95.5	Very high	68 Å²	68	43.3 Å²	43.3	26%	0.257	22%	0.219	S	C	.	.			trans	-75	142.4	175.5	-64.2	167.2	73.1	-160.6	-4.1	110.9	L22 D24 E48	L22-R26 HydrophobicContact CB-CB 4.45Å; L22-R26 HydrophobicContact CD1-CB 4.26Å; L22-R26 PolarHBondContact N-O 3.3Å; D24-R26 VanDerWaalsContact CG-CD 3.5Å; D24-R26 WeakPolarHBondContact OD1-CB 3.42Å; D24-R26 WeakPolarHBondContact OD1-CD 3.21Å; D24-R26 VanDerWaalsContact OD1-CG 3.31Å; D24-R26 WeakPolarHBondContact OD1-CG 3.3Å; D24-R26 PolarHBondContact OD1-N 2.98Å; D24-R26 VanDerWaalsContact OD1-N 3.08Å; D24-R26 WeakPolarHBondContact OD2-CD 3.39Å; D24-R26 IonicContact OD2-NH1 2.85Å; R26-E48 IonicContact CZ-OE1 2.74Å; R26-E48 IonicContact CZ-OE2 3.6Å; R26-E48 VanDerWaalsContact NE-CD 3.28Å; R26-E48 IonicContact NE-OE1 2.66Å; R26-E48 PolarHBondContact NE-OE1 2.96Å; R26-E48 IonicContact NE-OE2 3.55Å; R26-E48 PolarHBondContact NE-OE2 3.35Å; R26-E48 IonicContact NH2-OE1 3.87Å; R26-E48 IonicContact NH2-OE2 2.8Å; R26-E48 PolarHBondContact NH2-OE2 3.16Å
27	T	97.1	Very high	95.2	Very high	18 Å²	18	46.8 Å²	46.8	11%	0.11	24%	0.236	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	115.4	175.5	-58.7	0	0	0	0	109.2	L19 I29 E48 R49	L19-T27 HydrophobicContact CD1-CG2 3.71Å; L19-T27 HydrophobicContact CD2-CG2 4Å; L19-T27 HydrophobicContact CG-CG2 3.66Å; T27-I29 HydrophobicContact CG2-CG1 4.44Å; T27-E48 CarbonylContact O-C 3.49Å; T27-E48 WeakPolarHBondContact O-CA 3.38Å; T27-R49 WeakPolarHBondContact CB-O 3.47Å; T27-R49 PolarHBondContact O-N 2.95Å
28	L	97.8	Very high	95	Very high	0 Å²	0	51.4 Å²	51.4	0%	0	26%	0.256	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.2	140.9	172.6	-56.9	-176.2	0	0	0	109.8	L19 V20 L22 L43 T46 V47 E48 F64 V66	L19-L28 CarbonylContact C-O 3.53Å; L19-L28 WeakPolarHBondContact CA-O 3.38Å; V20-L28 HydrophobicContact CB-CB 4.37Å; V20-L28 PolarHBondContact N-O 2.84Å; V20-L28 PolarHBondContact O-N 3.48Å; L22-L28 HydrophobicContact CD1-CD1 3.97Å; L22-L28 HydrophobicContact CD1-CG 4.18Å; L22-L28 HydrophobicContact CG-CD1 4.5Å; L28-L43 HydrophobicContact CB-CD1 4.04Å; L28-L43 HydrophobicContact CD1-CD1 4.24Å; L28-T46 HydrophobicContact CB-CG2 3.98Å; L28-T46 HydrophobicContact CD1-CG2 4.4Å; L28-T46 HydrophobicContact CD2-CG2 4.24Å; L28-T46 HydrophobicContact CG-CG2 4.44Å; L28-V47 CarbonylContact C-O 3.58Å; L28-V47 WeakPolarHBondContact CA-O 3.34Å; L28-E48 HydrophobicContact CD2-CB 3.85Å; L28-E48 HydrophobicContact CD2-CG 4.17Å; L28-F64 HydrophobicContact CD1-CD1 3.49Å; L28-F64 VanDerWaalsContact CD1-CD1 3.49Å; L28-F64 HydrophobicContact CD1-CE1 3.68Å; L28-F64 HydrophobicContact CD1-CG 4.13Å; L28-F64 HydrophobicContact CD1-CZ 4.45Å; L28-V66 HydrophobicContact CD1-CG2 3.84Å
29	I	97.3	Very high	94.7	Very high	3 Å²	3	52.2 Å²	52.2	2%	0.015	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	125.9	174.4	-63.5	172.6	0	0	0	107.6	K17 H18 L19 T27 T46 V47 R49 I77	K17-I29 HydrophobicContact CD-CG2 4.46Å; K17-I29 VanDerWaalsContact CE-CG2 3.44Å; K17-I29 HydrophobicContact CG-CG2 4.31Å; H18-I29 VanDerWaalsContact O-CA 3.3Å; H18-I29 WeakPolarHBondContact O-CA 3.31Å; L19-I29 HydrophobicContact CB-CG1 4.43Å; L19-I29 HydrophobicContact CD1-CD1 4.44Å; L19-I29 HydrophobicContact CD1-CG1 4.36Å; L19-I29 HydrophobicContact CG-CG1 4.31Å; T27-I29 HydrophobicContact CG2-CG1 4.44Å; I29-T46 CarbonylContact O-C 3.53Å; I29-T46 VanDerWaalsContact O-CA 3.23Å; I29-T46 WeakPolarHBondContact O-CA 3.42Å; I29-V47 HydrophobicContact CB-CG2 3.81Å; I29-V47 HydrophobicContact CG2-CG2 4.32Å; I29-V47 PolarHBondContact N-O 3.12Å; I29-V47 PolarHBondContact O-N 2.89Å; I29-R49 HydrophobicContact CD1-CB 3.88Å; I29-R49 HydrophobicContact CD1-CG 4.48Å; I29-I77 HydrophobicContact CB-CD1 4.34Å; I29-I77 HydrophobicContact CD1-CD1 4.29Å; I29-I77 HydrophobicContact CG1-CD1 4.09Å; I29-I77 HydrophobicContact CG2-CD1 3.47Å; I29-I77 VanDerWaalsContact CG2-CD1 3.47Å
30	G	97.4	Very high	94.7	Very high	2 Å²	2	51.9 Å²	51.9	2%	0.021	26%	0.262	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-172.8	179.1	178.9	0	0	0	0	0	112.5	K17 H18	K17-G30 CarbonylContact C-O 3.53Å; K17-G30 WeakPolarHBondContact CA-O 3.38Å; H18-G30 PolarHBondContact N-O 3.46Å; H18-G30 PolarHBondContact O-N 3.5Å
31	F	97.1	Very high	94.6	Very high	53 Å²	53	51.9 Å²	51.9	23%	0.232	26%	0.262	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.3	125.5	175.1	-67.4	-85.8	0	0	0	110.5	K16 K17 R33 L43 H44 Q45	K16-F31 WeakPolarHBondContact O-CA 3.37Å; K17-F31 HydrophobicContact CB-CD1 4.21Å; K17-F31 HydrophobicContact CB-CE1 3.98Å; K17-F31 HydrophobicContact CB-CZ 4.44Å; F31-R33 PolarHBondContact O-N 2.95Å; F31-L43 CarbonylContact O-C 3.6Å; F31-L43 WeakPolarHBondContact O-CA 3.28Å; F31-H44 PolarHBondContact N-O 2.85Å; F31-H44 PolarHBondContact O-N 3.21Å; F31-Q45 HydrophobicContact CD2-CB 4.22Å; F31-Q45 VanDerWaalsContact CE2-OE1 3.25Å
32	L	96.7	Very high	94.6	Very high	1 Å²	1	51.7 Å²	51.7	1%	0.005	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.9	120.9	175.4	-176	63.5	0	0	0	109.8	D13 D15 K16 L41 L43	D13-L32 HydrophobicContact CB-CD2 4.14Å; D15-L32 WeakPolarHBondContact CA-O 3.35Å; D15-L32 PolarHBondContact N-O 2.99Å; K16-L32 PolarHBondContact O-N 3.37Å; L32-L41 HydrophobicContact CD1-CB 4.11Å; L32-L41 HydrophobicContact CD1-CD2 3.99Å; L32-L43 HydrophobicContact CB-CD2 4.46Å; L32-L43 HydrophobicContact CD1-CD2 4.18Å
33	R	96	Very high	94.7	Very high	100 Å²	100	51.1 Å²	51.1	38%	0.377	26%	0.26	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	-30.1	-178.3	-63.9	-57.1	176.8	177.2	-3	113.9	D15 F31 V42 H44	D15-R33 WeakPolarHBondContact OD1-CD 3.44Å; D15-R33 IonicContact OD1-CZ 2.81Å; D15-R33 IonicContact OD1-NE 3.47Å; D15-R33 IonicContact OD1-NH1 2.7Å; D15-R33 PolarHBondContact OD1-NH1 3.15Å; F31-R33 PolarHBondContact O-N 2.95Å; R33-V42 HydrophobicContact CB-CG1 4.44Å; R33-V42 PolarHBondContact N-O 2.97Å; R33-H44 HydrophobicContact CG-CB 3.54Å
34	S	94.6	Very high	94.8	Very high	62 Å²	62	47.8 Å²	47.8	43%	0.434	25%	0.25	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-153.3	147.7	179	-171.9	0	0	0	0	109.5	V42	S34-V42 PolarHBondContact O-N 2.93Å
35	I	93.5	Very high	95.1	Very high	30 Å²	30	48.3 Å²	48.3	15%	0.154	25%	0.249	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-143	148.5	174.2	-173.4	162.5	0	0	0	109.5	T7 L10 N40 L41	T7-I35 HydrophobicContact CG2-CD1 3.55Å; T7-I35 HydrophobicContact CG2-CG1 3.84Å; L10-I35 HydrophobicContact CB-CD1 3.52Å; L10-I35 HydrophobicContact CD1-CD1 3.21Å; L10-I35 HydrophobicContact CG-CD1 3.97Å; I35-N40 WeakPolarHBondContact CA-O 3.42Å; I35-L41 HydrophobicContact CB-CD2 4.31Å; I35-L41 HydrophobicContact CD1-CD2 3.5Å; I35-L41 HydrophobicContact CG1-CD2 3.8Å
36	D	92.6	Very high	95.4	Very high	50 Å²	50	45.8 Å²	45.8	27%	0.267	22%	0.223	S	C	.	.			trans	-116.3	175.5	167.5	76.1	5.8	0	0	0	111.9	T7 F38 A39 N40	T7-D36 WeakPolarHBondContact CG2-O 3.47Å; D36-F38 PolarHBondContact O-N 2.69Å; D36-F38 VanDerWaalsContact O-N 3.1Å; D36-F38 WeakPolarHBondContact OD1-CA 3.28Å; D36-F38 WeakPolarHBondContact OD1-CB 3.38Å; D36-F38 PolarHBondContact OD1-N 3.14Å; D36-A39 PolarHBondContact O-N 3.49Å; D36-A39 PolarHBondContact OD1-N 2.86Å; D36-N40 PolarHBondContact N-O 3.35Å; D36-N40 WeakPolarHBondContact OD1-CB 3.37Å; D36-N40 PolarHBondContact OD1-N 3.32Å; D36-N40 PolarHBondContact OD1-ND2 3.05Å; D36-N40 WeakPolarHBondContact OD2-CB 3.2Å; D36-N40 PolarHBondContact OD2-ND2 3.49Å
37	Q	90.1	Very high	95.5	Very high	137 Å²	137	44.3 Å²	44.3	64%	0.64	22%	0.221	S	C	*	.	T	Hydrogen-bonded Turn	trans	-61.5	-19	-178.9	69.2	-84.5	23.5	0	0	114.6	T7 A39	T7-Q37 PolarHBondContact OG1-O 3.2Å; T7-Q37 VanDerWaalsContact OG1-O 3.09Å; Q37-A39 VanDerWaalsContact C-N 3.3Å
38	F	90.6	Very high	95.6	Very high	141 Å²	141	44.1 Å²	44.1	62%	0.618	22%	0.219	S	C	*	.	T	Hydrogen-bonded Turn	trans	-91.4	6.8	177.6	-57.3	-71.2	0	0	0	112.5	D36 N40 G68	D36-F38 PolarHBondContact O-N 2.69Å; D36-F38 VanDerWaalsContact O-N 3.1Å; D36-F38 WeakPolarHBondContact OD1-CA 3.28Å; D36-F38 WeakPolarHBondContact OD1-CB 3.38Å; D36-F38 PolarHBondContact OD1-N 3.14Å; F38-N40 VanDerWaalsContact C-N 3.25Å; F38-N40 PolarHBondContact O-N 2.95Å; F38-G68 WeakPolarHBondContact O-CA 3.32Å
39	A	90	Very high	95.5	Very high	18 Å²	18	45.6 Å²	45.6	15%	0.149	23%	0.225	C	C	.	.			trans	61	30.4	-173.8	0	0	0	0	0	113.4	T7 D36 Q37 L41 G68	T7-A39 HydrophobicContact CG2-CB 4.5Å; D36-A39 PolarHBondContact O-N 3.49Å; D36-A39 PolarHBondContact OD1-N 2.86Å; Q37-A39 VanDerWaalsContact C-N 3.3Å; A39-L41 WeakPolarHBondContact O-CD2 3.28Å; A39-L41 WeakPolarHBondContact O-CG 3.48Å; A39-L41 PolarHBondContact O-N 3.47Å; A39-G68 WeakPolarHBondContact O-CA 3.34Å
40	N	94.8	Very high	95.4	Very high	49 Å²	49	45.9 Å²	45.9	26%	0.262	23%	0.226	S	C	.	.			trans	-70.1	122.5	165.1	-62	-48.7	0	0	0	108.5	I35 D36 F38 V66 R67 G68	I35-N40 WeakPolarHBondContact CA-O 3.42Å; D36-N40 PolarHBondContact N-O 3.35Å; D36-N40 WeakPolarHBondContact OD1-CB 3.37Å; D36-N40 PolarHBondContact OD1-N 3.32Å; D36-N40 PolarHBondContact OD1-ND2 3.05Å; D36-N40 WeakPolarHBondContact OD2-CB 3.2Å; D36-N40 PolarHBondContact OD2-ND2 3.49Å; F38-N40 VanDerWaalsContact C-N 3.25Å; F38-N40 PolarHBondContact O-N 2.95Å; N40-V66 CarbonylContact C-O 3.55Å; N40-V66 VanDerWaalsContact CA-O 3.3Å; N40-V66 WeakPolarHBondContact CA-O 3.17Å; N40-R67 VanDerWaalsContact OD1-CA 3.3Å; N40-R67 WeakPolarHBondContact OD1-CA 3.22Å; N40-G68 PolarHBondContact OD1-N 2.67Å
41	L	95.8	Very high	95.3	Very high	0 Å²	0	49.7 Å²	49.7	0%	0	24%	0.243	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	139	-171.2	-47.5	177.7	0	0	0	110.6	V20 L32 I35 A39 V65 V66 V71 L74	V20-L41 HydrophobicContact CG1-CD1 4Å; V20-L41 HydrophobicContact CG2-CD1 3.87Å; L32-L41 HydrophobicContact CD1-CB 4.11Å; L32-L41 HydrophobicContact CD1-CD2 3.99Å; I35-L41 HydrophobicContact CB-CD2 4.31Å; I35-L41 HydrophobicContact CD1-CD2 3.5Å; I35-L41 HydrophobicContact CG1-CD2 3.8Å; A39-L41 WeakPolarHBondContact O-CD2 3.28Å; A39-L41 WeakPolarHBondContact O-CG 3.48Å; A39-L41 PolarHBondContact O-N 3.47Å; L41-V65 CarbonylContact O-C 3.58Å; L41-V65 WeakPolarHBondContact O-CA 3.46Å; L41-V66 HydrophobicContact CB-CB 4.23Å; L41-V66 PolarHBondContact N-O 3.19Å; L41-V66 PolarHBondContact O-N 2.81Å; L41-V71 HydrophobicContact CD1-CG2 3.98Å; L41-V71 HydrophobicContact CG-CG2 4.43Å; L41-L74 HydrophobicContact CD1-CD1 4.28Å
42	V	97.1	Very high	95.1	Very high	45 Å²	45	47.9 Å²	47.9	27%	0.273	24%	0.236	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	114.2	163.1	-177.2	0	0	0	0	108.2	R33 S34 I63 V65	R33-V42 HydrophobicContact CB-CG1 4.44Å; R33-V42 PolarHBondContact N-O 2.97Å; S34-V42 PolarHBondContact O-N 2.93Å; V42-I63 HydrophobicContact CG1-CG2 4.33Å; V42-V65 HydrophobicContact CG2-CG2 4.42Å
43	L	97.7	Very high	94.9	Very high	0 Å²	0	51.2 Å²	51.2	0%	0	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.7	140.6	175.2	-60	175.8	0	0	0	110.1	V20 L28 F31 L32 T46 I63 F64 V66	V20-L43 HydrophobicContact CG2-CD1 3.97Å; V20-L43 HydrophobicContact CG2-CD2 4.33Å; L28-L43 HydrophobicContact CB-CD1 4.04Å; L28-L43 HydrophobicContact CD1-CD1 4.24Å; F31-L43 CarbonylContact O-C 3.6Å; F31-L43 WeakPolarHBondContact O-CA 3.28Å; L32-L43 HydrophobicContact CB-CD2 4.46Å; L32-L43 HydrophobicContact CD1-CD2 4.18Å; L43-T46 HydrophobicContact CB-CG2 4.41Å; L43-T46 WeakPolarHBondContact CB-OG1 3.15Å; L43-T46 HydrophobicContact CD1-CG2 4.18Å; L43-T46 PolarHBondContact O-OG1 3.44Å; L43-I63 WeakPolarHBondContact O-CA 3.37Å; L43-F64 PolarHBondContact N-O 2.86Å; L43-F64 PolarHBondContact O-N 3.29Å; L43-V66 HydrophobicContact CD1-CG2 4.47Å
44	H	97.7	Very high	94.8	Very high	67 Å²	67	54.7 Å²	54.7	31%	0.31	29%	0.289	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.2	149.1	173.6	179.8	-138.1	0	0	0	110.5	F31 R33 T46	F31-H44 PolarHBondContact N-O 2.85Å; F31-H44 PolarHBondContact O-N 3.21Å; R33-H44 HydrophobicContact CG-CB 3.54Å; H44-T46 PolarHBondContact O-N 3.32Å
45	Q	97.2	Very high	94.8	Very high	116 Å²	116	53.9 Å²	53.9	54%	0.542	28%	0.278	S	S	.	.	E	Extended strand (participates in β ladder)	trans	52.5	40	-173.3	-61.2	178.6	-32.4	0	0	111.8	F31 V47 G62	F31-Q45 HydrophobicContact CD2-CB 4.22Å; F31-Q45 VanDerWaalsContact CE2-OE1 3.25Å; Q45-V47 PolarHBondContact O-N 3.49Å; Q45-G62 PolarHBondContact N-O 2.79Å
46	T	97.7	Very high	94.9	Very high	1 Å²	1	53.9 Å²	53.9	1%	0.006	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.3	131.3	-177.2	-50	0	0	0	0	110.4	L28 I29 L43 H44 R61 G62 F64	L28-T46 HydrophobicContact CB-CG2 3.98Å; L28-T46 HydrophobicContact CD1-CG2 4.4Å; L28-T46 HydrophobicContact CD2-CG2 4.24Å; L28-T46 HydrophobicContact CG-CG2 4.44Å; I29-T46 CarbonylContact O-C 3.53Å; I29-T46 VanDerWaalsContact O-CA 3.23Å; I29-T46 WeakPolarHBondContact O-CA 3.42Å; L43-T46 HydrophobicContact CB-CG2 4.41Å; L43-T46 WeakPolarHBondContact CB-OG1 3.15Å; L43-T46 HydrophobicContact CD1-CG2 4.18Å; L43-T46 PolarHBondContact O-OG1 3.44Å; H44-T46 PolarHBondContact O-N 3.32Å; T46-R61 HydrophobicContact CG2-CB 4.31Å; T46-R61 WeakPolarHBondContact O-CA 3.49Å; T46-R61 PolarHBondContact O-N 2.81Å; T46-G62 PolarHBondContact N-O 3.08Å; T46-G62 PolarHBondContact O-N 3.09Å; T46-G62 VanDerWaalsContact O-N 3.07Å; T46-G62 PolarHBondContact OG1-O 2.96Å; T46-F64 HydrophobicContact CG2-CB 4.02Å
47	V	97.6	Very high	95.1	Very high	38 Å²	38	51.5 Å²	51.5	23%	0.23	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.6	142.3	162.8	-58.2	0	0	0	0	108.6	L28 I29 Q45 D58 I59	L28-V47 CarbonylContact C-O 3.58Å; L28-V47 WeakPolarHBondContact CA-O 3.34Å; I29-V47 HydrophobicContact CB-CG2 3.81Å; I29-V47 HydrophobicContact CG2-CG2 4.32Å; I29-V47 PolarHBondContact N-O 3.12Å; I29-V47 PolarHBondContact O-N 2.89Å; Q45-V47 PolarHBondContact O-N 3.49Å; V47-D58 HydrophobicContact CB-CB 4.22Å; V47-D58 HydrophobicContact CG2-CB 4.43Å; V47-I59 CarbonylContact C-O 3.47Å; V47-I59 VanDerWaalsContact CA-O 3.32Å; V47-I59 WeakPolarHBondContact CA-O 3.47Å
48	E	97.6	Very high	95.4	Very high	13 Å²	13	46.5 Å²	46.5	6%	0.061	24%	0.241	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-94.1	117.4	166.9	175.1	179.9	176.4	0	0	108.2	R26 T27 L28 D58 I59 R61	R26-E48 IonicContact CZ-OE1 2.74Å; R26-E48 IonicContact CZ-OE2 3.6Å; R26-E48 VanDerWaalsContact NE-CD 3.28Å; R26-E48 IonicContact NE-OE1 2.66Å; R26-E48 PolarHBondContact NE-OE1 2.96Å; R26-E48 IonicContact NE-OE2 3.55Å; R26-E48 PolarHBondContact NE-OE2 3.35Å; R26-E48 IonicContact NH2-OE1 3.87Å; R26-E48 IonicContact NH2-OE2 2.8Å; R26-E48 PolarHBondContact NH2-OE2 3.16Å; T27-E48 CarbonylContact O-C 3.49Å; T27-E48 WeakPolarHBondContact O-CA 3.38Å; L28-E48 HydrophobicContact CD2-CB 3.85Å; L28-E48 HydrophobicContact CD2-CG 4.17Å; E48-D58 WeakPolarHBondContact O-CA 3.3Å; E48-I59 HydrophobicContact CB-CB 4.32Å; E48-I59 PolarHBondContact N-O 2.86Å; E48-I59 PolarHBondContact O-N 3Å; E48-R61 HydrophobicContact CB-CG 4Å; E48-R61 IonicContact OE2-CZ 3.49Å; E48-R61 IonicContact OE2-NE 3.16Å; E48-R61 PolarHBondContact OE2-NE 3.41Å; E48-R61 IonicContact OE2-NH2 2.95Å; E48-R61 PolarHBondContact OE2-NH2 2.71Å
49	R	96.4	Very high	95.7	Very high	32 Å²	32	40.8 Å²	40.8	12%	0.121	22%	0.216	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	114.5	-178.8	-174.5	167.5	-72.3	172.8	-1.6	110.4	T27 I29 H51 Y56 G57 D58 E82	T27-R49 WeakPolarHBondContact CB-O 3.47Å; T27-R49 PolarHBondContact O-N 2.95Å; I29-R49 HydrophobicContact CD1-CB 3.88Å; I29-R49 HydrophobicContact CD1-CG 4.48Å; R49-H51 VanDerWaalsContact CD-CE1 3.47Å; R49-H51 WeakPolarHBondContact CD-CE1 3.3Å; R49-H51 VanDerWaalsContact CD-NE2 3.31Å; R49-H51 WeakPolarHBondContact CD-NE2 3.46Å; R49-H51 WeakPolarHBondContact CG-CE1 3.21Å; R49-Y56 HydrophobicContact CG-CD2 3.99Å; R49-G57 WeakPolarHBondContact CA-O 3.42Å; R49-D58 VanDerWaalsContact CB-OD1 3.27Å; R49-D58 WeakPolarHBondContact CB-OD1 3.22Å; R49-D58 WeakPolarHBondContact CG-OD1 3.5Å; R49-D58 IonicContact CZ-OD1 3.87Å; R49-D58 IonicContact CZ-OD2 3.6Å; R49-D58 IonicContact NE-OD1 2.78Å; R49-D58 PolarHBondContact NE-OD1 3.13Å; R49-D58 IonicContact NE-OD2 3.93Å; R49-D58 IonicContact NH2-OD1 3.6Å; R49-D58 IonicContact NH2-OD2 2.64Å; R49-D58 PolarHBondContact NH2-OD2 3.41Å; R49-E82 IonicContact NH2-OE1 2.73Å
50	I	96	Very high	96	Very high	8 Å²	8	44.5 Å²	44.5	4%	0.041	24%	0.239	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-93	132.2	173.5	-59.2	168	0	0	0	108	V52 Y56 G57 I59 I95 L96 Q99	I50-V52 HydrophobicContact CG2-CG2 4.14Å; I50-Y56 CarbonylContact O-C 3.53Å; I50-Y56 WeakPolarHBondContact O-CA 3.33Å; I50-G57 PolarHBondContact N-O 3.36Å; I50-G57 PolarHBondContact O-N 3.15Å; I50-I59 HydrophobicContact CD1-CD1 3.6Å; I50-I59 HydrophobicContact CD1-CG1 4.4Å; I50-I95 HydrophobicContact CB-CG1 3.75Å; I50-I95 HydrophobicContact CB-CG2 4.34Å; I50-I95 HydrophobicContact CD1-CG2 4.26Å; I50-I95 HydrophobicContact CG2-CD1 4.42Å; I50-I95 HydrophobicContact CG2-CG1 3.61Å; I50-L96 HydrophobicContact CD1-CD2 3.63Å; I50-L96 HydrophobicContact CD1-CG 4.4Å; I50-Q99 HydrophobicContact CG2-CB 4.04Å; I50-Q99 HydrophobicContact CG2-CG 4.05Å
51	H	94.1	Very high	96.1	Very high	83 Å²	83	47.3 Å²	47.3	38%	0.384	25%	0.246	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	128.3	177	-59.7	86.1	0	0	0	109.2	R49	R49-H51 VanDerWaalsContact CD-CE1 3.47Å; R49-H51 WeakPolarHBondContact CD-CE1 3.3Å; R49-H51 VanDerWaalsContact CD-NE2 3.31Å; R49-H51 WeakPolarHBondContact CD-NE2 3.46Å; R49-H51 WeakPolarHBondContact CG-CE1 3.21Å
52	V	94.2	Very high	96.1	Very high	14 Å²	14	49 Å²	49	9%	0.085	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136	114.2	173.4	-173	0	0	0	0	108.5	I50 K54 K55 I95 E98 Q99 E102	I50-V52 HydrophobicContact CG2-CG2 4.14Å; V52-K54 PolarHBondContact O-N 3.2Å; V52-K54 VanDerWaalsContact O-N 3.1Å; V52-K55 PolarHBondContact N-O 2.73Å; V52-K55 PolarHBondContact O-N 3.38Å; V52-I95 HydrophobicContact CB-CD1 3.92Å; V52-I95 HydrophobicContact CG2-CD1 3.73Å; V52-I95 HydrophobicContact CG2-CG1 4.3Å; V52-E98 HydrophobicContact CB-CB 4.23Å; V52-E98 HydrophobicContact CG1-CB 3.97Å; V52-E98 HydrophobicContact CG2-CB 4.31Å; V52-Q99 HydrophobicContact CG2-CB 3.89Å; V52-E102 HydrophobicContact CG1-CB 4.27Å
53	G	91.7	Very high	96.1	Very high	71 Å²	71	52.5 Å²	52.5	73%	0.732	28%	0.279	S	S	*	.	T	Hydrogen-bonded Turn	trans	56.4	-114.9	-176.2	0	0	0	0	0	113
54	K	93.2	Very high	96	Very high	173 Å²	173	54.9 Å²	54.9	75%	0.752	29%	0.29	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101.1	9.8	177.5	-64.3	-173.3	178.7	-176.7	0	113.3	V52 L87 Q88	V52-K54 PolarHBondContact O-N 3.2Å; V52-K54 VanDerWaalsContact O-N 3.1Å; K54-L87 CarbonylContact O-C 3.53Å; K54-L87 WeakPolarHBondContact O-CA 3.1Å; K54-Q88 PolarHBondContact O-N 2.87Å
55	K	95.1	Very high	96	Very high	46 Å²	46	56.9 Å²	56.9	20%	0.2	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	153.3	-177.9	-68.8	170.8	169.8	-165.6	0	110.7	V52 Q88 V90 E94 I95 E98	V52-K55 PolarHBondContact N-O 2.73Å; V52-K55 PolarHBondContact O-N 3.38Å; K55-Q88 CarbonylContact C-O 3.6Å; K55-Q88 VanDerWaalsContact CA-O 3.22Å; K55-Q88 WeakPolarHBondContact CA-O 3.02Å; K55-Q88 HydrophobicContact CG-CB 4.21Å; K55-V90 HydrophobicContact CB-CG1 4.18Å; K55-V90 HydrophobicContact CB-CG2 4.27Å; K55-V90 HydrophobicContact CD-CG1 3.86Å; K55-V90 HydrophobicContact CG-CG1 3.94Å; K55-E94 IonicContact NZ-OE1 2.74Å; K55-E94 PolarHBondContact NZ-OE1 2.89Å; K55-I95 HydrophobicContact CB-CD1 4.31Å; K55-E98 VanDerWaalsContact CD-OE1 3.3Å; K55-E98 WeakPolarHBondContact CD-OE1 3.31Å; K55-E98 WeakPolarHBondContact CD-OE2 3.36Å; K55-E98 WeakPolarHBondContact CE-OE1 3.31Å; K55-E98 IonicContact NZ-OE1 2.99Å; K55-E98 PolarHBondContact NZ-OE1 3.47Å
56	Y	95.5	Very high	95.9	Very high	29 Å²	29	51.6 Å²	51.6	11%	0.114	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141	155.4	170.7	78.8	-81.8	0	0	0	111.7	R49 I50 L87 Q88 Q89 V90	R49-Y56 HydrophobicContact CG-CD2 3.99Å; I50-Y56 CarbonylContact O-C 3.53Å; I50-Y56 WeakPolarHBondContact O-CA 3.33Å; Y56-L87 HydrophobicContact CD1-CB 3.61Å; Y56-L87 HydrophobicContact CE1-CB 4.1Å; Y56-Q88 PolarHBondContact N-O 3.17Å; Y56-Q89 HydrophobicContact CD1-CB 4.35Å; Y56-Q89 HydrophobicContact CD2-CG 4.43Å; Y56-Q89 HydrophobicContact CE1-CB 3.66Å; Y56-Q89 HydrophobicContact CE1-CG 4.23Å; Y56-Q89 HydrophobicContact CE2-CB 4.16Å; Y56-Q89 HydrophobicContact CE2-CG 3.78Å; Y56-Q89 CarbonylContact O-C 3.23Å; Y56-Q89 WeakPolarHBondContact O-CA 3.27Å; Y56-V90 WeakPolarHBondContact O-CG2 3.24Å; Y56-V90 PolarHBondContact O-N 3.28Å
57	G	96	Very high	95.9	Very high	0 Å²	0	58.8 Å²	58.8	0%	0	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.4	145.1	172.5	0	0	0	0	0	111.6	R49 I50	R49-G57 WeakPolarHBondContact CA-O 3.42Å; I50-G57 PolarHBondContact N-O 3.36Å; I50-G57 PolarHBondContact O-N 3.15Å
58	D	96.8	Very high	95.7	Very high	33 Å²	33	57.5 Å²	57.5	18%	0.176	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	122	-174.1	-73.7	-19.9	0	0	0	110.9	V47 E48 R49 I92	V47-D58 HydrophobicContact CB-CB 4.22Å; V47-D58 HydrophobicContact CG2-CB 4.43Å; E48-D58 WeakPolarHBondContact O-CA 3.3Å; R49-D58 VanDerWaalsContact CB-OD1 3.27Å; R49-D58 WeakPolarHBondContact CB-OD1 3.22Å; R49-D58 WeakPolarHBondContact CG-OD1 3.5Å; R49-D58 IonicContact CZ-OD1 3.87Å; R49-D58 IonicContact CZ-OD2 3.6Å; R49-D58 IonicContact NE-OD1 2.78Å; R49-D58 PolarHBondContact NE-OD1 3.13Å; R49-D58 IonicContact NE-OD2 3.93Å; R49-D58 IonicContact NH2-OD1 3.6Å; R49-D58 IonicContact NH2-OD2 2.64Å; R49-D58 PolarHBondContact NH2-OD2 3.41Å; D58-I92 WeakPolarHBondContact O-CG1 3.41Å
59	I	96.6	Very high	95.5	Very high	21 Å²	21	61.7 Å²	61.7	11%	0.108	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.4	118.4	175.4	-55.6	178.4	0	0	0	108.7	V47 E48 I50 R61 I92 L96	V47-I59 CarbonylContact C-O 3.47Å; V47-I59 VanDerWaalsContact CA-O 3.32Å; V47-I59 WeakPolarHBondContact CA-O 3.47Å; E48-I59 HydrophobicContact CB-CB 4.32Å; E48-I59 PolarHBondContact N-O 2.86Å; E48-I59 PolarHBondContact O-N 3Å; I50-I59 HydrophobicContact CD1-CD1 3.6Å; I50-I59 HydrophobicContact CD1-CG1 4.4Å; I59-R61 PolarHBondContact O-N 2.7Å; I59-I92 HydrophobicContact CD1-CG2 4.25Å; I59-I92 HydrophobicContact CG1-CG1 4.32Å; I59-I92 HydrophobicContact CG1-CG2 3.95Å; I59-L96 HydrophobicContact CD1-CD2 4.12Å
60	P	97.2	Very high	95.4	Very high	96 Å²	96	63.3 Å²	63.3	62%	0.623	33%	0.334	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-67.3	127.3	178.3	27.4	-33.3	0	0	0	110.9
61	R	96.5	Very high	95.4	Very high	107 Å²	107	64.2 Å²	64.2	40%	0.404	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	-21.3	177.9	-61.9	-56.9	-172	-174.9	-0.5	113.4	T46 E48 I59 I63 F64	T46-R61 HydrophobicContact CG2-CB 4.31Å; T46-R61 WeakPolarHBondContact O-CA 3.49Å; T46-R61 PolarHBondContact O-N 2.81Å; E48-R61 HydrophobicContact CB-CG 4Å; E48-R61 IonicContact OE2-CZ 3.49Å; E48-R61 IonicContact OE2-NE 3.16Å; E48-R61 PolarHBondContact OE2-NE 3.41Å; E48-R61 IonicContact OE2-NH2 2.95Å; E48-R61 PolarHBondContact OE2-NH2 2.71Å; I59-R61 PolarHBondContact O-N 2.7Å; R61-I63 PolarHBondContact O-N 2.7Å; R61-F64 HydrophobicContact CB-CD2 3.98Å; R61-F64 HydrophobicContact CG-CD2 4.48Å
62	G	96.8	Very high	95.4	Very high	35 Å²	35	64.4 Å²	64.4	36%	0.361	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	82.3	-114.1	174.2	0	0	0	0	0	113	Q45 T46	Q45-G62 PolarHBondContact N-O 2.79Å; T46-G62 PolarHBondContact N-O 3.08Å; T46-G62 PolarHBondContact O-N 3.09Å; T46-G62 VanDerWaalsContact O-N 3.07Å; T46-G62 PolarHBondContact OG1-O 2.96Å
63	I	97.1	Very high	95.4	Very high	120 Å²	120	68 Å²	68	62%	0.615	36%	0.364	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.6	128	172.2	-63	170.4	0	0	0	107.8	V42 L43 R61	V42-I63 HydrophobicContact CG1-CG2 4.33Å; L43-I63 WeakPolarHBondContact O-CA 3.37Å; R61-I63 PolarHBondContact O-N 2.7Å
64	F	95.9	Very high	95.5	Very high	50 Å²	50	66.7 Å²	66.7	22%	0.219	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.8	127.2	-177.4	-149.8	-89.4	0	0	0	110.5	L28 L43 T46 R61 V66	L28-F64 HydrophobicContact CD1-CD1 3.49Å; L28-F64 VanDerWaalsContact CD1-CD1 3.49Å; L28-F64 HydrophobicContact CD1-CE1 3.68Å; L28-F64 HydrophobicContact CD1-CG 4.13Å; L28-F64 HydrophobicContact CD1-CZ 4.45Å; L43-F64 PolarHBondContact N-O 2.86Å; L43-F64 PolarHBondContact O-N 3.29Å; T46-F64 HydrophobicContact CG2-CB 4.02Å; R61-F64 HydrophobicContact CB-CD2 3.98Å; R61-F64 HydrophobicContact CG-CD2 4.48Å; F64-V66 HydrophobicContact CD1-CG2 3.69Å; F64-V66 HydrophobicContact CE1-CG2 4.14Å
65	V	96.5	Very high	95.5	Very high	108 Å²	108	60 Å²	60	66%	0.655	32%	0.32	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.7	119.6	174.9	-176.7	0	0	0	0	108.1	L41 V42	L41-V65 CarbonylContact O-C 3.58Å; L41-V65 WeakPolarHBondContact O-CA 3.46Å; V42-V65 HydrophobicContact CG2-CG2 4.42Å
66	V	96.2	Very high	95.5	Very high	6 Å²	6	62.9 Å²	62.9	4%	0.036	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	127.5	-179.6	-175.5	0	0	0	0	108.9	L22 L28 N40 L41 L43 F64 V71	L22-V66 HydrophobicContact CD2-CG1 3.58Å; L28-V66 HydrophobicContact CD1-CG2 3.84Å; N40-V66 CarbonylContact C-O 3.55Å; N40-V66 VanDerWaalsContact CA-O 3.3Å; N40-V66 WeakPolarHBondContact CA-O 3.17Å; L41-V66 HydrophobicContact CB-CB 4.23Å; L41-V66 PolarHBondContact N-O 3.19Å; L41-V66 PolarHBondContact O-N 2.81Å; L43-V66 HydrophobicContact CD1-CG2 4.47Å; F64-V66 HydrophobicContact CD1-CG2 3.69Å; F64-V66 HydrophobicContact CE1-CG2 4.14Å; V66-V71 HydrophobicContact CG1-CG2 3.62Å
67	R	96.1	Very high	95.4	Very high	152 Å²	152	62.9 Å²	62.9	57%	0.574	34%	0.336	S	S	*	.			trans	-76.8	130.2	170.3	-169.3	174	174.3	-167.5	-15.1	109.6	N40 E69 N70	N40-R67 VanDerWaalsContact OD1-CA 3.3Å; N40-R67 WeakPolarHBondContact OD1-CA 3.22Å; R67-E69 VanDerWaalsContact C-N 3.29Å; R67-E69 VanDerWaalsContact CD-CD 3.48Å; R67-E69 WeakPolarHBondContact CD-OE1 3.43Å; R67-E69 HydrophobicContact CG-CG 4.02Å; R67-E69 IonicContact CZ-OE1 2.81Å; R67-E69 IonicContact CZ-OE2 3.5Å; R67-E69 IonicContact NE-OE1 3.94Å; R67-E69 PolarHBondContact NE-OE1 2.97Å; R67-E69 IonicContact NE-OE2 3.2Å; R67-E69 PolarHBondContact NE-OE2 3.17Å; R67-E69 IonicContact NH1-OE1 2.79Å; R67-E69 PolarHBondContact NH1-OE1 2.88Å; R67-E69 VanDerWaalsContact NH1-OE1 3.16Å; R67-E69 IonicContact NH2-OE1 2.73Å; R67-E69 PolarHBondContact NH2-OE1 2.89Å; R67-E69 IonicContact NH2-OE2 2.69Å; R67-E69 PolarHBondContact NH2-OE2 2.73Å; R67-E69 PolarHBondContact O-N 2.99Å; R67-N70 WeakPolarHBondContact O-CB 3.44Å; R67-N70 PolarHBondContact O-N 3Å
68	G	93.7	Very high	95.2	Very high	10 Å²	10	65.8 Å²	65.8	10%	0.103	35%	0.352	C	S	.	.	G	3₁₀ helix	trans	-62	-28.9	-166.8	0	0	0	0	0	115.5	F38 A39 N40 N70 V71	F38-G68 WeakPolarHBondContact O-CA 3.32Å; A39-G68 WeakPolarHBondContact O-CA 3.34Å; N40-G68 PolarHBondContact OD1-N 2.67Å; G68-N70 PolarHBondContact O-N 2.92Å; G68-V71 WeakPolarHBondContact O-CB 3.48Å; G68-V71 PolarHBondContact O-N 3.07Å
69	E	94.4	Very high	94.8	Very high	101 Å²	101	69.4 Å²	69.4	47%	0.472	37%	0.37	S	S	.	.	G	3₁₀ helix	trans	-62.3	-21.3	173.9	69.7	-156.1	-159.2	0	0	114.4	R67	R67-E69 VanDerWaalsContact C-N 3.29Å; R67-E69 VanDerWaalsContact CD-CD 3.48Å; R67-E69 WeakPolarHBondContact CD-OE1 3.43Å; R67-E69 HydrophobicContact CG-CG 4.02Å; R67-E69 IonicContact CZ-OE1 2.81Å; R67-E69 IonicContact CZ-OE2 3.5Å; R67-E69 IonicContact NE-OE1 3.94Å; R67-E69 PolarHBondContact NE-OE1 2.97Å; R67-E69 IonicContact NE-OE2 3.2Å; R67-E69 PolarHBondContact NE-OE2 3.17Å; R67-E69 IonicContact NH1-OE1 2.79Å; R67-E69 PolarHBondContact NH1-OE1 2.88Å; R67-E69 VanDerWaalsContact NH1-OE1 3.16Å; R67-E69 IonicContact NH2-OE1 2.73Å; R67-E69 PolarHBondContact NH2-OE1 2.89Å; R67-E69 IonicContact NH2-OE2 2.69Å; R67-E69 PolarHBondContact NH2-OE2 2.73Å; R67-E69 PolarHBondContact O-N 2.99Å
70	N	94.8	Very high	94.3	Very high	67 Å²	67	76.2 Å²	76.2	36%	0.358	40%	0.402	S	S	.	.	G	3₁₀ helix	trans	-88.7	-8.3	176.4	-65.1	-54.6	0	0	0	112.6	L22 R23 R67 G68	L22-N70 CarbonylContact C-O 3.59Å; L22-N70 VanDerWaalsContact CA-O 3.24Å; L22-N70 WeakPolarHBondContact CA-O 3.4Å; R23-N70 PolarHBondContact N-O 3.37Å; R67-N70 WeakPolarHBondContact O-CB 3.44Å; R67-N70 PolarHBondContact O-N 3Å; G68-N70 PolarHBondContact O-N 2.92Å
71	V	94.5	Very high	93.6	Very high	26 Å²	26	78.5 Å²	78.5	16%	0.158	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.8	120.2	179	-179.4	0	0	0	0	109	V20 L41 V66 G68 L74	V20-V71 HydrophobicContact CG1-CG1 4.12Å; V20-V71 HydrophobicContact CG1-CG2 4.21Å; L41-V71 HydrophobicContact CD1-CG2 3.98Å; L41-V71 HydrophobicContact CG-CG2 4.43Å; V66-V71 HydrophobicContact CG1-CG2 3.62Å; G68-V71 WeakPolarHBondContact O-CB 3.48Å; G68-V71 PolarHBondContact O-N 3.07Å; V71-L74 HydrophobicContact CG1-CD2 4.01Å
72	V	94.8	Very high	92.9	Very high	87 Å²	87	75.7 Å²	75.7	53%	0.527	39%	0.394	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.3	-50.6	172.4	175.3	0	0	0	0	109.7	L21 R23	L21-V72 HydrophobicContact CB-CB 4.48Å; L21-V72 HydrophobicContact CD2-CB 4.29Å; L21-V72 HydrophobicContact CD2-CG1 4.11Å; L21-V72 HydrophobicContact CG-CB 4.24Å; L21-V72 WeakPolarHBondContact O-CB 3.38Å; L21-V72 PolarHBondContact O-N 3.02Å; R23-V72 HydrophobicContact CB-CG2 4.3Å
73	L	94.3	Very high	92	Very high	89 Å²	89	79.1 Å²	79.1	47%	0.466	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.2	160	175.9	59.3	80.3	0	0	0	110	L19 L21	L19-L73 HydrophobicContact CD2-CD1 4.31Å; L21-L73 HydrophobicContact CB-CD1 3.76Å; L21-L73 HydrophobicContact CB-CG 3.89Å; L21-L73 HydrophobicContact CD2-CD1 4.47Å; L21-L73 HydrophobicContact CD2-CD2 4.16Å; L21-L73 HydrophobicContact CD2-CG 4.07Å; L21-L73 PolarHBondContact N-O 2.81Å
74	L	94	Very high	91.3	Very high	45 Å²	45	80.1 Å²	80.1	24%	0.236	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.4	154.8	167.1	67.2	156.2	0	0	0	110	L10 L19 V20 L41 V71	L10-L74 HydrophobicContact CD1-CD1 3.97Å; L10-L74 HydrophobicContact CD1-CD2 4.07Å; L10-L74 HydrophobicContact CD2-CD1 3.63Å; L10-L74 HydrophobicContact CD2-CD2 4.47Å; L10-L74 HydrophobicContact CD2-CG 4.13Å; L10-L74 HydrophobicContact CG-CD1 4.43Å; L19-L74 CarbonylContact O-C 3.53Å; L19-L74 WeakPolarHBondContact O-CA 3.46Å; V20-L74 HydrophobicContact CG2-CB 4.04Å; L41-L74 HydrophobicContact CD1-CD1 4.28Å; V71-L74 HydrophobicContact CG1-CD2 4.01Å
75	G	93.4	Very high	90.6	Very high	31 Å²	31	80.5 Å²	80.5	32%	0.32	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.6	145.9	175.6	0	0	0	0	0	112.2	H18 L19	H18-G75 WeakPolarHBondContact CA-O 3.44Å; H18-G75 PolarHBondContact CD2-O 3.23Å; L19-G75 PolarHBondContact N-O 3.44Å; L19-G75 PolarHBondContact O-N 3.38Å
76	E	94.1	Very high	90.3	Very high	108 Å²	108	81.3 Å²	81.3	51%	0.505	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.8	134.5	173.4	-173.4	-177.1	159.4	0	0	110.1	K16 H18	K16-E76 HydrophobicContact CB-CG 4.31Å; K16-E76 HydrophobicContact CD-CG 3.96Å; K16-E76 WeakPolarHBondContact CD-OE1 3.27Å; K16-E76 WeakPolarHBondContact CD-OE2 3.38Å; K16-E76 WeakPolarHBondContact CE-OE2 3.47Å; K16-E76 IonicContact NZ-OE2 2.8Å; K16-E76 PolarHBondContact NZ-OE2 2.8Å; H18-E76 PolarHBondContact CD2-N 3.4Å; H18-E76 PolarHBondContact NE2-N 3.5Å
77	I	93.3	Very high	90.1	Very high	28 Å²	28	83.9 Å²	83.9	14%	0.144	45%	0.446	C	S	.	.			trans	-90.7	121.6	172.9	-60.9	-177.4	0	0	0	108.5	K17 L19 I29 L79 E82	K17-I77 HydrophobicContact CB-CB 4.48Å; K17-I77 HydrophobicContact CG-CB 4.42Å; K17-I77 HydrophobicContact CG-CD1 4.28Å; K17-I77 PolarHBondContact O-N 2.92Å; L19-I77 HydrophobicContact CB-CD1 3.97Å; L19-I77 HydrophobicContact CB-CG1 3.98Å; I29-I77 HydrophobicContact CB-CD1 4.34Å; I29-I77 HydrophobicContact CD1-CD1 4.29Å; I29-I77 HydrophobicContact CG1-CD1 4.09Å; I29-I77 HydrophobicContact CG2-CD1 3.47Å; I29-I77 VanDerWaalsContact CG2-CD1 3.47Å; I77-L79 PolarHBondContact O-N 2.83Å; I77-E82 HydrophobicContact CG2-CB 4.3Å; I77-E82 HydrophobicContact CG2-CG 4.49Å
78	D	92	Very high	89.9	Confident	62 Å²	62	82.3 Å²	82.3	33%	0.332	45%	0.445	S	S	.	.			trans	-70.7	109	167.3	-174.4	-17.7	0	0	0	109.7	E80 K81 E82	D78-E80 PolarHBondContact O-N 3.35Å; D78-E80 WeakPolarHBondContact OD1-CB 3.4Å; D78-E80 PolarHBondContact OD1-N 2.88Å; D78-K81 HydrophobicContact CB-CB 4.3Å; D78-K81 HydrophobicContact CB-CD 4.32Å; D78-K81 HydrophobicContact CB-CG 4.37Å; D78-K81 PolarHBondContact O-N 2.98Å; D78-K81 WeakPolarHBondContact OD2-CD 3.48Å; D78-K81 WeakPolarHBondContact OD2-CE 3.48Å; D78-K81 IonicContact OD2-NZ 2.72Å; D78-K81 PolarHBondContact OD2-NZ 2.82Å; D78-E82 PolarHBondContact O-N 3.1Å; D78-E82 VanDerWaalsContact O-N 3.16Å
79	L	87.9	Confident	89.9	Confident	108 Å²	108	87.6 Å²	87.6	57%	0.565	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.5	-26.9	-176.9	-62.9	177.1	0	0	0	112.7	K17 I77	K17-L79 HydrophobicContact CB-CD2 4.13Å; K17-L79 HydrophobicContact CD-CD2 3.62Å; I77-L79 PolarHBondContact O-N 2.83Å
80	E	86.5	Confident	90	Very high	164 Å²	164	83.6 Å²	83.6	77%	0.766	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.5	-39.1	179.1	-60.3	-174.6	169.6	0	0	110.6	D78 S83	D78-E80 PolarHBondContact O-N 3.35Å; D78-E80 WeakPolarHBondContact OD1-CB 3.4Å; D78-E80 PolarHBondContact OD1-N 2.88Å; E80-S83 PolarHBondContact O-OG 2.84Å; E80-S83 VanDerWaalsContact O-OG 3.1Å
81	K	83.8	Confident	90.1	Very high	144 Å²	144	83.3 Å²	83.3	63%	0.626	45%	0.453	S	S	*	.	G	3₁₀ helix	trans	-83.1	-18.3	-177.6	-64.8	-177.9	-175	119.8	0	114	D78 S83 D84	D78-K81 HydrophobicContact CB-CB 4.3Å; D78-K81 HydrophobicContact CB-CD 4.32Å; D78-K81 HydrophobicContact CB-CG 4.37Å; D78-K81 PolarHBondContact O-N 2.98Å; D78-K81 WeakPolarHBondContact OD2-CD 3.48Å; D78-K81 WeakPolarHBondContact OD2-CE 3.48Å; D78-K81 IonicContact OD2-NZ 2.72Å; D78-K81 PolarHBondContact OD2-NZ 2.82Å; K81-S83 PolarHBondContact O-N 2.95Å; K81-D84 PolarHBondContact O-N 2.83Å
82	E	81.9	Confident	90.1	Very high	49 Å²	49	85.3 Å²	85.3	23%	0.229	46%	0.462	C	S	.	.	G	3₁₀ helix	trans	-60.7	-28.7	179.4	-170	176	-171.4	0	0	112.3	K17 R49 I77 D78 T85	K17-E82 IonicContact NZ-OE1 3.16Å; K17-E82 PolarHBondContact NZ-OE1 3.4Å; K17-E82 IonicContact NZ-OE2 3.47Å; K17-E82 PolarHBondContact NZ-OE2 2.92Å; R49-E82 IonicContact NH2-OE1 2.73Å; I77-E82 HydrophobicContact CG2-CB 4.3Å; I77-E82 HydrophobicContact CG2-CG 4.49Å; D78-E82 PolarHBondContact O-N 3.1Å; D78-E82 VanDerWaalsContact O-N 3.16Å; E82-T85 WeakPolarHBondContact O-CG2 3.37Å
83	S	77	Confident	90.1	Very high	107 Å²	107	89 Å²	89	75%	0.748	47%	0.473	S	S	*	.	G	3₁₀ helix	trans	-75.2	-22.5	177.2	66.9	0	0	0	0	114	E80 K81 T85	E80-S83 PolarHBondContact O-OG 2.84Å; E80-S83 VanDerWaalsContact O-OG 3.1Å; K81-S83 PolarHBondContact O-N 2.95Å; S83-T85 VanDerWaalsContact C-N 3.33Å; S83-T85 PolarHBondContact O-N 2.79Å
84	D	81.4	Confident	90.2	Very high	141 Å²	141	88.4 Å²	88.4	75%	0.754	47%	0.468	S	S	*	.			trans	-97.4	48.5	-175	-167.4	26.7	0	0	0	111.6	K81	K81-D84 PolarHBondContact O-N 2.83Å
85	T	82.7	Confident	90.3	Very high	58 Å²	58	86.2 Å²	86.2	36%	0.356	46%	0.457	S	S	.	.			trans	-99.6	132.8	177.5	63.4	0	0	0	0	110.9	E82 S83 L87	E82-T85 WeakPolarHBondContact O-CG2 3.37Å; S83-T85 VanDerWaalsContact C-N 3.33Å; S83-T85 PolarHBondContact O-N 2.79Å; T85-L87 PolarHBondContact O-N 2.84Å; T85-L87 VanDerWaalsContact O-N 3.13Å
86	P	89.1	Confident	90.4	Very high	124 Å²	124	88.3 Å²	88.3	81%	0.805	46%	0.46	S	S	*	.			trans	-76.3	8.4	175.2	33.4	-37.1	0	0	0	112.8
87	L	92	Very high	90.5	Very high	60 Å²	60	87.4 Å²	87.4	31%	0.314	46%	0.456	S	S	.	.	P	Polyproline II helix	trans	-90.8	138.1	-172.7	-59.3	175.3	0	0	0	110.5	K54 Y56 T85	K54-L87 CarbonylContact O-C 3.53Å; K54-L87 WeakPolarHBondContact O-CA 3.1Å; Y56-L87 HydrophobicContact CD1-CB 3.61Å; Y56-L87 HydrophobicContact CE1-CB 4.1Å; T85-L87 PolarHBondContact O-N 2.84Å; T85-L87 VanDerWaalsContact O-N 3.13Å
88	Q	92.8	Very high	90.5	Very high	120 Å²	120	88.8 Å²	88.8	56%	0.561	46%	0.462	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.4	121.1	177.2	-178.8	-179.1	-4.8	0	0	110.4	K54 K55 Y56 V90	K54-Q88 PolarHBondContact O-N 2.87Å; K55-Q88 CarbonylContact C-O 3.6Å; K55-Q88 VanDerWaalsContact CA-O 3.22Å; K55-Q88 WeakPolarHBondContact CA-O 3.02Å; K55-Q88 HydrophobicContact CG-CB 4.21Å; Y56-Q88 PolarHBondContact N-O 3.17Å; Q88-V90 HydrophobicContact CG-CG1 4.23Å
89	Q	94	Very high	90.6	Very high	120 Å²	120	88.2 Å²	88.2	56%	0.561	46%	0.457	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-72.5	129.5	170.6	-164.4	175.3	7.2	0	0	110.1	Y56	Y56-Q89 HydrophobicContact CD1-CB 4.35Å; Y56-Q89 HydrophobicContact CD2-CG 4.43Å; Y56-Q89 HydrophobicContact CE1-CB 3.66Å; Y56-Q89 HydrophobicContact CE1-CG 4.23Å; Y56-Q89 HydrophobicContact CE2-CB 4.16Å; Y56-Q89 HydrophobicContact CE2-CG 3.78Å; Y56-Q89 CarbonylContact O-C 3.23Å; Y56-Q89 WeakPolarHBondContact O-CA 3.27Å
90	V	95.8	Very high	91	Very high	17 Å²	17	88.6 Å²	88.6	10%	0.103	45%	0.451	C	S	.	.			trans	-124.4	170.4	177.3	-62.3	0	0	0	0	111.2	K55 Y56 Q88 E94 I95	K55-V90 HydrophobicContact CB-CG1 4.18Å; K55-V90 HydrophobicContact CB-CG2 4.27Å; K55-V90 HydrophobicContact CD-CG1 3.86Å; K55-V90 HydrophobicContact CG-CG1 3.94Å; Y56-V90 WeakPolarHBondContact O-CG2 3.24Å; Y56-V90 PolarHBondContact O-N 3.28Å; Q88-V90 HydrophobicContact CG-CG1 4.23Å; V90-E94 HydrophobicContact CB-CB 4.3Å; V90-E94 HydrophobicContact CB-CG 4.24Å; V90-E94 HydrophobicContact CG2-CB 4.41Å; V90-E94 HydrophobicContact CG2-CG 4.4Å; V90-I95 HydrophobicContact CG2-CB 3.8Å; V90-I95 HydrophobicContact CG2-CD1 3.94Å; V90-I95 HydrophobicContact CG2-CG1 4.37Å
91	S	96.4	Very high	91.4	Very high	62 Å²	62	84 Å²	84	43%	0.434	43%	0.434	S	S	.	.			trans	-66.8	157.4	177.9	71.6	0	0	0	0	112	E93 E94 I95	S91-E93 PolarHBondContact O-N 2.9Å; S91-E94 PolarHBondContact O-N 2.92Å; S91-E94 VanDerWaalsContact OG-CB 3.28Å; S91-E94 WeakPolarHBondContact OG-CB 3.3Å; S91-E94 PolarHBondContact OG-N 2.8Å; S91-I95 PolarHBondContact O-N 3.38Å
92	I	95.2	Very high	91.9	Very high	68 Å²	68	80 Å²	80	35%	0.349	42%	0.418	S	S	.	.	H	α-helix	trans	-58.5	-40.1	176.4	-64.3	171.8	0	0	0	110.8	D58 I59 I95 L96	D58-I92 WeakPolarHBondContact O-CG1 3.41Å; I59-I92 HydrophobicContact CD1-CG2 4.25Å; I59-I92 HydrophobicContact CG1-CG1 4.32Å; I59-I92 HydrophobicContact CG1-CG2 3.95Å; I92-I95 WeakPolarHBondContact O-CG2 3.37Å; I92-L96 HydrophobicContact CG2-CD1 3.67Å; I92-L96 HydrophobicContact CG2-CG 4.29Å; I92-L96 WeakPolarHBondContact O-CB 3.39Å; I92-L96 WeakPolarHBondContact O-CD1 3.36Å; I92-L96 WeakPolarHBondContact O-CG 3.39Å; I92-L96 PolarHBondContact O-N 3.42Å; I92-L96 VanDerWaalsContact O-N 3.13Å
93	E	95.7	Very high	92.3	Very high	165 Å²	165	82.4 Å²	82.4	77%	0.771	43%	0.429	S	S	*	.	H	α-helix	trans	-65.5	-44.3	179.6	-63.9	176.7	-178.3	0	0	111.6	S91 E97	S91-E93 PolarHBondContact O-N 2.9Å; E93-E97 PolarHBondContact O-N 2.86Å; E93-E97 VanDerWaalsContact O-N 3.15Å
94	E	95.9	Very high	93.2	Very high	75 Å²	75	81.4 Å²	81.4	35%	0.35	41%	0.412	S	S	.	.	H	α-helix	trans	-64.9	-47.4	178.8	-174.7	179	166.8	0	0	111.8	K55 V90 S91 L96 E97 E98	K55-E94 IonicContact NZ-OE1 2.74Å; K55-E94 PolarHBondContact NZ-OE1 2.89Å; V90-E94 HydrophobicContact CB-CB 4.3Å; V90-E94 HydrophobicContact CB-CG 4.24Å; V90-E94 HydrophobicContact CG2-CB 4.41Å; V90-E94 HydrophobicContact CG2-CG 4.4Å; S91-E94 PolarHBondContact O-N 2.92Å; S91-E94 VanDerWaalsContact OG-CB 3.28Å; S91-E94 WeakPolarHBondContact OG-CB 3.3Å; S91-E94 PolarHBondContact OG-N 2.8Å; E94-L96 VanDerWaalsContact C-N 3.33Å; E94-L96 PolarHBondContact O-N 2.87Å; E94-E97 PolarHBondContact O-N 3.35Å; E94-E98 WeakPolarHBondContact O-CG 3.47Å; E94-E98 PolarHBondContact O-N 2.88Å
95	I	96	Very high	93.8	Very high	0 Å²	0	78.3 Å²	78.3	0%	0	40%	0.399	C	S	.	.	H	α-helix	trans	-66.7	-35.5	-178.3	-161.3	65.2	0	0	0	112.2	I50 V52 K55 V90 S91 I92 Q99	I50-I95 HydrophobicContact CB-CG1 3.75Å; I50-I95 HydrophobicContact CB-CG2 4.34Å; I50-I95 HydrophobicContact CD1-CG2 4.26Å; I50-I95 HydrophobicContact CG2-CD1 4.42Å; I50-I95 HydrophobicContact CG2-CG1 3.61Å; V52-I95 HydrophobicContact CB-CD1 3.92Å; V52-I95 HydrophobicContact CG2-CD1 3.73Å; V52-I95 HydrophobicContact CG2-CG1 4.3Å; K55-I95 HydrophobicContact CB-CD1 4.31Å; V90-I95 HydrophobicContact CG2-CB 3.8Å; V90-I95 HydrophobicContact CG2-CD1 3.94Å; V90-I95 HydrophobicContact CG2-CG1 4.37Å; S91-I95 PolarHBondContact O-N 3.38Å; I92-I95 WeakPolarHBondContact O-CG2 3.37Å; I95-Q99 WeakPolarHBondContact O-CB 3.5Å; I95-Q99 PolarHBondContact O-N 2.8Å
96	L	95	Very high	94.2	Very high	75 Å²	75	81 Å²	81	39%	0.393	41%	0.406	S	S	.	.	H	α-helix	trans	-67.5	-39.6	178.1	-75.5	172.5	0	0	0	111.2	I50 I59 I92 E94 R100	I50-L96 HydrophobicContact CD1-CD2 3.63Å; I50-L96 HydrophobicContact CD1-CG 4.4Å; I59-L96 HydrophobicContact CD1-CD2 4.12Å; I92-L96 HydrophobicContact CG2-CD1 3.67Å; I92-L96 HydrophobicContact CG2-CG 4.29Å; I92-L96 WeakPolarHBondContact O-CB 3.39Å; I92-L96 WeakPolarHBondContact O-CD1 3.36Å; I92-L96 WeakPolarHBondContact O-CG 3.39Å; I92-L96 PolarHBondContact O-N 3.42Å; I92-L96 VanDerWaalsContact O-N 3.13Å; E94-L96 VanDerWaalsContact C-N 3.33Å; E94-L96 PolarHBondContact O-N 2.87Å; L96-R100 WeakPolarHBondContact O-CB 3.47Å; L96-R100 PolarHBondContact O-N 2.7Å
97	E	95.3	Very high	94.4	Very high	89 Å²	89	79.6 Å²	79.6	42%	0.416	39%	0.391	S	S	.	.	H	α-helix	trans	-68.3	-44.3	176.1	-178.4	55.8	-161.1	0	0	111.6	E93 E94 Q99 R100 V101	E93-E97 PolarHBondContact O-N 2.86Å; E93-E97 VanDerWaalsContact O-N 3.15Å; E94-E97 PolarHBondContact O-N 3.35Å; E97-Q99 VanDerWaalsContact C-N 3.33Å; E97-Q99 PolarHBondContact O-N 3.18Å; E97-R100 WeakPolarHBondContact O-CB 3.07Å; E97-R100 PolarHBondContact O-N 2.92Å; E97-R100 IonicContact OE1-CZ 3.09Å; E97-R100 IonicContact OE1-NE 3.64Å; E97-R100 PolarHBondContact OE1-NE 3Å; E97-R100 IonicContact OE1-NH2 3.63Å; E97-R100 PolarHBondContact OE1-NH2 3.1Å; E97-R100 IonicContact OE2-CZ 3.5Å; E97-R100 IonicContact OE2-NE 2.81Å; E97-R100 PolarHBondContact OE2-NE 3.47Å; E97-R100 IonicContact OE2-NH2 3.38Å; E97-R100 PolarHBondContact OE2-NH2 3.32Å; E97-V101 WeakPolarHBondContact O-CG2 3.23Å; E97-V101 PolarHBondContact O-N 2.81Å
98	E	94.6	Very high	94.4	Very high	57 Å²	57	82.6 Å²	82.6	27%	0.266	40%	0.403	S	S	.	.	H	α-helix	trans	-61.4	-41.6	174.8	-72.3	-166.3	175.2	0	0	112.1	V52 K55 E94 R100 V101 E102	V52-E98 HydrophobicContact CB-CB 4.23Å; V52-E98 HydrophobicContact CG1-CB 3.97Å; V52-E98 HydrophobicContact CG2-CB 4.31Å; K55-E98 VanDerWaalsContact CD-OE1 3.3Å; K55-E98 WeakPolarHBondContact CD-OE1 3.31Å; K55-E98 WeakPolarHBondContact CD-OE2 3.36Å; K55-E98 WeakPolarHBondContact CE-OE1 3.31Å; K55-E98 IonicContact NZ-OE1 2.99Å; K55-E98 PolarHBondContact NZ-OE1 3.47Å; E94-E98 WeakPolarHBondContact O-CG 3.47Å; E94-E98 PolarHBondContact O-N 2.88Å; E98-R100 VanDerWaalsContact C-N 3.33Å; E98-R100 PolarHBondContact O-N 3.5Å; E98-V101 PolarHBondContact O-N 3.01Å; E98-E102 WeakPolarHBondContact O-CB 3.22Å; E98-E102 PolarHBondContact O-N 2.8Å
99	Q	94.7	Very high	94.5	Very high	49 Å²	49	79.6 Å²	79.6	23%	0.229	40%	0.399	C	S	.	.	H	α-helix	trans	-62.5	-41.4	175.9	-174.1	-174.7	36.2	0	0	111	I50 V52 I95 E97 V101 E102 Q103	I50-Q99 HydrophobicContact CG2-CB 4.04Å; I50-Q99 HydrophobicContact CG2-CG 4.05Å; V52-Q99 HydrophobicContact CG2-CB 3.89Å; I95-Q99 WeakPolarHBondContact O-CB 3.5Å; I95-Q99 PolarHBondContact O-N 2.8Å; E97-Q99 VanDerWaalsContact C-N 3.33Å; E97-Q99 PolarHBondContact O-N 3.18Å; Q99-V101 PolarHBondContact O-N 3.3Å; Q99-E102 PolarHBondContact O-N 2.74Å; Q99-Q103 HydrophobicContact CG-CG 4.36Å; Q99-Q103 WeakPolarHBondContact O-CB 3.37Å; Q99-Q103 VanDerWaalsContact O-CG 3.28Å; Q99-Q103 WeakPolarHBondContact O-CG 3.01Å; Q99-Q103 PolarHBondContact O-N 2.76Å
100	R	94.4	Very high	94.3	Very high	116 Å²	116	79.3 Å²	79.3	44%	0.438	40%	0.398	S	S	.	.	H	α-helix	trans	-60.6	-44.9	177.7	-171.6	-177.3	75.5	91.5	7.7	111.4	L96 E97 E98 Q104	L96-R100 WeakPolarHBondContact O-CB 3.47Å; L96-R100 PolarHBondContact O-N 2.7Å; E97-R100 WeakPolarHBondContact O-CB 3.07Å; E97-R100 PolarHBondContact O-N 2.92Å; E97-R100 IonicContact OE1-CZ 3.09Å; E97-R100 IonicContact OE1-NE 3.64Å; E97-R100 PolarHBondContact OE1-NE 3Å; E97-R100 IonicContact OE1-NH2 3.63Å; E97-R100 PolarHBondContact OE1-NH2 3.1Å; E97-R100 IonicContact OE2-CZ 3.5Å; E97-R100 IonicContact OE2-NE 2.81Å; E97-R100 PolarHBondContact OE2-NE 3.47Å; E97-R100 IonicContact OE2-NH2 3.38Å; E97-R100 PolarHBondContact OE2-NH2 3.32Å; E98-R100 VanDerWaalsContact C-N 3.33Å; E98-R100 PolarHBondContact O-N 3.5Å; R100-Q104 VanDerWaalsContact NH1-NE2 3.13Å; R100-Q104 VanDerWaalsContact O-CG 3.3Å; R100-Q104 WeakPolarHBondContact O-CG 3.42Å; R100-Q104 PolarHBondContact O-N 2.89Å
101	V	95.4	Very high	94	Very high	68 Å²	68	85.7 Å²	85.7	41%	0.412	42%	0.424	S	S	.	.	H	α-helix	trans	-65.6	-43.5	176.9	175.1	0	0	0	0	111	E97 E98 Q99 Q103 Q104 T105	E97-V101 WeakPolarHBondContact O-CG2 3.23Å; E97-V101 PolarHBondContact O-N 2.81Å; E98-V101 PolarHBondContact O-N 3.01Å; Q99-V101 PolarHBondContact O-N 3.3Å; V101-Q103 PolarHBondContact O-N 2.82Å; V101-Q104 PolarHBondContact O-N 3.36Å; V101-T105 WeakPolarHBondContact O-CG2 3.49Å; V101-T105 PolarHBondContact O-N 2.74Å; V101-T105 PolarHBondContact O-OG1 2.79Å; V101-T105 VanDerWaalsContact O-OG1 3.12Å
102	E	94	Very high	93.8	Very high	61 Å²	61	88.9 Å²	88.9	29%	0.285	44%	0.436	S	S	.	.	H	α-helix	trans	-64	-41	177.9	-160.9	-161.6	-148	0	0	112	V52 E98 Q99 T105 K106	V52-E102 HydrophobicContact CG1-CB 4.27Å; E98-E102 WeakPolarHBondContact O-CB 3.22Å; E98-E102 PolarHBondContact O-N 2.8Å; Q99-E102 PolarHBondContact O-N 2.74Å; E102-T105 WeakPolarHBondContact CA-OG1 3.49Å; E102-T105 PolarHBondContact O-OG1 3.39Å; E102-K106 HydrophobicContact CG-CD 4.26Å; E102-K106 WeakPolarHBondContact O-CB 3.3Å; E102-K106 VanDerWaalsContact O-CG 3.28Å; E102-K106 WeakPolarHBondContact O-CG 3.39Å; E102-K106 PolarHBondContact O-N 2.86Å; E102-K106 IonicContact OE1-NZ 3.51Å; E102-K106 PolarHBondContact OE1-NZ 2.87Å; E102-K106 VanDerWaalsContact OE1-NZ 3.09Å; E102-K106 IonicContact OE2-NZ 3.56Å; E102-K106 PolarHBondContact OE2-NZ 3.01Å
103	Q	91.9	Very high	93.6	Very high	99 Å²	99	91.9 Å²	91.9	46%	0.463	45%	0.446	S	S	.	.	H	α-helix	trans	-65.4	-42.6	176.3	-75.2	176.6	-5.3	0	0	111.8	Q99 V101 K106 L107	Q99-Q103 HydrophobicContact CG-CG 4.36Å; Q99-Q103 WeakPolarHBondContact O-CB 3.37Å; Q99-Q103 VanDerWaalsContact O-CG 3.28Å; Q99-Q103 WeakPolarHBondContact O-CG 3.01Å; Q99-Q103 PolarHBondContact O-N 2.76Å; V101-Q103 PolarHBondContact O-N 2.82Å; Q103-K106 PolarHBondContact O-N 2.95Å; Q103-L107 WeakPolarHBondContact O-CB 3.16Å; Q103-L107 WeakPolarHBondContact O-CG 3.34Å; Q103-L107 PolarHBondContact O-N 2.96Å
104	Q	94.3	Very high	93.2	Very high	86 Å²	86	87 Å²	87	40%	0.402	43%	0.428	S	S	.	.	H	α-helix	trans	-61.1	-47.2	176.7	-75.5	172.3	11.8	0	0	111.8	R100 V101 K106 L107 E108	R100-Q104 VanDerWaalsContact NH1-NE2 3.13Å; R100-Q104 VanDerWaalsContact O-CG 3.3Å; R100-Q104 WeakPolarHBondContact O-CG 3.42Å; R100-Q104 PolarHBondContact O-N 2.89Å; V101-Q104 PolarHBondContact O-N 3.36Å; Q104-K106 PolarHBondContact O-N 3.09Å; Q104-L107 PolarHBondContact O-N 3.13Å; Q104-E108 WeakPolarHBondContact O-CG 3.39Å; Q104-E108 PolarHBondContact O-N 2.66Å
105	T	94.7	Very high	93	Very high	76 Å²	76	88.1 Å²	88.1	47%	0.466	43%	0.432	S	S	.	.	H	α-helix	trans	-64.2	-40.2	178.2	54.7	0	0	0	0	112.2	V101 E102 E108 A109	V101-T105 WeakPolarHBondContact O-CG2 3.49Å; V101-T105 PolarHBondContact O-N 2.74Å; V101-T105 PolarHBondContact O-OG1 2.79Å; V101-T105 VanDerWaalsContact O-OG1 3.12Å; E102-T105 WeakPolarHBondContact CA-OG1 3.49Å; E102-T105 PolarHBondContact O-OG1 3.39Å; T105-E108 PolarHBondContact O-N 3.29Å; T105-A109 WeakPolarHBondContact O-CB 3.47Å; T105-A109 PolarHBondContact O-N 2.64Å
106	K	92	Very high	92.8	Very high	115 Å²	115	90.4 Å²	90.4	50%	0.5	45%	0.451	S	S	.	.	H	α-helix	trans	-61.9	-45.2	173.6	-77	172.8	178.8	167.9	0	112	E102 Q103 Q104 E108 A109 E110	E102-K106 HydrophobicContact CG-CD 4.26Å; E102-K106 WeakPolarHBondContact O-CB 3.3Å; E102-K106 VanDerWaalsContact O-CG 3.28Å; E102-K106 WeakPolarHBondContact O-CG 3.39Å; E102-K106 PolarHBondContact O-N 2.86Å; E102-K106 IonicContact OE1-NZ 3.51Å; E102-K106 PolarHBondContact OE1-NZ 2.87Å; E102-K106 VanDerWaalsContact OE1-NZ 3.09Å; E102-K106 IonicContact OE2-NZ 3.56Å; E102-K106 PolarHBondContact OE2-NZ 3.01Å; Q103-K106 PolarHBondContact O-N 2.95Å; Q104-K106 PolarHBondContact O-N 3.09Å; K106-E108 PolarHBondContact O-N 3.18Å; K106-A109 PolarHBondContact O-N 2.78Å; K106-E110 VanDerWaalsContact O-CB 3.31Å; K106-E110 WeakPolarHBondContact O-CB 3.44Å; K106-E110 PolarHBondContact O-N 2.83Å
107	L	91.5	Very high	92.6	Very high	94 Å²	94	88.6 Å²	88.6	49%	0.492	44%	0.442	S	S	.	.	H	α-helix	trans	-63.5	-40.4	178.2	-74	169.4	0	0	0	112.3	Q103 Q104 K111	Q103-L107 WeakPolarHBondContact O-CB 3.16Å; Q103-L107 WeakPolarHBondContact O-CG 3.34Å; Q103-L107 PolarHBondContact O-N 2.96Å; Q104-L107 PolarHBondContact O-N 3.13Å; L107-K111 VanDerWaalsContact O-CG 3.29Å; L107-K111 WeakPolarHBondContact O-CG 3.36Å; L107-K111 PolarHBondContact O-N 3.06Å
108	E	93.5	Very high	92.4	Very high	122 Å²	122	91.4 Å²	91.4	57%	0.57	45%	0.453	S	S	*	.	H	α-helix	trans	-65.7	-45.5	175.6	-72.6	177.5	177.2	0	0	111.8	Q104 T105 K106 E110 K111 L112	Q104-E108 WeakPolarHBondContact O-CG 3.39Å; Q104-E108 PolarHBondContact O-N 2.66Å; T105-E108 PolarHBondContact O-N 3.29Å; K106-E108 PolarHBondContact O-N 3.18Å; E108-E110 VanDerWaalsContact C-N 3.33Å; E108-E110 PolarHBondContact O-N 3.5Å; E108-K111 PolarHBondContact O-N 3.48Å; E108-L112 WeakPolarHBondContact O-CG 3.41Å; E108-L112 PolarHBondContact O-N 3.46Å; E108-L112 VanDerWaalsContact O-N 3.11Å
109	A	93.3	Very high	92.2	Very high	58 Å²	58	94.3 Å²	94.3	48%	0.479	47%	0.47	S	S	.	.	H	α-helix	trans	-62.8	-39.4	176	0	0	0	0	0	112.2	T105 K106 L112 K113	T105-A109 WeakPolarHBondContact O-CB 3.47Å; T105-A109 PolarHBondContact O-N 2.64Å; K106-A109 PolarHBondContact O-N 2.78Å; A109-L112 PolarHBondContact O-N 3.4Å; A109-K113 WeakPolarHBondContact O-CB 3.38Å; A109-K113 PolarHBondContact O-N 3.5Å
110	E	90.5	Very high	92.2	Very high	114 Å²	114	101.4 Å²	101.4	53%	0.533	50%	0.495	S	S	.	.	H	α-helix	trans	-65.4	-43.7	176.7	-171.6	177.9	-175.4	0	0	111.5	K106 E108 L112 K113 V114	K106-E110 VanDerWaalsContact O-CB 3.31Å; K106-E110 WeakPolarHBondContact O-CB 3.44Å; K106-E110 PolarHBondContact O-N 2.83Å; E108-E110 VanDerWaalsContact C-N 3.33Å; E108-E110 PolarHBondContact O-N 3.5Å; E110-L112 VanDerWaalsContact C-N 3.34Å; E110-L112 PolarHBondContact O-N 3.27Å; E110-K113 PolarHBondContact O-N 3.33Å; E110-V114 HydrophobicContact CG-CG2 4.23Å; E110-V114 WeakPolarHBondContact O-CB 3.5Å; E110-V114 VanDerWaalsContact O-CG2 3.29Å; E110-V114 WeakPolarHBondContact O-CG2 3.36Å; E110-V114 PolarHBondContact O-N 3.11Å
111	K	89.8	Confident	92	Very high	150 Å²	150	99.3 Å²	99.3	65%	0.652	51%	0.509	S	S	*	.	H	α-helix	trans	-57.7	-45.8	174.8	-75.9	172.7	-175.1	176.2	0	111.9	L107 E108 V114 Q115	L107-K111 VanDerWaalsContact O-CG 3.29Å; L107-K111 WeakPolarHBondContact O-CG 3.36Å; L107-K111 PolarHBondContact O-N 3.06Å; E108-K111 PolarHBondContact O-N 3.48Å; K111-V114 PolarHBondContact O-N 3.11Å; K111-Q115 WeakPolarHBondContact O-CB 3.45Å; K111-Q115 PolarHBondContact O-N 3.27Å
112	L	92	Very high	91.7	Very high	130 Å²	130	100.9 Å²	100.9	68%	0.681	51%	0.514	S	S	*	.	H	α-helix	trans	-63	-42.6	177.1	-68.5	171.7	0	0	0	111.6	E108 A109 E110 Q115 A116	E108-L112 WeakPolarHBondContact O-CG 3.41Å; E108-L112 PolarHBondContact O-N 3.46Å; E108-L112 VanDerWaalsContact O-N 3.11Å; A109-L112 PolarHBondContact O-N 3.4Å; E110-L112 VanDerWaalsContact C-N 3.34Å; E110-L112 PolarHBondContact O-N 3.27Å; L112-Q115 PolarHBondContact O-N 3.01Å; L112-A116 WeakPolarHBondContact O-CB 3.4Å; L112-A116 PolarHBondContact O-N 3.3Å
113	K	90.4	Very high	91.3	Very high	131 Å²	131	103.5 Å²	103.5	57%	0.57	54%	0.54	S	S	*	.	H	α-helix	trans	-64.3	-46.3	177.4	-177.7	-177.7	176	-174.1	0	112.1	A109 E110 Q115 A116 L117	A109-K113 WeakPolarHBondContact O-CB 3.38Å; A109-K113 PolarHBondContact O-N 3.5Å; E110-K113 PolarHBondContact O-N 3.33Å; K113-Q115 VanDerWaalsContact C-N 3.34Å; K113-A116 PolarHBondContact O-N 3.2Å; K113-L117 HydrophobicContact CG-CD1 3.94Å; K113-L117 WeakPolarHBondContact O-CB 3.46Å; K113-L117 VanDerWaalsContact O-CG 3.31Å; K113-L117 WeakPolarHBondContact O-CG 3.39Å; K113-L117 PolarHBondContact O-N 3.38Å
114	V	89.1	Confident	90.7	Very high	63 Å²	63	102.7 Å²	102.7	38%	0.382	54%	0.538	S	S	.	.	H	α-helix	trans	-62.1	-43.3	178.2	169.8	0	0	0	0	110.4	E110 K111 L117 K118 I124	E110-V114 HydrophobicContact CG-CG2 4.23Å; E110-V114 WeakPolarHBondContact O-CB 3.5Å; E110-V114 VanDerWaalsContact O-CG2 3.29Å; E110-V114 WeakPolarHBondContact O-CG2 3.36Å; E110-V114 PolarHBondContact O-N 3.11Å; K111-V114 PolarHBondContact O-N 3.11Å; V114-L117 PolarHBondContact O-N 3.16Å; V114-K118 VanDerWaalsContact O-CB 3.31Å; V114-K118 WeakPolarHBondContact O-CB 3.44Å; V114-K118 PolarHBondContact O-N 3.2Å; V114-I124 HydrophobicContact CG2-CD1 4.22Å
115	Q	90.2	Very high	89.8	Confident	97 Å²	97	103.6 Å²	103.6	45%	0.453	55%	0.551	S	S	.	*	H	α-helix	trans	-61.7	-48.6	175.8	-175.1	59.7	36.1	0	0	111.4	K111 L112 K113 L117 K118 D119	K111-Q115 WeakPolarHBondContact O-CB 3.45Å; K111-Q115 PolarHBondContact O-N 3.27Å; L112-Q115 PolarHBondContact O-N 3.01Å; K113-Q115 VanDerWaalsContact C-N 3.34Å; Q115-L117 VanDerWaalsContact C-N 3.28Å; Q115-L117 PolarHBondContact O-N 3.09Å; Q115-K118 WeakPolarHBondContact O-CB 3.03Å; Q115-K118 PolarHBondContact O-N 3.02Å; Q115-D119 PolarHBondContact NE2-OD1 3.5Å; Q115-D119 VanDerWaalsContact O-CG 3.26Å; Q115-D119 PolarHBondContact O-N 2.78Å
116	A	91.3	Very high	88.4	Confident	48 Å²	48	109.4 Å²	109.4	40%	0.397	56%	0.564	S	S	.	*	H	α-helix	trans	-62.6	-32.5	179.5	0	0	0	0	0	113.6	L112 K113 R120	L112-A116 WeakPolarHBondContact O-CB 3.4Å; L112-A116 PolarHBondContact O-N 3.3Å; K113-A116 PolarHBondContact O-N 3.2Å; A116-R120 WeakPolarHBondContact O-CG 3.46Å
117	L	92.1	Very high	86.9	Confident	38 Å²	38	107.6 Å²	107.6	20%	0.199	57%	0.571	C	S	.	*	H	α-helix	trans	-76.3	-39.6	175.5	-72.8	169.2	0	0	0	111.9	K113 V114 Q115 D119 R120 G121 L122 I124	K113-L117 HydrophobicContact CG-CD1 3.94Å; K113-L117 WeakPolarHBondContact O-CB 3.46Å; K113-L117 VanDerWaalsContact O-CG 3.31Å; K113-L117 WeakPolarHBondContact O-CG 3.39Å; K113-L117 PolarHBondContact O-N 3.38Å; V114-L117 PolarHBondContact O-N 3.16Å; Q115-L117 VanDerWaalsContact C-N 3.28Å; Q115-L117 PolarHBondContact O-N 3.09Å; L117-D119 VanDerWaalsContact C-N 3.29Å; L117-D119 PolarHBondContact O-N 3.49Å; L117-R120 CarbonylContact O-C 3.42Å; L117-R120 WeakPolarHBondContact O-CA 3.19Å; L117-R120 WeakPolarHBondContact O-CB 3.5Å; L117-R120 PolarHBondContact O-N 3.29Å; L117-G121 PolarHBondContact O-N 3.1Å; L117-L122 CarbonylContact C-O 3.57Å; L117-L122 VanDerWaalsContact C-O 3.23Å; L117-L122 HydrophobicContact CB-CB 4.14Å; L117-L122 HydrophobicContact CD2-CB 4.2Å; L117-L122 HydrophobicContact CD2-CD1 3.77Å; L117-L122 PolarHBondContact O-N 3.06Å; L117-I124 HydrophobicContact CD1-CD1 3.21Å; L117-I124 HydrophobicContact CD1-CG1 3.67Å
118	K	90.5	Very high	85.2	Confident	148 Å²	148	110 Å²	110	64%	0.643	58%	0.584	S	S	*	*	H	α-helix	trans	-59.6	-41.6	175.4	-172.8	-179	179.6	-176.3	0	111.4	V114 Q115 R120 G121 L122	V114-K118 VanDerWaalsContact O-CB 3.31Å; V114-K118 WeakPolarHBondContact O-CB 3.44Å; V114-K118 PolarHBondContact O-N 3.2Å; Q115-K118 WeakPolarHBondContact O-CB 3.03Å; Q115-K118 PolarHBondContact O-N 3.02Å; K118-R120 PolarHBondContact O-N 3.27Å; K118-G121 PolarHBondContact O-N 3.17Å; K118-L122 PolarHBondContact N-O 3.23Å
119	D	91.7	Very high	82.9	Confident	117 Å²	117	107.8 Å²	107.8	63%	0.626	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.5	-18.3	176.1	-63.4	-21.4	0	0	0	112.7	Q115 L117	Q115-D119 PolarHBondContact NE2-OD1 3.5Å; Q115-D119 VanDerWaalsContact O-CG 3.26Å; Q115-D119 PolarHBondContact O-N 2.78Å; L117-D119 VanDerWaalsContact C-N 3.29Å; L117-D119 PolarHBondContact O-N 3.49Å
120	R	92.9	Very high	80.6	Confident	199 Å²	199	111.4 Å²	111.4	75%	0.751	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.5	7.3	174.3	-63.7	176.9	-176.7	-169.9	0.9	113.5	A116 L117 K118 L122	A116-R120 WeakPolarHBondContact O-CG 3.46Å; L117-R120 CarbonylContact O-C 3.42Å; L117-R120 WeakPolarHBondContact O-CA 3.19Å; L117-R120 WeakPolarHBondContact O-CB 3.5Å; L117-R120 PolarHBondContact O-N 3.29Å; K118-R120 PolarHBondContact O-N 3.27Å; R120-L122 VanDerWaalsContact C-N 3.29Å; R120-L122 PolarHBondContact O-N 3.2Å
121	G	90.4	Very high	78.6	Confident	71 Å²	71	111.7 Å²	111.7	73%	0.732	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	74.3	14.5	-178.6	0	0	0	0	0	114.7	L117 K118	L117-G121 PolarHBondContact O-N 3.1Å; K118-G121 PolarHBondContact O-N 3.17Å
122	L	89.7	Confident	76	Confident	101 Å²	101	112 Å²	112	53%	0.529	60%	0.599	S	S	.	*			trans	-99.6	128.7	176.8	-65.1	171.8	0	0	0	109.9	L117 K118 R120	L117-L122 CarbonylContact C-O 3.57Å; L117-L122 VanDerWaalsContact C-O 3.23Å; L117-L122 HydrophobicContact CB-CB 4.14Å; L117-L122 HydrophobicContact CD2-CB 4.2Å; L117-L122 HydrophobicContact CD2-CD1 3.77Å; L117-L122 PolarHBondContact O-N 3.06Å; K118-L122 PolarHBondContact N-O 3.23Å; R120-L122 VanDerWaalsContact C-N 3.29Å; R120-L122 PolarHBondContact O-N 3.2Å
123	S	85	Confident	73.5	Confident	116 Å²	116	120.2 Å²	120.2	81%	0.811	62%	0.623	S	S	*	*			trans	-106.7	132.6	171.2	59.2	0	0	0	0	109.8
124	I	79	Confident	72.6	Confident	83 Å²	83	119.7 Å²	119.7	43%	0.426	63%	0.625	S	S	.	*	P	Polyproline II helix	trans	-92.6	121.1	170	-59	166.5	0	0	0	106.8	V114 L117 R126	V114-I124 HydrophobicContact CG2-CD1 4.22Å; L117-I124 HydrophobicContact CD1-CD1 3.21Å; L117-I124 HydrophobicContact CD1-CG1 3.67Å; I124-R126 PolarHBondContact O-N 2.8Å
125	P	75.9	Confident	71.8	Confident	105 Å²	105	122.6 Å²	122.6	68%	0.682	64%	0.638	S	S	*	*	P	Polyproline II helix	trans	-62.4	134.5	170.5	26.2	-31.8	0	0	0	109.1
126	R	66.2	Low	70.7	Confident	198 Å²	198	124.1 Å²	124.1	75%	0.747	65%	0.648	S	S	*	*	P	Polyproline II helix	trans	-68	139	175.2	-73.2	-177.2	174.7	168.2	-2	108.7	I124 D128 T129	I124-R126 PolarHBondContact O-N 2.8Å; R126-D128 PolarHBondContact O-N 3.24Å; R126-D128 VanDerWaalsContact O-N 3.15Å; R126-T129 HydrophobicContact CB-CG2 4.29Å; R126-T129 PolarHBondContact O-N 3.22Å; R126-T129 VanDerWaalsContact O-N 3.14Å; R126-T129 PolarHBondContact O-OG1 3.03Å
127	A	60.2	Low	69.5	Low	77 Å²	77	128.5 Å²	128.5	64%	0.636	66%	0.663	S	S	*	*	G	3₁₀ helix	trans	-59	-26.6	177.3	0	0	0	0	0	112.4	T129	A127-T129 VanDerWaalsContact C-N 3.3Å; A127-T129 PolarHBondContact O-N 3.26Å
128	D	56.4	Low	68.1	Low	145 Å²	145	134.2 Å²	134.2	78%	0.775	69%	0.692	S	S	*	*	G	3₁₀ helix	trans	-77.1	-8.9	-179.2	-55.7	-20.9	0	0	0	114.2	R126	R126-D128 PolarHBondContact O-N 3.24Å; R126-D128 VanDerWaalsContact O-N 3.15Å
129	T	44.8	Very low	66.6	Low	75 Å²	75	133.3 Å²	133.3	46%	0.46	70%	0.696	S	S	.	*	G	3₁₀ helix	trans	-95.9	13.4	-178.7	55	0	0	0	0	113.9	R126 A127 D131	R126-T129 HydrophobicContact CB-CG2 4.29Å; R126-T129 PolarHBondContact O-N 3.22Å; R126-T129 VanDerWaalsContact O-N 3.14Å; R126-T129 PolarHBondContact O-OG1 3.03Å; A127-T129 VanDerWaalsContact C-N 3.3Å; A127-T129 PolarHBondContact O-N 3.26Å; T129-D131 VanDerWaalsContact C-N 3.31Å
130	L	45.3	Very low	64.8	Low	133 Å²	133	134.4 Å²	134.4	70%	0.696	70%	0.7	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82	-4.5	179.4	-81.3	159.8	0	0	0	114.3
131	D	47.9	Very low	62.7	Low	121 Å²	121	129.5 Å²	129.5	65%	0.647	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.2	12.3	179.7	-60.9	-20.3	0	0	0	113.2	R23 T129	R23-D131 IonicContact NH1-OD1 2.67Å; R23-D131 PolarHBondContact NH1-OD1 2.72Å; T129-D131 VanDerWaalsContact C-N 3.31Å
132	E	35.5	Very low	60.4	Low	157 Å²	157	134.3 Å²	134.3	73%	0.734	69%	0.694	S	S	*	*			trans	-106.2	58.4	174.5	-69.8	-170.8	166.2	0	0	112.5
133	Y	38.2	Very low	57.7	Low	301 Å²	301	137.4 Å²	137.4	100%	1.18	71%	0.709	S	S	*	*			trans	-149.3	0	159.9	-79.8	-75	0	0	0	111.9

Retrieved 133 of 133 residues in 211.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).