RL37_SCHMA Loading...

Large ribosomal subunit protein eL37

Binds to the 23S rRNA.

AlphaFold DB , UniProt , Accession O44125, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene RPL37, Length 88 aa.

						>RL37_SCHMA|O44125|RPL37
MTKGTTSFGKRHNKSHTQCRRCGRKSYHIQKKTCSSCGYPSARLRKYNWSEKAKRRRTTGTGRMLHLKRVHRRFKQGFRSGPPKPVKA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	73.6	Confident	89.5	Confident	242 Å²	242	121.5 Å²	121.5	100%	1.192	65%	0.647	S	S	*	*				0	98.8	0	-70.1	-64.5	-165	0	0	109.1
2	T	86.7	Confident	89.9	Confident	105 Å²	105	122.5 Å²	122.5	64%	0.644	65%	0.645	S	S	*	*			trans	-94.1	129.6	-175	-33.6	0	0	0	0	110.4
3	K	88.7	Confident	90.3	Very high	200 Å²	200	123.3 Å²	123.3	87%	0.87	65%	0.65	S	S	*	*			trans	-80.7	156	167.4	-64.9	174.3	-177.8	172.7	0	108.8
4	G	88.2	Confident	90.6	Very high	27 Å²	27	125.1 Å²	125.1	28%	0.278	65%	0.65	S	S	.	*	S	Bend	trans	97.2	-134.1	172.9	0	0	0	0	0	114.5	T6 S7 F8	G4-T6 PolarHBondContact O-N 3.38Å; G4-S7 PolarHBondContact N-OG 2.99Å; G4-S7 WeakPolarHBondContact O-CA 3.32Å; G4-S7 WeakPolarHBondContact O-CB 3.48Å; G4-S7 PolarHBondContact O-N 2.79Å; G4-S7 PolarHBondContact O-OG 2.93Å; G4-F8 PolarHBondContact O-N 3.14Å; G4-F8 VanDerWaalsContact O-N 3.14Å
5	T	92.4	Very high	91.1	Very high	122 Å²	122	121.1 Å²	121.1	75%	0.748	64%	0.636	S	S	*	*	H	α-helix	trans	-51	-51.1	-167.1	-51.7	0	0	0	0	113.9	S7 F8	T5-S7 PolarHBondContact O-N 3.13Å; T5-F8 PolarHBondContact O-N 3.48Å; T5-F8 VanDerWaalsContact O-N 3.08Å
6	T	90.6	Very high	91.5	Very high	93 Å²	93	118.8 Å²	118.8	57%	0.571	62%	0.621	S	S	*	*	H	α-helix	trans	-62.7	-29.7	179.7	57.5	0	0	0	0	112.7	G4	G4-T6 PolarHBondContact O-N 3.38Å
7	S	91.5	Very high	91.8	Very high	36 Å²	36	115.8 Å²	115.8	25%	0.252	61%	0.609	S	S	.	*	H	α-helix	trans	-78.1	-24.2	176.9	77.1	0	0	0	0	113.4	G4 T5 K10	G4-S7 PolarHBondContact N-OG 2.99Å; G4-S7 WeakPolarHBondContact O-CA 3.32Å; G4-S7 WeakPolarHBondContact O-CB 3.48Å; G4-S7 PolarHBondContact O-N 2.79Å; G4-S7 PolarHBondContact O-OG 2.93Å; T5-S7 PolarHBondContact O-N 3.13Å; S7-K10 PolarHBondContact O-N 2.99Å
8	F	93.7	Very high	92.2	Very high	109 Å²	109	116.3 Å²	116.3	48%	0.478	61%	0.608	S	S	.	*	H	α-helix	trans	-69	-33.1	-179.7	-65.2	-34.2	0	0	0	112.8	G4 T5 K10 R11	G4-F8 PolarHBondContact O-N 3.14Å; G4-F8 VanDerWaalsContact O-N 3.14Å; T5-F8 PolarHBondContact O-N 3.48Å; T5-F8 VanDerWaalsContact O-N 3.08Å; F8-K10 PolarHBondContact O-N 3.49Å; F8-R11 VanDerWaalsContact CE1-CZ 3.42Å; F8-R11 VanDerWaalsContact CE1-NH1 3.33Å; F8-R11 WeakPolarHBondContact O-CB 3.4Å; F8-R11 PolarHBondContact O-N 3.44Å; F8-R11 VanDerWaalsContact O-N 3.12Å
9	G	92.3	Very high	92.5	Very high	72 Å²	72	110.2 Å²	110.2	74%	0.742	58%	0.576	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.2	-25.2	176.3	0	0	0	0	0	113.8	R11	G9-R11 VanDerWaalsContact C-N 3.29Å; G9-R11 PolarHBondContact O-N 3.45Å
10	K	93.3	Very high	92.7	Very high	167 Å²	167	115.4 Å²	115.4	73%	0.726	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.9	-1.2	179.4	-56.5	-175.4	-179.6	-175	0	113.8	S7 F8 H12	S7-K10 PolarHBondContact O-N 2.99Å; F8-K10 PolarHBondContact O-N 3.49Å; K10-H12 PolarHBondContact O-CD2 3.13Å; K10-H12 PolarHBondContact O-N 3.28Å
11	R	93.7	Very high	92.9	Very high	164 Å²	164	114.3 Å²	114.3	62%	0.619	58%	0.576	S	S	*	*			trans	-90.6	59	-171.4	-62	-176.6	175.8	-174.7	-1.2	114	F8 G9	F8-R11 VanDerWaalsContact CE1-CZ 3.42Å; F8-R11 VanDerWaalsContact CE1-NH1 3.33Å; F8-R11 WeakPolarHBondContact O-CB 3.4Å; F8-R11 PolarHBondContact O-N 3.44Å; F8-R11 VanDerWaalsContact O-N 3.12Å; G9-R11 VanDerWaalsContact C-N 3.29Å; G9-R11 PolarHBondContact O-N 3.45Å
12	H	93.9	Very high	93.9	Very high	133 Å²	133	104.5 Å²	104.5	62%	0.616	53%	0.531	S	S	*	.			trans	-89.6	-26.9	178.7	53.3	83	0	0	0	114.1	K10	K10-H12 PolarHBondContact O-CD2 3.13Å; K10-H12 PolarHBondContact O-N 3.28Å
13	N	94.9	Very high	94.4	Very high	133 Å²	133	101.4 Å²	101.4	71%	0.711	52%	0.52	S	S	*	.			trans	-72.1	134.9	-179.4	-64.3	-31.9	0	0	0	112.2
14	K	95.3	Very high	94.7	Very high	149 Å²	149	96.6 Å²	96.6	65%	0.648	50%	0.496	S	S	*	.			trans	-100.8	126.6	179.9	-53.1	-51.6	177.3	-155.8	0	110.6	I29	K14-I29 WeakPolarHBondContact O-CD1 3.48Å
15	S	97.4	Very high	95.2	Very high	64 Å²	64	104 Å²	104	45%	0.448	52%	0.521	S	S	.	.	S	Bend	trans	-81.5	-29.1	175.2	-43.3	0	0	0	0	112.5	H28 I29	S15-H28 CarbonylContact O-C 3.45Å; S15-H28 WeakPolarHBondContact O-CA 3.34Å; S15-I29 PolarHBondContact O-N 2.81Å
16	H	97.9	Very high	95.4	Very high	85 Å²	85	98.7 Å²	98.7	39%	0.394	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	142.9	-173.5	-62.1	97.1	0	0	0	112.5	Y27 H28	H16-Y27 CarbonylContact C-O 3.56Å; H16-Y27 WeakPolarHBondContact CA-O 3.43Å; H16-H28 AromaticContact NE2-CD2 3.93Å
17	T	97.4	Very high	95.8	Very high	67 Å²	67	96.5 Å²	96.5	41%	0.411	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	-179.6	168.6	-172.8	0	0	0	0	110.8	K25 S26 Y27 I29	T17-K25 CarbonylContact O-C 3.5Å; T17-K25 WeakPolarHBondContact O-CA 3.46Å; T17-S26 PolarHBondContact O-N 3.48Å; T17-Y27 HydrophobicContact CG2-CD1 3.63Å; T17-Y27 HydrophobicContact CG2-CG 4.36Å; T17-Y27 PolarHBondContact N-O 3.23Å; T17-Y27 WeakPolarHBondContact O-CB 3.4Å; T17-Y27 PolarHBondContact O-N 3.17Å; T17-I29 HydrophobicContact CG2-CD1 4.33Å; T17-I29 HydrophobicContact CG2-CG1 3.81Å
18	Q	97.9	Very high	96.1	Very high	126 Å²	126	96.2 Å²	96.2	59%	0.589	46%	0.464	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.4	129	-179.9	-166.3	169.4	23.9	0	0	111.4	G23	Q18-G23 WeakPolarHBondContact CG-O 3.43Å; Q18-G23 PolarHBondContact NE2-O 3.14Å
19	C	97.9	Very high	96.3	Very high	0 Å²	0	94 Å²	94	0%	0	46%	0.457	C	S	.	.			trans	-82.9	123.4	175.5	175.7	0	0	0	0	110.9	R21 C22 G23 R24 C34	C19-R21 PolarHBondContact O-N 3.37Å; C19-R21 PolarHBondContact SG-N 3.16Å; C19-C22 PolarHBondContact O-N 3.32Å; C19-G23 WeakPolarHBondContact O-CA 3.24Å; C19-G23 PolarHBondContact O-N 2.88Å; C19-R24 PolarHBondContact N-O 2.89Å; C19-C34 HydrophobicContact CB-CB 4.3Å; C19-C34 VanDerWaalsContact CB-SG 3.55Å; C19-C34 PolarHBondContact SG-SG 2.96Å
20	R	96.4	Very high	96.5	Very high	213 Å²	213	98.3 Å²	98.3	80%	0.804	46%	0.458	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.2	-34	177	-63.4	-168.1	-71.8	-165.5	-2.7	114.5	Y39	R20-Y39 PolarHBondContact NH2-OH 3.14Å
21	R	96.6	Very high	96.7	Very high	94 Å²	94	97.4 Å²	97.4	36%	0.355	45%	0.454	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.2	-44.4	-178	-173.1	-175.2	-66.5	168.4	-3.4	113.6	C19 Y39 S41	C19-R21 PolarHBondContact O-N 3.37Å; C19-R21 PolarHBondContact SG-N 3.16Å; R21-Y39 HydrophobicContact CB-CD2 4.41Å; R21-S41 PolarHBondContact NH1-O 3.05Å; R21-S41 PolarHBondContact NH2-O 3.08Å
22	C	96	Very high	96.9	Very high	36 Å²	36	95.2 Å²	95.2	24%	0.243	45%	0.449	C	S	.	.	T	Hydrogen-bonded Turn	trans	-115	-1.3	-169.8	72.1	0	0	0	0	114.9	C19 R24 S36 C37	C19-C22 PolarHBondContact O-N 3.32Å; C22-R24 PolarHBondContact O-N 3.29Å; C22-S36 PolarHBondContact SG-OG 3.5Å; C22-S36 VanDerWaalsContact SG-OG 3.38Å; C22-C37 HydrophobicContact CB-CB 3.89Å; C22-C37 VanDerWaalsContact SG-SG 3.68Å
23	G	96.1	Very high	97.1	Very high	40 Å²	40	91.8 Å²	91.8	41%	0.412	44%	0.437	S	S	.	.			trans	70.4	-7.8	178	0	0	0	0	0	115.8	Q18 C19	Q18-G23 WeakPolarHBondContact CG-O 3.43Å; Q18-G23 PolarHBondContact NE2-O 3.14Å; C19-G23 WeakPolarHBondContact O-CA 3.24Å; C19-G23 PolarHBondContact O-N 2.88Å
24	R	96.2	Very high	97.2	Very high	98 Å²	98	85.6 Å²	85.6	37%	0.37	40%	0.404	S	S	.	.	S	Bend	trans	-82.7	143.7	-179	-62.9	-173.2	176.8	98.1	-0	111.9	C19 C22 S26	C19-R24 PolarHBondContact N-O 2.89Å; C22-R24 PolarHBondContact O-N 3.29Å; R24-S26 PolarHBondContact O-N 2.97Å; R24-S26 PolarHBondContact O-OG 3.19Å
25	K	97.7	Very high	97.3	Very high	184 Å²	184	81.4 Å²	81.4	80%	0.8	39%	0.394	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.9	77.4	170	-69.2	-175.4	179.8	-179.8	0	111	T17	T17-K25 CarbonylContact O-C 3.5Å; T17-K25 WeakPolarHBondContact O-CA 3.46Å
26	S	97.4	Very high	97.3	Very high	10 Å²	10	78.7 Å²	78.7	7%	0.07	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.7	4	-168.8	53.4	0	0	0	0	113	T17 R24 H28 C34 S35 S36	T17-S26 PolarHBondContact O-N 3.48Å; R24-S26 PolarHBondContact O-N 2.97Å; R24-S26 PolarHBondContact O-OG 3.19Å; S26-H28 PolarHBondContact O-N 2.82Å; S26-C34 CarbonylContact O-C 3.6Å; S26-C34 WeakPolarHBondContact O-CA 3.39Å; S26-C34 PolarHBondContact OG-SG 2.94Å; S26-C34 VanDerWaalsContact OG-SG 3.33Å; S26-S35 WeakPolarHBondContact CB-OG 3.31Å; S26-S35 PolarHBondContact O-N 3.26Å; S26-S35 PolarHBondContact O-OG 3.07Å; S26-S35 VanDerWaalsContact O-OG 3.09Å; S26-S36 WeakPolarHBondContact OG-CB 3.46Å
27	Y	98.4	Very high	97.2	Very high	46 Å²	46	74.7 Å²	74.7	18%	0.18	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.4	111.8	173.5	-175.9	-105.7	0	0	0	109.6	H16 T17 I29 K32 C34 Y39	H16-Y27 CarbonylContact C-O 3.56Å; H16-Y27 WeakPolarHBondContact CA-O 3.43Å; T17-Y27 HydrophobicContact CG2-CD1 3.63Å; T17-Y27 HydrophobicContact CG2-CG 4.36Å; T17-Y27 PolarHBondContact N-O 3.23Å; T17-Y27 WeakPolarHBondContact O-CB 3.4Å; T17-Y27 PolarHBondContact O-N 3.17Å; Y27-I29 PolarHBondContact O-N 3.16Å; Y27-K32 VanDerWaalsContact CE2-C 3.49Å; Y27-K32 WeakPolarHBondContact CE2-O 3.46Å; Y27-K32 WeakPolarHBondContact OH-CA 3.22Å; Y27-K32 PolarHBondContact OH-O 3.48Å; Y27-C34 HydrophobicContact CD2-CB 4.23Å; Y27-Y39 AromaticContact CD2-CD1 3.92Å; Y27-Y39 HydrophobicContact CD2-CD1 3.92Å; Y27-Y39 HydrophobicContact CD2-CE1 4.49Å; Y27-Y39 AromaticContact CE2-CD1 3.66Å; Y27-Y39 HydrophobicContact CE2-CD1 3.66Å; Y27-Y39 AromaticContact CE2-CE1 3.92Å; Y27-Y39 HydrophobicContact CE2-CE1 3.92Å
28	H	98.3	Very high	97.2	Very high	30 Å²	30	72.1 Å²	72.1	14%	0.139	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74	120.4	-179.9	-166.8	-56.2	0	0	0	109.9	S15 H16 S26 Q30 K31 K32 T33	S15-H28 CarbonylContact O-C 3.45Å; S15-H28 WeakPolarHBondContact O-CA 3.34Å; H16-H28 AromaticContact NE2-CD2 3.93Å; S26-H28 PolarHBondContact O-N 2.82Å; H28-Q30 PolarHBondContact ND1-N 3.25Å; H28-K31 HydrophobicContact CB-CB 4.19Å; H28-K31 PolarHBondContact ND1-N 3.21Å; H28-K32 WeakPolarHBondContact O-CA 3.38Å; H28-K32 PolarHBondContact O-N 3.36Å; H28-T33 VanDerWaalsContact CB-O 3.28Å; H28-T33 WeakPolarHBondContact CB-O 3.44Å; H28-T33 PolarHBondContact N-O 3.11Å; H28-T33 PolarHBondContact O-N 3.24Å
29	I	97.2	Very high	97.2	Very high	64 Å²	64	68.5 Å²	68.5	33%	0.328	33%	0.325	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.1	-42.8	-169.6	-67.7	160.5	0	0	0	112	K14 S15 T17 Y27 K32	K14-I29 WeakPolarHBondContact O-CD1 3.48Å; S15-I29 PolarHBondContact O-N 2.81Å; T17-I29 HydrophobicContact CG2-CD1 4.33Å; T17-I29 HydrophobicContact CG2-CG1 3.81Å; Y27-I29 PolarHBondContact O-N 3.16Å; I29-K32 VanDerWaalsContact O-CD 3.24Å; I29-K32 WeakPolarHBondContact O-CD 3.48Å; I29-K32 WeakPolarHBondContact O-CE 3.08Å; I29-K32 PolarHBondContact O-NZ 2.98Å
30	Q	97.4	Very high	97.2	Very high	161 Å²	161	72.2 Å²	72.2	75%	0.752	35%	0.349	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.6	-53.1	179.7	-60.5	169.8	-3.5	0	0	111.8	H28 K32	H28-Q30 PolarHBondContact ND1-N 3.25Å; Q30-K32 PolarHBondContact O-N 3.49Å
31	K	97.6	Very high	97.2	Very high	148 Å²	148	64.6 Å²	64.6	64%	0.643	33%	0.328	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.4	-8.8	-179.6	-60.5	-174.6	180	-171.8	0	114.6	H28 T33	H28-K31 HydrophobicContact CB-CB 4.19Å; H28-K31 PolarHBondContact ND1-N 3.21Å; K31-T33 WeakPolarHBondContact O-CG2 3.47Å; K31-T33 PolarHBondContact O-N 3.39Å; K31-T33 VanDerWaalsContact O-N 3.09Å
32	K	97	Very high	97.2	Very high	119 Å²	119	64.9 Å²	64.9	52%	0.517	35%	0.35	S	S	.	.	T	Hydrogen-bonded Turn	trans	52.2	30.8	-176.5	-53	-62.7	175.8	-165.6	0	113.6	Y27 H28 I29 Q30 P40	Y27-K32 VanDerWaalsContact CE2-C 3.49Å; Y27-K32 WeakPolarHBondContact CE2-O 3.46Å; Y27-K32 WeakPolarHBondContact OH-CA 3.22Å; Y27-K32 PolarHBondContact OH-O 3.48Å; H28-K32 WeakPolarHBondContact O-CA 3.38Å; H28-K32 PolarHBondContact O-N 3.36Å; I29-K32 VanDerWaalsContact O-CD 3.24Å; I29-K32 WeakPolarHBondContact O-CD 3.48Å; I29-K32 WeakPolarHBondContact O-CE 3.08Å; I29-K32 PolarHBondContact O-NZ 2.98Å; Q30-K32 PolarHBondContact O-N 3.49Å; K32-P40 WeakPolarHBondContact O-CD 3.49Å
33	T	98	Very high	97.2	Very high	60 Å²	60	73.7 Å²	73.7	37%	0.368	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.9	139	-175.6	54.3	0	0	0	0	111.8	H28 K31 S35 Y39	H28-T33 VanDerWaalsContact CB-O 3.28Å; H28-T33 WeakPolarHBondContact CB-O 3.44Å; H28-T33 PolarHBondContact N-O 3.11Å; H28-T33 PolarHBondContact O-N 3.24Å; K31-T33 WeakPolarHBondContact O-CG2 3.47Å; K31-T33 PolarHBondContact O-N 3.39Å; K31-T33 VanDerWaalsContact O-N 3.09Å; T33-S35 PolarHBondContact O-N 2.97Å; T33-Y39 CarbonylContact C-O 3.39Å; T33-Y39 WeakPolarHBondContact CA-O 3.17Å
34	C	98	Very high	97.2	Very high	3 Å²	3	77.6 Å²	77.6	2%	0.02	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.3	111.9	175.5	-176.4	0	0	0	0	111.3	C19 S26 Y27 S36 C37 G38 Y39	C19-C34 HydrophobicContact CB-CB 4.3Å; C19-C34 VanDerWaalsContact CB-SG 3.55Å; C19-C34 PolarHBondContact SG-SG 2.96Å; S26-C34 CarbonylContact O-C 3.6Å; S26-C34 WeakPolarHBondContact O-CA 3.39Å; S26-C34 PolarHBondContact OG-SG 2.94Å; S26-C34 VanDerWaalsContact OG-SG 3.33Å; Y27-C34 HydrophobicContact CD2-CB 4.23Å; C34-S36 PolarHBondContact O-N 3.08Å; C34-S36 VanDerWaalsContact O-N 3.12Å; C34-C37 PolarHBondContact SG-N 3.24Å; C34-C37 VanDerWaalsContact SG-N 3.38Å; C34-C37 PolarHBondContact SG-SG 3.13Å; C34-G38 WeakPolarHBondContact O-CA 3.31Å; C34-G38 PolarHBondContact O-N 3.22Å; C34-Y39 WeakPolarHBondContact CB-O 3.33Å; C34-Y39 PolarHBondContact N-O 3.26Å
35	S	96.8	Very high	97.2	Very high	61 Å²	61	77.5 Å²	77.5	43%	0.427	39%	0.389	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.3	-16	176.5	63.9	0	0	0	0	112.9	S26 T33 R45	S26-S35 WeakPolarHBondContact CB-OG 3.31Å; S26-S35 PolarHBondContact O-N 3.26Å; S26-S35 PolarHBondContact O-OG 3.07Å; S26-S35 VanDerWaalsContact O-OG 3.09Å; T33-S35 PolarHBondContact O-N 2.97Å; S35-R45 PolarHBondContact O-NE 3.29Å; S35-R45 PolarHBondContact O-NH1 2.76Å; S35-R45 PolarHBondContact O-NH2 2.7Å
36	S	96.8	Very high	97.1	Very high	7 Å²	7	75.7 Å²	75.7	5%	0.049	38%	0.381	C	S	.	.	T	Hydrogen-bonded Turn	trans	-86.4	-68.4	176.6	163.4	0	0	0	0	110.9	C22 S26 C34 R45 R57	C22-S36 PolarHBondContact SG-OG 3.5Å; C22-S36 VanDerWaalsContact SG-OG 3.38Å; S26-S36 WeakPolarHBondContact OG-CB 3.46Å; C34-S36 PolarHBondContact O-N 3.08Å; C34-S36 VanDerWaalsContact O-N 3.12Å; S36-R45 PolarHBondContact O-NE 3.03Å; S36-R45 PolarHBondContact O-NH2 3.28Å; S36-R57 PolarHBondContact O-NH1 3.09Å; S36-R57 PolarHBondContact OG-NH1 3.04Å; S36-R57 PolarHBondContact OG-NH2 3.33Å
37	C	96.9	Very high	97.1	Very high	1 Å²	1	80.1 Å²	80.1	1%	0.007	40%	0.397	C	S	.	.	T	Hydrogen-bonded Turn	trans	-105.1	-5.5	-168.2	70.2	0	0	0	0	115.3	C22 C34 L44 R45	C22-C37 HydrophobicContact CB-CB 3.89Å; C22-C37 VanDerWaalsContact SG-SG 3.68Å; C34-C37 PolarHBondContact SG-N 3.24Å; C34-C37 VanDerWaalsContact SG-N 3.38Å; C34-C37 PolarHBondContact SG-SG 3.13Å; C37-L44 HydrophobicContact CB-CD2 4.08Å; C37-R45 PolarHBondContact O-N 2.73Å
38	G	97.1	Very high	97	Very high	13 Å²	13	83.7 Å²	83.7	13%	0.134	42%	0.419	C	S	.	.			trans	91.1	-10	179.6	0	0	0	0	0	116	C34 S41	C34-G38 WeakPolarHBondContact O-CA 3.31Å; C34-G38 PolarHBondContact O-N 3.22Å; G38-S41 WeakPolarHBondContact CA-OG 3.34Å; G38-S41 VanDerWaalsContact O-CB 3.31Å; G38-S41 WeakPolarHBondContact O-CB 3.33Å; G38-S41 PolarHBondContact O-N 3.47Å; G38-S41 PolarHBondContact O-OG 2.9Å
39	Y	97.6	Very high	97	Very high	51 Å²	51	91.9 Å²	91.9	20%	0.2	45%	0.449	C	S	.	.	T	Hydrogen-bonded Turn	trans	-44.9	126.4	178.5	178.5	-97.7	0	0	0	111.7	R20 R21 Y27 T33 C34	R20-Y39 PolarHBondContact NH2-OH 3.14Å; R21-Y39 HydrophobicContact CB-CD2 4.41Å; Y27-Y39 AromaticContact CD2-CD1 3.92Å; Y27-Y39 HydrophobicContact CD2-CD1 3.92Å; Y27-Y39 HydrophobicContact CD2-CE1 4.49Å; Y27-Y39 AromaticContact CE2-CD1 3.66Å; Y27-Y39 HydrophobicContact CE2-CD1 3.66Å; Y27-Y39 AromaticContact CE2-CE1 3.92Å; Y27-Y39 HydrophobicContact CE2-CE1 3.92Å; T33-Y39 CarbonylContact C-O 3.39Å; T33-Y39 WeakPolarHBondContact CA-O 3.17Å; C34-Y39 WeakPolarHBondContact CB-O 3.33Å; C34-Y39 PolarHBondContact N-O 3.26Å
40	P	97.2	Very high	96.9	Very high	78 Å²	78	90.3 Å²	90.3	51%	0.506	44%	0.444	S	S	.	.	T	Hydrogen-bonded Turn	cis	-85.5	-3.3	19.3	33.4	-38.8	0	0	0	116.7	K32 A42	K32-P40 WeakPolarHBondContact O-CD 3.49Å; P40-A42 PolarHBondContact O-N 2.9Å
41	S	97.4	Very high	96.9	Very high	53 Å²	53	90 Å²	90	37%	0.371	44%	0.442	S	S	.	.	S	Bend	trans	-48.9	135.2	-177.3	69.1	0	0	0	0	112	R21 G38 R43	R21-S41 PolarHBondContact NH1-O 3.05Å; R21-S41 PolarHBondContact NH2-O 3.08Å; G38-S41 WeakPolarHBondContact CA-OG 3.34Å; G38-S41 VanDerWaalsContact O-CB 3.31Å; G38-S41 WeakPolarHBondContact O-CB 3.33Å; G38-S41 PolarHBondContact O-N 3.47Å; G38-S41 PolarHBondContact O-OG 2.9Å; S41-R43 VanDerWaalsContact C-N 3.33Å; S41-R43 PolarHBondContact O-N 2.85Å; S41-R43 PolarHBondContact OG-O 2.96Å
42	A	96.9	Very high	96.9	Very high	99 Å²	99	88.9 Å²	88.9	82%	0.818	44%	0.437	S	S	*	.	S	Bend	trans	-59.2	-46	-177.3	0	0	0	0	0	111.5	P40	P40-A42 PolarHBondContact O-N 2.9Å
43	R	96.1	Very high	96.8	Very high	221 Å²	221	84.8 Å²	84.8	83%	0.834	43%	0.426	S	S	*	.	S	Bend	trans	-78.5	145.7	177.2	-56.9	-175.5	85.8	178.6	6.5	111.3	S41	S41-R43 VanDerWaalsContact C-N 3.33Å; S41-R43 PolarHBondContact O-N 2.85Å; S41-R43 PolarHBondContact OG-O 2.96Å
44	L	95.7	Very high	96.7	Very high	123 Å²	123	84.9 Å²	84.9	64%	0.644	42%	0.421	S	S	*	.	P	Polyproline II helix	trans	-69.5	127.7	170.9	-74	168.5	0	0	0	110.1	C37 K46	C37-L44 HydrophobicContact CB-CD2 4.08Å; L44-K46 PolarHBondContact O-N 2.79Å
45	R	96.6	Very high	96.7	Very high	96 Å²	96	93 Å²	93	36%	0.362	45%	0.451	S	S	.	.	P	Polyproline II helix	trans	-63	117.4	174.5	-168.4	-172.5	71.6	118	12.9	110.3	S35 S36 C37 Y47	S35-R45 PolarHBondContact O-NE 3.29Å; S35-R45 PolarHBondContact O-NH1 2.76Å; S35-R45 PolarHBondContact O-NH2 2.7Å; S36-R45 PolarHBondContact O-NE 3.03Å; S36-R45 PolarHBondContact O-NH2 3.28Å; C37-R45 PolarHBondContact O-N 2.73Å; R45-Y47 HydrophobicContact CG-CD2 4.4Å; R45-Y47 HydrophobicContact CG-CE2 3.56Å; R45-Y47 VanDerWaalsContact NH1-CE2 3.31Å
46	K	95.7	Very high	96.6	Very high	146 Å²	146	96.6 Å²	96.6	64%	0.635	46%	0.456	S	S	*	.			trans	-136.4	134.7	177.1	176.2	178.8	172.8	-175.5	0	108.3	L44 K54	L44-K46 PolarHBondContact O-N 2.79Å; K46-K54 HydrophobicContact CD-CG 4.45Å; K46-K54 HydrophobicContact CG-CG 4.17Å
47	Y	96.8	Very high	96.4	Very high	102 Å²	102	100.6 Å²	100.6	40%	0.4	47%	0.47	S	S	.	.			trans	-120.5	144.1	172.5	-63.1	-75.6	0	0	0	110.5	R45 W49 S50 K54	R45-Y47 HydrophobicContact CG-CD2 4.4Å; R45-Y47 HydrophobicContact CG-CE2 3.56Å; R45-Y47 VanDerWaalsContact NH1-CE2 3.31Å; Y47-W49 VanDerWaalsContact CB-CE2 3.45Å; Y47-W49 VanDerWaalsContact CB-NE1 3.3Å; Y47-W49 HydrophobicContact CD1-CZ2 4.49Å; Y47-W49 AromaticContact CD1-NE1 3.7Å; Y47-W49 AromaticContact CD2-CZ2 3.81Å; Y47-W49 HydrophobicContact CD2-CZ2 3.81Å; Y47-W49 AromaticContact CG-CE2 3.74Å; Y47-W49 AromaticContact CG-CZ2 3.8Å; Y47-W49 HydrophobicContact CG-CZ2 3.8Å; Y47-W49 AromaticContact CG-NE1 3.55Å; Y47-S50 PolarHBondContact O-N 3.03Å; Y47-K54 WeakPolarHBondContact O-CE 3.08Å
48	N	96.6	Very high	96.3	Very high	122 Å²	122	104.3 Å²	104.3	65%	0.652	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.2	-32.5	-174.6	-77.5	-26.2	0	0	0	114	S50 K54	N48-S50 PolarHBondContact O-N 2.74Å; N48-K54 VanDerWaalsContact CA-NZ 3.32Å; N48-K54 WeakPolarHBondContact O-CE 3.35Å; N48-K54 PolarHBondContact O-NZ 3.28Å; N48-K54 PolarHBondContact OD1-NZ 3.38Å; N48-K54 VanDerWaalsContact OD1-NZ 3.17Å
49	W	97.3	Very high	96.2	Very high	201 Å²	201	108.9 Å²	108.9	76%	0.761	52%	0.518	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.6	-9.8	177.4	55.9	-105.3	0	0	0	114.8	Y47	Y47-W49 VanDerWaalsContact CB-CE2 3.45Å; Y47-W49 VanDerWaalsContact CB-NE1 3.3Å; Y47-W49 HydrophobicContact CD1-CZ2 4.49Å; Y47-W49 AromaticContact CD1-NE1 3.7Å; Y47-W49 AromaticContact CD2-CZ2 3.81Å; Y47-W49 HydrophobicContact CD2-CZ2 3.81Å; Y47-W49 AromaticContact CG-CE2 3.74Å; Y47-W49 AromaticContact CG-CZ2 3.8Å; Y47-W49 HydrophobicContact CG-CZ2 3.8Å; Y47-W49 AromaticContact CG-NE1 3.55Å
50	S	96.1	Very high	96	Very high	31 Å²	31	108.3 Å²	108.3	22%	0.217	53%	0.528	C	S	.	.			trans	-115.6	77	-177.6	-159.3	0	0	0	0	113.1	Y47 N48 K52 A53 K54	Y47-S50 PolarHBondContact O-N 3.03Å; N48-S50 PolarHBondContact O-N 2.74Å; S50-K52 PolarHBondContact O-N 3.38Å; S50-A53 PolarHBondContact O-N 3.29Å; S50-A53 WeakPolarHBondContact OG-CB 3.36Å; S50-K54 WeakPolarHBondContact O-CG 3.36Å; S50-K54 PolarHBondContact O-N 3.38Å; S50-K54 VanDerWaalsContact O-N 3.11Å
51	E	96.7	Very high	95.9	Very high	155 Å²	155	108.9 Å²	108.9	72%	0.724	53%	0.53	S	S	*	.	H	α-helix	trans	-60.8	-46	-179.6	-63.5	-174.9	174	0	0	113	A53 K54 R55	E51-A53 PolarHBondContact O-N 3.12Å; E51-K54 WeakPolarHBondContact O-CB 3.09Å; E51-K54 PolarHBondContact O-N 2.92Å; E51-K54 VanDerWaalsContact O-N 3.08Å; E51-R55 PolarHBondContact O-N 3.18Å
52	K	97.4	Very high	95.8	Very high	124 Å²	124	108.7 Å²	108.7	54%	0.539	54%	0.537	S	S	.	.	H	α-helix	trans	-60.6	-34.4	178.3	-160.8	178.8	-171.3	172.1	0	111.8	S50 R56	S50-K52 PolarHBondContact O-N 3.38Å; K52-R56 WeakPolarHBondContact O-CG 3.5Å; K52-R56 PolarHBondContact O-N 3.42Å
53	A	96	Very high	95.7	Very high	33 Å²	33	114.1 Å²	114.1	27%	0.273	54%	0.536	S	S	.	.	H	α-helix	trans	-71	-39.2	176.2	0	0	0	0	0	112.1	S50 E51 R56	S50-A53 PolarHBondContact O-N 3.29Å; S50-A53 WeakPolarHBondContact OG-CB 3.36Å; E51-A53 PolarHBondContact O-N 3.12Å; A53-R56 PolarHBondContact O-N 2.72Å
54	K	96	Very high	95.7	Very high	63 Å²	63	107.6 Å²	107.6	27%	0.274	52%	0.516	S	S	.	.	H	α-helix	trans	-58.2	-51.2	172.5	-64.9	171.8	-172.7	171.3	0	110.4	K46 Y47 N48 S50 E51 R56 R57 T58	K46-K54 HydrophobicContact CD-CG 4.45Å; K46-K54 HydrophobicContact CG-CG 4.17Å; Y47-K54 WeakPolarHBondContact O-CE 3.08Å; N48-K54 VanDerWaalsContact CA-NZ 3.32Å; N48-K54 WeakPolarHBondContact O-CE 3.35Å; N48-K54 PolarHBondContact O-NZ 3.28Å; N48-K54 PolarHBondContact OD1-NZ 3.38Å; N48-K54 VanDerWaalsContact OD1-NZ 3.17Å; S50-K54 WeakPolarHBondContact O-CG 3.36Å; S50-K54 PolarHBondContact O-N 3.38Å; S50-K54 VanDerWaalsContact O-N 3.11Å; E51-K54 WeakPolarHBondContact O-CB 3.09Å; E51-K54 PolarHBondContact O-N 2.92Å; E51-K54 VanDerWaalsContact O-N 3.08Å; K54-R56 VanDerWaalsContact C-N 3.31Å; K54-R56 PolarHBondContact O-N 3.45Å; K54-R57 PolarHBondContact O-N 3.45Å; K54-R57 VanDerWaalsContact O-N 3.07Å; K54-T58 PolarHBondContact O-N 3.5Å
55	R	96.2	Very high	95.7	Very high	173 Å²	173	108 Å²	108	65%	0.653	52%	0.518	S	S	*	.	H	α-helix	trans	-57.1	-39.2	-178.3	-171.9	178.8	67.2	158.8	1.5	113.4	E51 R57 T61	E51-R55 PolarHBondContact O-N 3.18Å; R55-R57 PolarHBondContact O-N 2.81Å; R55-R57 VanDerWaalsContact O-N 3.13Å; R55-T61 VanDerWaalsContact O-CG2 3.31Å; R55-T61 WeakPolarHBondContact O-CG2 3.38Å
56	R	94.9	Very high	95.7	Very high	136 Å²	136	109.9 Å²	109.9	51%	0.513	53%	0.531	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69.4	-4.8	179.7	-72	175.1	-178.8	132.6	-16.3	114.9	K52 A53 K54	K52-R56 WeakPolarHBondContact O-CG 3.5Å; K52-R56 PolarHBondContact O-N 3.42Å; A53-R56 PolarHBondContact O-N 2.72Å; K54-R56 VanDerWaalsContact C-N 3.31Å; K54-R56 PolarHBondContact O-N 3.45Å
57	R	93	Very high	95.7	Very high	91 Å²	91	107.3 Å²	107.3	34%	0.343	52%	0.523	S	S	.	.	T	Hydrogen-bonded Turn	trans	-139.7	-5.5	-172.8	-56	-179.4	-171.5	-165	-0.9	114.2	S36 K54 R55	S36-R57 PolarHBondContact O-NH1 3.09Å; S36-R57 PolarHBondContact OG-NH1 3.04Å; S36-R57 PolarHBondContact OG-NH2 3.33Å; K54-R57 PolarHBondContact O-N 3.45Å; K54-R57 VanDerWaalsContact O-N 3.07Å; R55-R57 PolarHBondContact O-N 2.81Å; R55-R57 VanDerWaalsContact O-N 3.13Å
58	T	94.6	Very high	95.6	Very high	80 Å²	80	110.1 Å²	110.1	49%	0.491	54%	0.537	S	S	.	.	S	Bend	trans	-62.7	155.6	-176.4	-167.7	0	0	0	0	110.9	K54 G60 T61	K54-T58 PolarHBondContact O-N 3.5Å; T58-G60 PolarHBondContact O-N 2.84Å; T58-T61 HydrophobicContact CG2-CG2 4.2Å; T58-T61 PolarHBondContact O-N 3.01Å; T58-T61 PolarHBondContact O-OG1 3.06Å
59	T	94.7	Very high	95.5	Very high	108 Å²	108	111.7 Å²	111.7	66%	0.663	53%	0.534	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.7	128.3	168.1	-52.9	0	0	0	0	108.4	L67	T59-L67 HydrophobicContact CG2-CD1 3.59Å
60	G	94.3	Very high	95.4	Very high	40 Å²	40	104.4 Å²	104.4	41%	0.412	51%	0.512	S	S	.	.	T	Hydrogen-bonded Turn	trans	123.8	-35.2	-167.7	0	0	0	0	0	113.7	T58 G62 M64	T58-G60 PolarHBondContact O-N 2.84Å; G60-G62 PolarHBondContact O-N 2.95Å; G60-M64 WeakPolarHBondContact CA-SD 3.28Å
61	T	95.5	Very high	95.4	Very high	89 Å²	89	108.2 Å²	108.2	55%	0.546	53%	0.526	S	S	.	.	S	Bend	trans	-81.5	-14.7	-173.1	63.1	0	0	0	0	114.2	R55 T58	R55-T61 VanDerWaalsContact O-CG2 3.31Å; R55-T61 WeakPolarHBondContact O-CG2 3.38Å; T58-T61 HydrophobicContact CG2-CG2 4.2Å; T58-T61 PolarHBondContact O-N 3.01Å; T58-T61 PolarHBondContact O-OG1 3.06Å
62	G	94.5	Very high	95.2	Very high	50 Å²	50	107.8 Å²	107.8	52%	0.515	52%	0.518	S	S	.	.	S	Bend	trans	-108.1	-170.9	-178.4	0	0	0	0	0	112.5	G60 M64	G60-G62 PolarHBondContact O-N 2.95Å; G62-M64 PolarHBondContact O-N 2.85Å; G62-M64 VanDerWaalsContact O-N 3.08Å
63	R	95.6	Very high	95	Very high	213 Å²	213	107.2 Å²	107.2	80%	0.804	51%	0.512	S	S	*	.			trans	-61.4	-21.7	-175.9	-65.4	-179.3	176	173.6	-4.3	115	L65	R63-L65 HydrophobicContact CB-CD2 4.02Å; R63-L65 HydrophobicContact CB-CG 3.85Å; R63-L65 PolarHBondContact O-N 2.85Å
64	M	96.2	Very high	95	Very high	83 Å²	83	111.8 Å²	111.8	41%	0.409	53%	0.526	S	S	.	.			trans	45.6	39.7	-177.5	-67.2	-168.2	-74.1	0	0	113.3	G60 G62 H66 L67 K68	G60-M64 WeakPolarHBondContact CA-SD 3.28Å; G62-M64 PolarHBondContact O-N 2.85Å; G62-M64 VanDerWaalsContact O-N 3.08Å; M64-H66 VanDerWaalsContact C-N 3.3Å; M64-H66 PolarHBondContact O-N 3.47Å; M64-H66 VanDerWaalsContact O-N 3.16Å; M64-L67 HydrophobicContact CB-CB 4.41Å; M64-L67 PolarHBondContact O-N 3.41Å; M64-K68 VanDerWaalsContact O-CB 3.22Å; M64-K68 WeakPolarHBondContact O-CB 3.39Å; M64-K68 PolarHBondContact O-N 2.87Å
65	L	95.4	Very high	94.9	Very high	131 Å²	131	116.4 Å²	116.4	69%	0.686	55%	0.546	S	S	*	.	H	α-helix	trans	-51.8	-46.6	-168.4	-68.7	173.6	0	0	0	112.9	R63	R63-L65 HydrophobicContact CB-CD2 4.02Å; R63-L65 HydrophobicContact CB-CG 3.85Å; R63-L65 PolarHBondContact O-N 2.85Å
66	H	96.4	Very high	94.7	Very high	137 Å²	137	113.5 Å²	113.5	63%	0.634	54%	0.54	S	S	*	.	H	α-helix	trans	-74.5	-54.3	177.9	-178.4	71.5	0	0	0	112	M64 K68 R69 V70	M64-H66 VanDerWaalsContact C-N 3.3Å; M64-H66 PolarHBondContact O-N 3.47Å; M64-H66 VanDerWaalsContact O-N 3.16Å; H66-K68 VanDerWaalsContact C-N 3.29Å; H66-K68 PolarHBondContact O-N 3.18Å; H66-R69 WeakPolarHBondContact O-CA 3.37Å; H66-R69 WeakPolarHBondContact O-CB 3.46Å; H66-R69 PolarHBondContact O-N 2.95Å; H66-V70 VanDerWaalsContact NE2-CG2 3.34Å; H66-V70 WeakPolarHBondContact NE2-CG2 3.39Å; H66-V70 WeakPolarHBondContact O-CG2 3.4Å; H66-V70 PolarHBondContact O-N 3.22Å
67	L	95.8	Very high	94.5	Very high	92 Å²	92	109.8 Å²	109.8	48%	0.482	54%	0.544	S	S	.	.	H	α-helix	trans	-60.7	-34.8	-175.7	-66.6	176.4	0	0	0	113.3	T59 M64 R69 V70 H71	T59-L67 HydrophobicContact CG2-CD1 3.59Å; M64-L67 HydrophobicContact CB-CB 4.41Å; M64-L67 PolarHBondContact O-N 3.41Å; L67-R69 VanDerWaalsContact C-N 3.34Å; L67-R69 PolarHBondContact O-N 2.93Å; L67-V70 PolarHBondContact O-N 3.49Å; L67-H71 PolarHBondContact O-N 2.89Å
68	K	94.6	Very high	94.5	Very high	160 Å²	160	110 Å²	110	70%	0.696	55%	0.548	S	S	*	.	H	α-helix	trans	-61.6	-42.5	173.4	-176.6	177.9	179.4	178.7	0	111.4	M64 H66 R72	M64-K68 VanDerWaalsContact O-CB 3.22Å; M64-K68 WeakPolarHBondContact O-CB 3.39Å; M64-K68 PolarHBondContact O-N 2.87Å; H66-K68 VanDerWaalsContact C-N 3.29Å; H66-K68 PolarHBondContact O-N 3.18Å; K68-R72 PolarHBondContact O-N 2.84Å; K68-R72 VanDerWaalsContact O-N 3.16Å
69	R	94.6	Very high	94.2	Very high	156 Å²	156	116.3 Å²	116.3	59%	0.589	56%	0.562	S	S	*	*	H	α-helix	trans	-68	-40.9	175.7	-175.1	-178.1	-67	-178.2	-2.2	111.3	H66 L67 R72 R73	H66-R69 WeakPolarHBondContact O-CA 3.37Å; H66-R69 WeakPolarHBondContact O-CB 3.46Å; H66-R69 PolarHBondContact O-N 2.95Å; L67-R69 VanDerWaalsContact C-N 3.34Å; L67-R69 PolarHBondContact O-N 2.93Å; R69-R72 PolarHBondContact O-N 3.41Å; R69-R73 WeakPolarHBondContact O-CG 3.34Å; R69-R73 PolarHBondContact O-N 3.09Å
70	V	95.3	Very high	93.8	Very high	48 Å²	48	116.5 Å²	116.5	29%	0.291	57%	0.568	S	S	.	*	H	α-helix	trans	-59.1	-48	175.4	172.9	0	0	0	0	110.5	H66 L67 R72 R73 F74 F78	H66-V70 VanDerWaalsContact NE2-CG2 3.34Å; H66-V70 WeakPolarHBondContact NE2-CG2 3.39Å; H66-V70 WeakPolarHBondContact O-CG2 3.4Å; H66-V70 PolarHBondContact O-N 3.22Å; L67-V70 PolarHBondContact O-N 3.49Å; V70-R72 VanDerWaalsContact C-N 3.32Å; V70-R72 PolarHBondContact O-N 3.31Å; V70-R73 PolarHBondContact O-N 2.98Å; V70-R73 VanDerWaalsContact O-N 3.14Å; V70-F74 WeakPolarHBondContact O-CB 3.21Å; V70-F74 PolarHBondContact O-N 2.92Å; V70-F78 HydrophobicContact CG1-CE1 4.13Å; V70-F78 HydrophobicContact CG1-CZ 4.44Å
71	H	95	Very high	93.4	Very high	110 Å²	110	117.8 Å²	117.8	51%	0.509	58%	0.581	S	S	.	*	H	α-helix	trans	-59.8	-41.1	177.7	-170.6	59.2	0	0	0	112.7	L67 F74 K75	L67-H71 PolarHBondContact O-N 2.89Å; H71-F74 WeakPolarHBondContact O-CB 3.36Å; H71-F74 PolarHBondContact O-N 3.17Å; H71-K75 WeakPolarHBondContact NE2-CE 3.18Å; H71-K75 PolarHBondContact O-N 3.29Å; H71-K75 VanDerWaalsContact O-N 3.13Å
72	R	93.4	Very high	92.9	Very high	147 Å²	147	119.3 Å²	119.3	56%	0.555	59%	0.593	S	S	*	*	H	α-helix	trans	-62	-45	174.7	-175.3	-177.6	68.3	-168.8	5.4	111.9	K68 R69 V70 K75 Q76	K68-R72 PolarHBondContact O-N 2.84Å; K68-R72 VanDerWaalsContact O-N 3.16Å; R69-R72 PolarHBondContact O-N 3.41Å; V70-R72 VanDerWaalsContact C-N 3.32Å; V70-R72 PolarHBondContact O-N 3.31Å; R72-K75 PolarHBondContact O-N 2.6Å; R72-Q76 PolarHBondContact O-N 3.14Å
73	R	93.9	Very high	92.4	Very high	112 Å²	112	122.7 Å²	122.7	42%	0.423	61%	0.606	S	S	.	*	H	α-helix	trans	-66	-39.3	177	-71.2	-179.1	68.4	-167.6	-1.6	111.5	R69 V70 K75 Q76 G77 F78	R69-R73 WeakPolarHBondContact O-CG 3.34Å; R69-R73 PolarHBondContact O-N 3.09Å; V70-R73 PolarHBondContact O-N 2.98Å; V70-R73 VanDerWaalsContact O-N 3.14Å; R73-K75 PolarHBondContact O-N 2.93Å; R73-Q76 CarbonylContact O-C 3.45Å; R73-Q76 WeakPolarHBondContact O-CA 3.24Å; R73-Q76 PolarHBondContact O-N 3.25Å; R73-G77 PolarHBondContact O-N 3.24Å; R73-G77 VanDerWaalsContact O-N 3.14Å; R73-F78 HydrophobicContact CB-CD1 3.66Å; R73-F78 HydrophobicContact CB-CE1 4.06Å; R73-F78 WeakPolarHBondContact O-CA 3.39Å; R73-F78 PolarHBondContact O-N 3.17Å
74	F	95.6	Very high	91.8	Very high	129 Å²	129	121.9 Å²	121.9	57%	0.566	61%	0.608	S	S	*	*	H	α-helix	trans	-56.4	-47.7	176.6	174	-103.1	0	0	0	111.4	V70 H71 Q76 G77 F78	V70-F74 WeakPolarHBondContact O-CB 3.21Å; V70-F74 PolarHBondContact O-N 2.92Å; H71-F74 WeakPolarHBondContact O-CB 3.36Å; H71-F74 PolarHBondContact O-N 3.17Å; F74-Q76 PolarHBondContact O-N 3.08Å; F74-Q76 VanDerWaalsContact O-N 3.13Å; F74-G77 PolarHBondContact O-N 3.36Å; F74-F78 HydrophobicContact CB-CE1 4.06Å; F74-F78 HydrophobicContact CB-CE2 4.1Å; F74-F78 HydrophobicContact CB-CZ 3.63Å; F74-F78 AromaticContact CD2-CE2 3.58Å; F74-F78 HydrophobicContact CD2-CE2 3.58Å; F74-F78 AromaticContact CD2-CZ 3.79Å; F74-F78 HydrophobicContact CD2-CZ 3.79Å; F74-F78 HydrophobicContact CG-CE2 4.34Å; F74-F78 HydrophobicContact CG-CZ 4.21Å
75	K	94.1	Very high	91.4	Very high	160 Å²	160	123.6 Å²	123.6	70%	0.696	63%	0.625	S	S	*	*	H	α-helix	trans	-59.7	-23.9	175	-69.5	-171.8	177.8	-166.3	0	114.1	H71 R72 R73	H71-K75 WeakPolarHBondContact NE2-CE 3.18Å; H71-K75 PolarHBondContact O-N 3.29Å; H71-K75 VanDerWaalsContact O-N 3.13Å; R72-K75 PolarHBondContact O-N 2.6Å; R73-K75 PolarHBondContact O-N 2.93Å
76	Q	90.5	Very high	91	Very high	111 Å²	111	124.2 Å²	124.2	52%	0.519	64%	0.635	S	S	.	*	T	Hydrogen-bonded Turn	trans	-97.2	7.3	177.3	-64.4	174.8	-16.3	0	0	112.5	R72 R73 F74 R79	R72-Q76 PolarHBondContact O-N 3.14Å; R73-Q76 CarbonylContact O-C 3.45Å; R73-Q76 WeakPolarHBondContact O-CA 3.24Å; R73-Q76 PolarHBondContact O-N 3.25Å; F74-Q76 PolarHBondContact O-N 3.08Å; F74-Q76 VanDerWaalsContact O-N 3.13Å; Q76-R79 WeakPolarHBondContact O-CD 3.43Å; Q76-R79 VanDerWaalsContact O-CG 3.24Å; Q76-R79 WeakPolarHBondContact O-CG 3.39Å
77	G	92	Very high	90.4	Very high	58 Å²	58	127.1 Å²	127.1	60%	0.598	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	72	27.5	-178.4	0	0	0	0	0	114.1	R73 F74 R79	R73-G77 PolarHBondContact O-N 3.24Å; R73-G77 VanDerWaalsContact O-N 3.14Å; F74-G77 PolarHBondContact O-N 3.36Å; G77-R79 PolarHBondContact O-N 3.12Å
78	F	92.6	Very high	89.4	Confident	95 Å²	95	131 Å²	131	42%	0.417	69%	0.691	S	S	.	*	T	Hydrogen-bonded Turn	trans	54	19.4	-177.3	-62.1	-73.1	0	0	0	116	V70 R73 F74 S80	V70-F78 HydrophobicContact CG1-CE1 4.13Å; V70-F78 HydrophobicContact CG1-CZ 4.44Å; R73-F78 HydrophobicContact CB-CD1 3.66Å; R73-F78 HydrophobicContact CB-CE1 4.06Å; R73-F78 WeakPolarHBondContact O-CA 3.39Å; R73-F78 PolarHBondContact O-N 3.17Å; F74-F78 HydrophobicContact CB-CE1 4.06Å; F74-F78 HydrophobicContact CB-CE2 4.1Å; F74-F78 HydrophobicContact CB-CZ 3.63Å; F74-F78 AromaticContact CD2-CE2 3.58Å; F74-F78 HydrophobicContact CD2-CE2 3.58Å; F74-F78 AromaticContact CD2-CZ 3.79Å; F74-F78 HydrophobicContact CD2-CZ 3.79Å; F74-F78 HydrophobicContact CG-CE2 4.34Å; F74-F78 HydrophobicContact CG-CZ 4.21Å; F78-S80 PolarHBondContact O-N 3.4Å
79	R	87.4	Confident	89.1	Confident	213 Å²	213	129.6 Å²	129.6	80%	0.804	69%	0.691	S	S	*	*			trans	-42.1	127.9	176.8	-71.7	172	-175.7	-177.3	2.7	111.2	Q76 G77	Q76-R79 WeakPolarHBondContact O-CD 3.43Å; Q76-R79 VanDerWaalsContact O-CG 3.24Å; Q76-R79 WeakPolarHBondContact O-CG 3.39Å; G77-R79 PolarHBondContact O-N 3.12Å
80	S	87.2	Confident	88.8	Confident	112 Å²	112	128.2 Å²	128.2	78%	0.783	70%	0.696	S	S	*	*			trans	-112.8	159.2	172.9	49.9	0	0	0	0	109.3	F78	F78-S80 PolarHBondContact O-N 3.4Å
81	G	86	Confident	88.5	Confident	67 Å²	67	132.7 Å²	132.7	69%	0.691	72%	0.719	S	S	*	*	S	Bend	trans	100.4	168.6	-177.9	0	0	0	0	0	113.8
82	P	84.6	Confident	88.1	Confident	122 Å²	122	134 Å²	134	79%	0.792	73%	0.731	S	S	*	*	S	Bend	trans	-64.8	157.4	178.8	28.4	-34.4	0	0	0	111.4
83	P	84	Confident	87.7	Confident	120 Å²	120	133.2 Å²	133.2	78%	0.779	74%	0.742	S	S	*	*	P	Polyproline II helix	trans	-58	149.9	171.3	27.3	-34.3	0	0	0	110.2
84	K	83.8	Confident	87.3	Confident	196 Å²	196	134.6 Å²	134.6	85%	0.852	76%	0.763	S	S	*	*	P	Polyproline II helix	trans	-58	133.4	172.5	-66.5	-175	177.9	-173.7	0	108.5
85	P	87.2	Confident	86.7	Confident	119 Å²	119	135 Å²	135	77%	0.773	78%	0.777	S	S	*	*	P	Polyproline II helix	trans	-60	144.4	177.7	25.6	-33.6	0	0	0	110.3	K87	P85-K87 PolarHBondContact O-N 3.38Å
86	V	88.1	Confident	86.2	Confident	145 Å²	145	133.1 Å²	133.1	88%	0.879	78%	0.784	S	S	*	*	P	Polyproline II helix	trans	-68.4	126.6	172	-172	0	0	0	0	107
87	K	82.4	Confident	85.8	Confident	197 Å²	197	134.9 Å²	134.9	86%	0.857	81%	0.806	S	S	*	*	P	Polyproline II helix	trans	-69.3	132.2	172.2	-66.3	-176.1	177.6	-174.6	0	107.8	P85	P85-K87 PolarHBondContact O-N 3.38Å
88	A	74.6	Confident	85.3	Confident	175 Å²	175	141.9 Å²	141.9	100%	1.446	83%	0.825	S	S	*	*			trans	-58.3	0	173.8	0	0	0	0	0	111.4

Retrieved 88 of 88 residues in 51.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).