VAMP4_HUMAN Loading...

Vesicle-associated membrane protein 4

Involved in the pathway that functions to remove an inhibitor (probably synaptotagmin-4) of calcium-triggered exocytosis during the maturation of secretory granules. May be a marker for this sorting pathway that is critical for remodeling the secretory response of granule.

AlphaFold DB , UniProt , Accession O75379, Species HUMAN (Homo sapiens, Human), Gene VAMP4, Length 141 aa.

						>VAMP4_HUMAN|O75379|VAMP4
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59	Low	63.3	Low	235 Å²	235	158.5 Å²	158.5	100%	1.158	77%	0.774	S	S	*	*				0	122.3	0	-72.7	175.5	170.1	0	0	107.2
2	P	51.8	Low	63.8	Low	123 Å²	123	153 Å²	153	80%	0.799	75%	0.75	S	S	*	*			trans	-71.8	141.7	174.9	29	-30.9	0	0	0	110
3	P	59.5	Low	64.1	Low	116 Å²	116	150.5 Å²	150.5	75%	0.753	74%	0.742	S	S	*	*			trans	-67.3	139.7	-176.2	26	-32.1	0	0	0	111.3	F5	P3-F5 PolarHBondContact O-N 3.38Å; P3-F5 VanDerWaalsContact O-N 3.12Å
4	K	66.6	Low	64.2	Low	194 Å²	194	146.6 Å²	146.6	84%	0.843	73%	0.731	S	S	*	*			trans	-72.1	102.1	176.4	-71.7	-176.4	176.2	-177.4	0	109.2	K6	K4-K6 VanDerWaalsContact C-N 3.31Å; K4-K6 PolarHBondContact O-N 3.17Å
5	F	68.2	Low	64.4	Low	184 Å²	184	144.5 Å²	144.5	81%	0.807	73%	0.729	S	S	*	*			trans	-63	95.1	162.3	-110.6	-93.4	0	0	0	108	P3 R7	P3-F5 PolarHBondContact O-N 3.38Å; P3-F5 VanDerWaalsContact O-N 3.12Å; F5-R7 VanDerWaalsContact C-N 3.29Å; F5-R7 PolarHBondContact O-N 2.9Å
6	K	58.5	Low	64.3	Low	154 Å²	154	138.5 Å²	138.5	67%	0.67	72%	0.715	S	S	*	*			trans	-73.7	94.4	164.6	-67.5	-173	-177.8	-179.6	0	105.8	K4 H8	K4-K6 VanDerWaalsContact C-N 3.31Å; K4-K6 PolarHBondContact O-N 3.17Å; K6-H8 WeakPolarHBondContact CB-NE2 3.42Å; K6-H8 PolarHBondContact O-CD2 3.02Å; K6-H8 PolarHBondContact O-N 2.87Å
7	R	66.2	Low	64.4	Low	214 Å²	214	134.2 Å²	134.2	81%	0.808	70%	0.7	S	S	*	*			trans	-67	90.3	167.7	-69.5	-179.6	173.9	138.1	-3	106.3	F5 L9	F5-R7 VanDerWaalsContact C-N 3.29Å; F5-R7 PolarHBondContact O-N 2.9Å; R7-L9 PolarHBondContact O-N 3.32Å
8	H	61.3	Low	64.6	Low	156 Å²	156	131.6 Å²	131.6	72%	0.722	69%	0.69	S	S	*	*			trans	-73.1	86.5	164.1	-63.3	-80.3	0	0	0	105.1	K6 N10	K6-H8 WeakPolarHBondContact CB-NE2 3.42Å; K6-H8 PolarHBondContact O-CD2 3.02Å; K6-H8 PolarHBondContact O-N 2.87Å; H8-N10 PolarHBondContact O-N 3.37Å
9	L	63.5	Low	65	Low	130 Å²	130	132.6 Å²	132.6	68%	0.681	69%	0.688	S	S	*	*			trans	-64	113.7	160.4	-109.9	86.3	0	0	0	104.8	R7	R7-L9 PolarHBondContact O-N 3.32Å
10	N	70.8	Confident	65	Low	96 Å²	96	129.7 Å²	129.7	51%	0.513	68%	0.68	S	S	.	*			trans	-81.9	130.3	177.2	-155.6	31.4	0	0	0	106.8	H8 D12 D13	H8-N10 PolarHBondContact O-N 3.37Å; N10-D12 VanDerWaalsContact C-OD1 3.24Å; N10-D12 WeakPolarHBondContact CB-OD1 3.3Å; N10-D12 PolarHBondContact ND2-OD1 3.44Å; N10-D12 PolarHBondContact ND2-OD2 3.28Å; N10-D12 PolarHBondContact O-N 2.96Å; N10-D12 VanDerWaalsContact O-N 3.1Å; N10-D13 PolarHBondContact O-N 3.47Å; N10-D13 VanDerWaalsContact O-N 3.11Å
11	D	70.7	Confident	65.2	Low	142 Å²	142	129.6 Å²	129.6	76%	0.759	68%	0.676	S	S	*	*	H	α-helix	trans	-63.7	-18	-170.7	-72.8	-41.8	0	0	0	112.8
12	D	69.8	Low	65.8	Low	92 Å²	92	127.1 Å²	127.1	49%	0.492	65%	0.654	S	S	.	*	H	α-helix	trans	-69	-34.9	174.2	56	-15.3	0	0	0	113.4	N10 V14 T15	N10-D12 VanDerWaalsContact C-OD1 3.24Å; N10-D12 WeakPolarHBondContact CB-OD1 3.3Å; N10-D12 PolarHBondContact ND2-OD1 3.44Å; N10-D12 PolarHBondContact ND2-OD2 3.28Å; N10-D12 PolarHBondContact O-N 2.96Å; N10-D12 VanDerWaalsContact O-N 3.1Å; D12-V14 VanDerWaalsContact C-N 3.26Å; D12-V14 PolarHBondContact O-N 3.47Å; D12-T15 PolarHBondContact O-N 2.89Å; D12-T15 PolarHBondContact O-OG1 3.19Å
13	D	67.3	Low	66.6	Low	121 Å²	121	129.9 Å²	129.9	65%	0.647	65%	0.648	S	S	*	*	H	α-helix	trans	-60.6	-34.1	179.6	-82.9	-21	0	0	0	112.4	N10 T15	N10-D13 PolarHBondContact O-N 3.47Å; N10-D13 VanDerWaalsContact O-N 3.11Å; D13-T15 VanDerWaalsContact C-N 3.3Å; D13-T15 PolarHBondContact O-N 3.1Å
14	V	65.7	Low	67	Low	96 Å²	96	130.5 Å²	130.5	58%	0.582	65%	0.645	S	S	*	*	H	α-helix	trans	-69.6	-29.8	-177.9	178.5	0	0	0	0	111.6	D12	D12-V14 VanDerWaalsContact C-N 3.26Å; D12-V14 PolarHBondContact O-N 3.47Å
15	T	67.5	Low	67	Low	114 Å²	114	128.3 Å²	128.3	70%	0.699	64%	0.642	S	S	*	*	H	α-helix	trans	-83.7	-21.1	-172.7	66.6	0	0	0	0	113.8	D12 D13	D12-T15 PolarHBondContact O-N 2.89Å; D12-T15 PolarHBondContact O-OG1 3.19Å; D13-T15 VanDerWaalsContact C-N 3.3Å; D13-T15 PolarHBondContact O-N 3.1Å
16	G	63.1	Low	66.7	Low	49 Å²	49	127 Å²	127	51%	0.505	64%	0.643	S	S	.	*	H	α-helix	trans	-81.1	-32.4	-176.9	0	0	0	0	0	115.1	V18	G16-V18 PolarHBondContact O-N 2.98Å
17	S	65.2	Low	66.9	Low	65 Å²	65	127.7 Å²	127.7	46%	0.455	65%	0.648	S	S	.	*	H	α-helix	trans	-69	-38.6	-166.1	-165.8	0	0	0	0	114.3	K19 S20	S17-K19 VanDerWaalsContact C-N 3.34Å; S17-K19 PolarHBondContact O-N 2.97Å; S17-S20 PolarHBondContact O-OG 2.85Å
18	V	68.1	Low	66.8	Low	87 Å²	87	124.4 Å²	124.4	53%	0.527	65%	0.646	S	S	.	*	H	α-helix	trans	-71	-27.5	-168.5	-177.4	0	0	0	0	113.1	G16	G16-V18 PolarHBondContact O-N 2.98Å
19	K	72.6	Confident	66.9	Low	152 Å²	152	124.6 Å²	124.6	66%	0.661	65%	0.653	S	S	*	*	H	α-helix	trans	-81.1	-30.2	-175.7	-168.3	169.1	-177.9	175.3	0	112.8	S17	S17-K19 VanDerWaalsContact C-N 3.34Å; S17-K19 PolarHBondContact O-N 2.97Å
20	S	65.2	Low	66.4	Low	74 Å²	74	123.6 Å²	123.6	52%	0.517	66%	0.657	S	S	.	*	H	α-helix	trans	-70.9	-41.6	176.7	34.8	0	0	0	0	112.3	S17 R22 R23 N24	S17-S20 PolarHBondContact O-OG 2.85Å; S20-R22 PolarHBondContact O-N 3.1Å; S20-R23 PolarHBondContact O-N 3.36Å; S20-N24 PolarHBondContact O-N 2.93Å
21	E	69.6	Low	65.7	Low	127 Å²	127	125.9 Å²	125.9	59%	0.593	67%	0.669	S	S	*	*	H	α-helix	trans	-65	-39	-178.7	-66.7	-172.2	121.6	0	0	112.3	R23 N24 L25	E21-R23 VanDerWaalsContact C-N 3.27Å; E21-R23 PolarHBondContact O-N 2.96Å; E21-N24 PolarHBondContact O-N 3.41Å; E21-L25 PolarHBondContact O-N 2.91Å
22	R	69.7	Low	65.2	Low	184 Å²	184	126.9 Å²	126.9	69%	0.694	67%	0.669	S	S	*	*	H	α-helix	trans	-65.5	-28	178.5	-73.7	-167.8	-178.7	-151.2	0.9	113.9	S20 L26	S20-R22 PolarHBondContact O-N 3.1Å; R22-L26 WeakPolarHBondContact O-CD1 3.44Å
23	R	69.2	Low	64.6	Low	181 Å²	181	132.2 Å²	132.2	68%	0.683	69%	0.691	S	S	*	*	H	α-helix	trans	-75.9	-40	177.5	-78.2	-174.1	172.5	-177.5	-4.4	111.6	S20 E21 L25 L26	S20-R23 PolarHBondContact O-N 3.36Å; E21-R23 VanDerWaalsContact C-N 3.27Å; E21-R23 PolarHBondContact O-N 2.96Å; R23-L25 VanDerWaalsContact C-N 3.3Å; R23-L25 PolarHBondContact O-N 3.35Å; R23-L26 PolarHBondContact O-N 3.31Å
24	N	69	Low	64	Low	129 Å²	129	134.5 Å²	134.5	69%	0.69	70%	0.698	S	S	*	*	H	α-helix	trans	-69.1	-28.2	-177.9	-150.8	39.4	0	0	0	113	S20 E21 L26	S20-N24 PolarHBondContact O-N 2.93Å; E21-N24 PolarHBondContact O-N 3.41Å; N24-L26 VanDerWaalsContact C-N 3.31Å
25	L	65	Low	63.5	Low	148 Å²	148	134.9 Å²	134.9	78%	0.775	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.1	-13	176.2	-89.7	163.9	0	0	0	114.6	E21 R23	E21-L25 PolarHBondContact O-N 2.91Å; R23-L25 VanDerWaalsContact C-N 3.3Å; R23-L25 PolarHBondContact O-N 3.35Å
26	L	63.2	Low	63.4	Low	157 Å²	157	138.4 Å²	138.4	82%	0.822	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.7	-2.1	-176.4	-108.5	133.1	0	0	0	112.9	R22 R23 N24	R22-L26 WeakPolarHBondContact O-CD1 3.44Å; R23-L26 PolarHBondContact O-N 3.31Å; N24-L26 VanDerWaalsContact C-N 3.31Å
27	E	62.7	Low	63.4	Low	168 Å²	168	144.6 Å²	144.6	79%	0.785	72%	0.716	S	S	*	*	S	Bend	trans	-113.6	3.1	-172.1	-157.4	162.4	-172	0	0	113.7
28	D	63.7	Low	63.1	Low	144 Å²	144	148.1 Å²	148.1	77%	0.77	73%	0.729	S	S	*	*	S	Bend	trans	-121.8	76.1	-178.4	-166	52.2	0	0	0	110.7
29	D	63.1	Low	62.5	Low	160 Å²	160	155.4 Å²	155.4	86%	0.856	75%	0.747	S	S	*	*			trans	-165.4	43.5	170.9	-126.9	4	0	0	0	115.4
30	S	53.1	Low	61.9	Low	110 Å²	110	150.9 Å²	150.9	77%	0.769	74%	0.744	S	S	*	*			trans	-145.9	31.4	-174.4	-67.1	0	0	0	0	118.5
31	D	57.2	Low	61.8	Low	144 Å²	144	153.6 Å²	153.6	77%	0.77	76%	0.76	S	S	*	*	S	Bend	trans	-153.1	106.6	175.5	-38.3	59.2	0	0	0	112.3
32	E	59.8	Low	61.2	Low	162 Å²	162	153.5 Å²	153.5	76%	0.757	77%	0.773	S	S	*	*			trans	80.2	53.1	143.5	-55.3	174.2	-179.6	0	0	119.2	E34	E32-E34 PolarHBondContact O-N 3.32Å
33	E	57	Low	60.8	Low	204 Å²	204	147.9 Å²	147.9	95%	0.953	77%	0.772	S	S	*	*			trans	-75.9	65.6	144.3	-71.9	-174.9	-179.6	0	0	109.7	D35	E33-D35 PolarHBondContact O-N 3.45Å
34	E	53.9	Low	60.4	Low	170 Å²	170	145.3 Å²	145.3	79%	0.794	78%	0.779	S	S	*	*			trans	-68.9	94.4	169.2	-73.2	-160.1	160.4	0	0	110.2	E32 F36	E32-E34 PolarHBondContact O-N 3.32Å; E34-F36 PolarHBondContact O-N 3.35Å
35	D	56.5	Low	59.8	Low	104 Å²	104	150.9 Å²	150.9	56%	0.556	79%	0.79	S	S	*	*			trans	49.8	62.8	137.8	-112.9	-0.8	0	0	0	117.7	E33 F37 L38	E33-D35 PolarHBondContact O-N 3.45Å; D35-F37 PolarHBondContact O-N 2.91Å; D35-F37 VanDerWaalsContact O-N 3.08Å; D35-L38 HydrophobicContact CB-CD1 4.28Å; D35-L38 HydrophobicContact CB-CG 4.4Å; D35-L38 WeakPolarHBondContact OD2-CD1 3.26Å
36	F	64.8	Low	59.5	Low	187 Å²	187	152.6 Å²	152.6	82%	0.82	79%	0.792	S	S	*	*	G	3₁₀ helix	trans	-54.4	-21.6	164.6	177.8	-103	0	0	0	113.5	E34 L38	E34-F36 PolarHBondContact O-N 3.35Å; F36-L38 PolarHBondContact O-N 3.49Å
37	F	62.1	Low	59.1	Low	179 Å²	179	147.1 Å²	147.1	79%	0.785	77%	0.773	S	S	*	*	G	3₁₀ helix	trans	-83	-6.4	-169.7	-72.2	-83.2	0	0	0	116.1	D35	D35-F37 PolarHBondContact O-N 2.91Å; D35-F37 VanDerWaalsContact O-N 3.08Å
38	L	60.4	Low	59	Low	140 Å²	140	143.3 Å²	143.3	73%	0.733	76%	0.763	S	S	*	*	G	3₁₀ helix	trans	-87.9	-4.8	-173.3	-68.1	-179	0	0	0	116.3	D35 F36 G40	D35-L38 HydrophobicContact CB-CD1 4.28Å; D35-L38 HydrophobicContact CB-CG 4.4Å; D35-L38 WeakPolarHBondContact OD2-CD1 3.26Å; F36-L38 PolarHBondContact O-N 3.49Å; L38-G40 PolarHBondContact O-N 2.99Å
39	R	55	Low	59.1	Low	240 Å²	240	146.4 Å²	146.4	91%	0.906	76%	0.764	S	S	*	*	S	Bend	trans	-101.5	80	174.6	-162	161.8	-178.8	168	-1.5	111.6
40	G	59.5	Low	59.4	Low	57 Å²	57	143.5 Å²	143.5	59%	0.588	75%	0.748	S	S	*	*			trans	-53.5	144.7	176.3	0	0	0	0	0	113.5	L38 S42	L38-G40 PolarHBondContact O-N 2.99Å; G40-S42 PolarHBondContact O-N 3.47Å
41	P	62.8	Low	60.5	Low	131 Å²	131	142.6 Å²	142.6	85%	0.851	74%	0.735	S	S	*	*			trans	-74.5	118.8	-173.4	27.2	-32	0	0	0	111.9	G43	P41-G43 PolarHBondContact O-N 3.25Å; P41-G43 VanDerWaalsContact O-N 3.1Å
42	S	57.3	Low	61.4	Low	124 Å²	124	140.5 Å²	140.5	87%	0.867	72%	0.719	S	S	*	*			trans	-62.3	107.9	163.4	-68.9	0	0	0	0	109.5	G40	G40-S42 PolarHBondContact O-N 3.47Å
43	G	61.4	Low	62.3	Low	66 Å²	66	137 Å²	137	68%	0.68	70%	0.704	S	S	*	*	P	Polyproline II helix	trans	-62.5	142.1	-176.6	0	0	0	0	0	114.2	P41	P41-G43 PolarHBondContact O-N 3.25Å; P41-G43 VanDerWaalsContact O-N 3.1Å
44	P	60.1	Low	63.5	Low	128 Å²	128	132.6 Å²	132.6	83%	0.831	68%	0.682	S	S	*	*	P	Polyproline II helix	trans	-76.2	137.4	179.2	-12.2	27.6	0	0	0	113.3
45	R	56.9	Low	64.8	Low	246 Å²	246	130 Å²	130	93%	0.928	67%	0.669	S	S	*	*	P	Polyproline II helix	trans	-64.4	140.3	176.8	-64.5	-177.9	170.5	-179.1	-3.1	112.4	G47	R45-G47 PolarHBondContact O-N 2.96Å; R45-G47 VanDerWaalsContact O-N 3.17Å
46	F	59.5	Low	66	Low	184 Å²	184	129 Å²	129	81%	0.807	67%	0.667	S	S	*	*			trans	-78.4	92.2	176	-72.5	-96.3	0	0	0	111.7
47	G	55.5	Low	66.8	Low	41 Å²	41	125.5 Å²	125.5	42%	0.423	65%	0.653	S	S	.	*			trans	-71.5	168	162.6	0	0	0	0	0	112.9	R45 R49	R45-G47 PolarHBondContact O-N 2.96Å; R45-G47 VanDerWaalsContact O-N 3.17Å; G47-R49 PolarHBondContact O-N 2.85Å
48	P	59.8	Low	68	Low	89 Å²	89	122 Å²	122	58%	0.578	64%	0.643	S	S	*	*			trans	-63.7	130.8	-166.3	26.3	-30.9	0	0	0	111.1	N50 D51	P48-N50 PolarHBondContact O-N 3.46Å; P48-D51 WeakPolarHBondContact CD-OD2 3.44Å; P48-D51 VanDerWaalsContact CG-OD2 3.3Å; P48-D51 WeakPolarHBondContact CG-OD2 3.29Å; P48-D51 WeakPolarHBondContact O-CB 3.39Å; P48-D51 PolarHBondContact O-N 3.32Å
49	R	65.1	Low	69.2	Low	209 Å²	209	119.5 Å²	119.5	79%	0.789	63%	0.627	S	S	*	*	H	α-helix	trans	-46.4	-28.6	-170.6	-174.2	179.7	-71.1	-128.8	0.3	115.4	G47 D51 K52 I53	G47-R49 PolarHBondContact O-N 2.85Å; R49-D51 VanDerWaalsContact C-N 3.3Å; R49-D51 PolarHBondContact O-N 2.97Å; R49-K52 PolarHBondContact O-N 3.08Å; R49-I53 PolarHBondContact O-N 3.32Å
50	N	69.4	Low	70.7	Confident	98 Å²	98	111.6 Å²	111.6	52%	0.524	61%	0.606	S	S	.	*	H	α-helix	trans	-65.5	-33.9	178.9	-152.8	25	0	0	0	112.4	P48 K52 I53 K54	P48-N50 PolarHBondContact O-N 3.46Å; N50-K52 VanDerWaalsContact C-N 3.3Å; N50-K52 PolarHBondContact O-N 3.36Å; N50-I53 PolarHBondContact O-N 3.48Å; N50-K54 WeakPolarHBondContact O-CG 3.46Å; N50-K54 PolarHBondContact O-N 2.82Å
51	D	75.5	Confident	72.1	Confident	92 Å²	92	113.7 Å²	113.7	49%	0.492	60%	0.603	S	S	.	*	H	α-helix	trans	-66.5	-36.8	177.1	-62.1	-19.3	0	0	0	110.6	P48 R49 H55	P48-D51 WeakPolarHBondContact CD-OD2 3.44Å; P48-D51 VanDerWaalsContact CG-OD2 3.3Å; P48-D51 WeakPolarHBondContact CG-OD2 3.29Å; P48-D51 WeakPolarHBondContact O-CB 3.39Å; P48-D51 PolarHBondContact O-N 3.32Å; R49-D51 VanDerWaalsContact C-N 3.3Å; R49-D51 PolarHBondContact O-N 2.97Å; D51-H55 WeakPolarHBondContact O-CB 3.49Å; D51-H55 PolarHBondContact O-N 3.23Å
52	K	77.6	Confident	73.4	Confident	100 Å²	100	113.8 Å²	113.8	44%	0.435	59%	0.592	S	S	.	*	H	α-helix	trans	-64.5	-43.7	176.5	-60	-172.1	178.5	-164.1	0	111.8	R49 N50 H55 V56	R49-K52 PolarHBondContact O-N 3.08Å; N50-K52 VanDerWaalsContact C-N 3.3Å; N50-K52 PolarHBondContact O-N 3.36Å; K52-H55 PolarHBondContact O-N 3.48Å; K52-V56 VanDerWaalsContact O-CG2 3.26Å; K52-V56 WeakPolarHBondContact O-CG2 3.08Å; K52-V56 PolarHBondContact O-N 2.97Å
53	I	79.3	Confident	74.9	Confident	87 Å²	87	112.2 Å²	112.2	45%	0.446	58%	0.577	S	S	.	*	H	α-helix	trans	-67.9	-46.2	179.6	-64.2	176.4	0	0	0	110.6	R49 N50 H55 V56 Q57	R49-I53 PolarHBondContact O-N 3.32Å; N50-I53 PolarHBondContact O-N 3.48Å; I53-H55 VanDerWaalsContact C-N 3.28Å; I53-H55 PolarHBondContact O-N 2.81Å; I53-V56 PolarHBondContact O-N 2.86Å; I53-Q57 WeakPolarHBondContact O-CG 3.38Å; I53-Q57 PolarHBondContact O-N 3.16Å
54	K	81.4	Confident	76.3	Confident	112 Å²	112	113.5 Å²	113.5	49%	0.487	57%	0.568	S	S	.	*	H	α-helix	trans	-60.3	-40.4	175.3	-72	-178.6	178	-174	0	111.9	N50 Q57 N58	N50-K54 WeakPolarHBondContact O-CG 3.46Å; N50-K54 PolarHBondContact O-N 2.82Å; K54-Q57 PolarHBondContact O-N 3.47Å; K54-N58 WeakPolarHBondContact O-CB 3.32Å; K54-N58 VanDerWaalsContact O-CG 3.27Å; K54-N58 PolarHBondContact O-N 2.97Å; K54-N58 PolarHBondContact O-OD1 3.05Å
55	H	81.1	Confident	77.9	Confident	115 Å²	115	112.6 Å²	112.6	53%	0.532	56%	0.556	S	S	.	*	H	α-helix	trans	-63.6	-40.9	176	-174.6	55	0	0	0	111.9	D51 K52 I53 Q59	D51-H55 WeakPolarHBondContact O-CB 3.49Å; D51-H55 PolarHBondContact O-N 3.23Å; K52-H55 PolarHBondContact O-N 3.48Å; I53-H55 VanDerWaalsContact C-N 3.28Å; I53-H55 PolarHBondContact O-N 2.81Å; H55-Q59 PolarHBondContact CD2-NE2 3.23Å; H55-Q59 PolarHBondContact CE1-NE2 2.8Å; H55-Q59 PolarHBondContact NE2-NE2 3.45Å; H55-Q59 WeakPolarHBondContact O-CB 3.21Å; H55-Q59 VanDerWaalsContact O-CG 3.29Å; H55-Q59 WeakPolarHBondContact O-CG 3.48Å; H55-Q59 PolarHBondContact O-N 3.35Å
56	V	82	Confident	79.6	Confident	83 Å²	83	104 Å²	104	50%	0.503	53%	0.531	S	S	.	.	H	α-helix	trans	-66.3	-40.4	174.5	171.9	0	0	0	0	111.6	K52 I53 Q59 V60	K52-V56 VanDerWaalsContact O-CG2 3.26Å; K52-V56 WeakPolarHBondContact O-CG2 3.08Å; K52-V56 PolarHBondContact O-N 2.97Å; I53-V56 PolarHBondContact O-N 2.86Å; V56-Q59 PolarHBondContact O-N 2.81Å; V56-V60 HydrophobicContact CG1-CG2 4.5Å; V56-V60 VanDerWaalsContact O-CG2 3.32Å; V56-V60 WeakPolarHBondContact O-CG2 3.48Å; V56-V60 PolarHBondContact O-N 3.43Å
57	Q	82.1	Confident	81	Confident	114 Å²	114	100 Å²	100	53%	0.533	52%	0.516	S	S	.	.	H	α-helix	trans	-61.9	-48.4	175.7	-73.8	176	-4.8	0	0	111.5	I53 K54 Q59 V60 D61	I53-Q57 WeakPolarHBondContact O-CG 3.38Å; I53-Q57 PolarHBondContact O-N 3.16Å; K54-Q57 PolarHBondContact O-N 3.47Å; Q57-Q59 VanDerWaalsContact C-N 3.3Å; Q57-Q59 PolarHBondContact O-N 3.18Å; Q57-V60 PolarHBondContact O-N 2.93Å; Q57-V60 VanDerWaalsContact O-N 3.1Å; Q57-D61 PolarHBondContact O-N 3.49Å
58	N	86.9	Confident	82.8	Confident	105 Å²	105	104 Å²	104	56%	0.561	52%	0.524	S	S	*	.	H	α-helix	trans	-61.4	-38.2	176.9	-68.6	4.2	0	0	0	112.2	K54 D61 E62	K54-N58 WeakPolarHBondContact O-CB 3.32Å; K54-N58 VanDerWaalsContact O-CG 3.27Å; K54-N58 PolarHBondContact O-N 2.97Å; K54-N58 PolarHBondContact O-OD1 3.05Å; N58-D61 PolarHBondContact O-N 3.01Å; N58-E62 WeakPolarHBondContact O-CB 3.21Å; N58-E62 PolarHBondContact O-N 3.02Å
59	Q	84.1	Confident	84.4	Confident	88 Å²	88	104.5 Å²	104.5	41%	0.411	52%	0.518	S	S	.	.	H	α-helix	trans	-64.8	-39.2	174.6	-79.6	178.9	58.9	0	0	112.1	H55 V56 Q57 V63	H55-Q59 PolarHBondContact CD2-NE2 3.23Å; H55-Q59 PolarHBondContact CE1-NE2 2.8Å; H55-Q59 PolarHBondContact NE2-NE2 3.45Å; H55-Q59 WeakPolarHBondContact O-CB 3.21Å; H55-Q59 VanDerWaalsContact O-CG 3.29Å; H55-Q59 WeakPolarHBondContact O-CG 3.48Å; H55-Q59 PolarHBondContact O-N 3.35Å; V56-Q59 PolarHBondContact O-N 2.81Å; Q57-Q59 VanDerWaalsContact C-N 3.3Å; Q57-Q59 PolarHBondContact O-N 3.18Å; Q59-V63 WeakPolarHBondContact O-CB 3.39Å; Q59-V63 WeakPolarHBondContact O-CG2 3.32Å; Q59-V63 PolarHBondContact O-N 3.01Å
60	V	86.7	Confident	85.8	Confident	75 Å²	75	97.8 Å²	97.8	46%	0.455	50%	0.498	S	S	.	.	H	α-helix	trans	-67.5	-43.3	176.9	170.8	0	0	0	0	110.5	V56 Q57 E62 V63 I64	V56-V60 HydrophobicContact CG1-CG2 4.5Å; V56-V60 VanDerWaalsContact O-CG2 3.32Å; V56-V60 WeakPolarHBondContact O-CG2 3.48Å; V56-V60 PolarHBondContact O-N 3.43Å; Q57-V60 PolarHBondContact O-N 2.93Å; Q57-V60 VanDerWaalsContact O-N 3.1Å; V60-E62 VanDerWaalsContact C-N 3.34Å; V60-E62 PolarHBondContact O-N 3.45Å; V60-V63 PolarHBondContact O-N 3.42Å; V60-I64 HydrophobicContact CG1-CD1 3.69Å; V60-I64 HydrophobicContact CG1-CG1 4.3Å; V60-I64 WeakPolarHBondContact O-CB 3.29Å; V60-I64 WeakPolarHBondContact O-CG1 3.19Å; V60-I64 PolarHBondContact O-N 3.48Å
61	D	90.1	Very high	86.9	Confident	100 Å²	100	97.4 Å²	97.4	54%	0.535	50%	0.495	S	S	.	.	H	α-helix	trans	-61.6	-41.8	176.4	-68.6	-28	0	0	0	111.7	Q57 N58 I64 D65	Q57-D61 PolarHBondContact O-N 3.49Å; N58-D61 PolarHBondContact O-N 3.01Å; D61-I64 PolarHBondContact O-N 3.46Å; D61-D65 PolarHBondContact O-N 2.85Å
62	E	90.6	Very high	87.7	Confident	133 Å²	133	96.9 Å²	96.9	62%	0.621	50%	0.495	S	S	*	.	H	α-helix	trans	-61.7	-44.7	174.1	-176.5	178.2	-177.7	0	0	111.8	N58 V60 I64 D65 V66	N58-E62 WeakPolarHBondContact O-CB 3.21Å; N58-E62 PolarHBondContact O-N 3.02Å; V60-E62 VanDerWaalsContact C-N 3.34Å; V60-E62 PolarHBondContact O-N 3.45Å; E62-I64 VanDerWaalsContact C-N 3.34Å; E62-I64 PolarHBondContact O-N 3.48Å; E62-D65 PolarHBondContact O-N 2.83Å; E62-V66 WeakPolarHBondContact O-CG2 3.37Å; E62-V66 PolarHBondContact O-N 3.43Å
63	V	88.1	Confident	88.4	Confident	91 Å²	91	96.8 Å²	96.8	55%	0.552	50%	0.495	S	S	*	.	H	α-helix	trans	-68.1	-34.2	177.8	173.2	0	0	0	0	111.6	Q59 V60 V66 M67	Q59-V63 WeakPolarHBondContact O-CB 3.39Å; Q59-V63 WeakPolarHBondContact O-CG2 3.32Å; Q59-V63 PolarHBondContact O-N 3.01Å; V60-V63 PolarHBondContact O-N 3.42Å; V63-V66 PolarHBondContact O-N 3.26Å; V63-M67 HydrophobicContact CG1-CG 4.42Å; V63-M67 WeakPolarHBondContact O-CB 3.48Å; V63-M67 VanDerWaalsContact O-CG 3.29Å; V63-M67 WeakPolarHBondContact O-CG 3.42Å; V63-M67 PolarHBondContact O-N 2.86Å
64	I	90.8	Very high	89.1	Confident	94 Å²	94	96.9 Å²	96.9	48%	0.482	50%	0.499	S	S	.	.	H	α-helix	trans	-64.6	-43.9	174.3	-71.3	165.6	0	0	0	110.3	V60 D61 E62 M67 Q68	V60-I64 HydrophobicContact CG1-CD1 3.69Å; V60-I64 HydrophobicContact CG1-CG1 4.3Å; V60-I64 WeakPolarHBondContact O-CB 3.29Å; V60-I64 WeakPolarHBondContact O-CG1 3.19Å; V60-I64 PolarHBondContact O-N 3.48Å; D61-I64 PolarHBondContact O-N 3.46Å; E62-I64 VanDerWaalsContact C-N 3.34Å; E62-I64 PolarHBondContact O-N 3.48Å; I64-M67 PolarHBondContact O-N 3.4Å; I64-Q68 WeakPolarHBondContact O-CB 3.47Å; I64-Q68 PolarHBondContact O-N 3.34Å
65	D	93.3	Very high	89.5	Confident	109 Å²	109	96.8 Å²	96.8	58%	0.583	50%	0.503	S	S	*	.	H	α-helix	trans	-61.5	-46.9	176.4	-169.7	43.6	0	0	0	111.1	D61 E62 M67 Q68 E69	D61-D65 PolarHBondContact O-N 2.85Å; E62-D65 PolarHBondContact O-N 2.83Å; D65-M67 VanDerWaalsContact C-N 3.31Å; D65-M67 PolarHBondContact O-N 3.01Å; D65-Q68 WeakPolarHBondContact O-CB 3.47Å; D65-Q68 PolarHBondContact O-N 2.93Å; D65-Q68 VanDerWaalsContact O-N 3.16Å; D65-E69 PolarHBondContact O-N 3.08Å
66	V	92.4	Very high	90	Very high	65 Å²	65	95.5 Å²	95.5	39%	0.394	50%	0.497	S	S	.	.	H	α-helix	trans	-60.1	-39.7	174.3	172.2	0	0	0	0	111.6	E62 V63 E69 N70	E62-V66 WeakPolarHBondContact O-CG2 3.37Å; E62-V66 PolarHBondContact O-N 3.43Å; V63-V66 PolarHBondContact O-N 3.26Å; V66-E69 PolarHBondContact O-N 3.31Å; V66-N70 WeakPolarHBondContact O-CB 3.36Å; V66-N70 PolarHBondContact O-N 3.5Å; V66-N70 PolarHBondContact O-ND2 2.69Å; V66-N70 PolarHBondContact O-OD1 3.07Å
67	M	90	Very high	90.4	Very high	101 Å²	101	99.6 Å²	99.6	50%	0.498	50%	0.503	S	S	.	.	H	α-helix	trans	-69.8	-36.2	176.4	-78.1	-64.3	-66.7	0	0	112.6	V63 I64 D65 E69 N70 I71	V63-M67 HydrophobicContact CG1-CG 4.42Å; V63-M67 WeakPolarHBondContact O-CB 3.48Å; V63-M67 VanDerWaalsContact O-CG 3.29Å; V63-M67 WeakPolarHBondContact O-CG 3.42Å; V63-M67 PolarHBondContact O-N 2.86Å; I64-M67 PolarHBondContact O-N 3.4Å; D65-M67 VanDerWaalsContact C-N 3.31Å; D65-M67 PolarHBondContact O-N 3.01Å; M67-E69 VanDerWaalsContact C-N 3.33Å; M67-N70 CarbonylContact O-C 3.6Å; M67-N70 PolarHBondContact O-N 3.49Å; M67-I71 WeakPolarHBondContact O-CB 3.46Å; M67-I71 WeakPolarHBondContact O-CD1 3.23Å; M67-I71 WeakPolarHBondContact O-CG1 3.41Å; M67-I71 PolarHBondContact O-N 2.87Å
68	Q	93.4	Very high	90.8	Very high	125 Å²	125	95.4 Å²	95.4	58%	0.584	49%	0.491	S	S	*	.	H	α-helix	trans	-62.8	-43.5	173.6	-174	172	2	0	0	110.4	I64 D65 I71 T72	I64-Q68 WeakPolarHBondContact O-CB 3.47Å; I64-Q68 PolarHBondContact O-N 3.34Å; D65-Q68 WeakPolarHBondContact O-CB 3.47Å; D65-Q68 PolarHBondContact O-N 2.93Å; D65-Q68 VanDerWaalsContact O-N 3.16Å; Q68-I71 PolarHBondContact O-N 2.79Å; Q68-T72 PolarHBondContact O-N 3.49Å; Q68-T72 VanDerWaalsContact O-N 3.08Å; Q68-T72 PolarHBondContact O-OG1 3.27Å
69	E	93.4	Very high	91	Very high	98 Å²	98	96.4 Å²	96.4	46%	0.458	49%	0.492	S	S	.	.	H	α-helix	trans	-64.6	-38.3	172.5	-159.8	-160	175.3	0	0	112	D65 V66 M67 I71 T72 K73	D65-E69 PolarHBondContact O-N 3.08Å; V66-E69 PolarHBondContact O-N 3.31Å; M67-E69 VanDerWaalsContact C-N 3.33Å; E69-I71 VanDerWaalsContact C-N 3.33Å; E69-I71 PolarHBondContact O-N 3.13Å; E69-T72 PolarHBondContact O-N 3.11Å; E69-T72 PolarHBondContact O-OG1 3.33Å; E69-K73 HydrophobicContact CG-CD 4.45Å; E69-K73 WeakPolarHBondContact O-CB 3.35Å; E69-K73 VanDerWaalsContact O-CG 3.23Å; E69-K73 WeakPolarHBondContact O-CG 3.29Å; E69-K73 PolarHBondContact O-N 3.01Å; E69-K73 WeakPolarHBondContact OE1-CE 3.44Å; E69-K73 IonicContact OE1-NZ 3.01Å; E69-K73 PolarHBondContact OE1-NZ 3.33Å; E69-K73 IonicContact OE2-NZ 3.83Å; E69-K73 PolarHBondContact OE2-NZ 3.15Å
70	N	93	Very high	91.3	Very high	68 Å²	68	99.6 Å²	99.6	36%	0.364	50%	0.5	S	S	.	.	H	α-helix	trans	-66.5	-35.6	175.5	-70.6	-25.8	0	0	0	111.9	V66 M67 K73 V74	V66-N70 WeakPolarHBondContact O-CB 3.36Å; V66-N70 PolarHBondContact O-N 3.5Å; V66-N70 PolarHBondContact O-ND2 2.69Å; V66-N70 PolarHBondContact O-OD1 3.07Å; M67-N70 CarbonylContact O-C 3.6Å; M67-N70 PolarHBondContact O-N 3.49Å; N70-K73 PolarHBondContact O-N 2.73Å; N70-V74 WeakPolarHBondContact O-CB 3.11Å; N70-V74 PolarHBondContact O-N 2.67Å
71	I	93	Very high	91.6	Very high	90 Å²	90	100.2 Å²	100.2	46%	0.462	50%	0.5	S	S	.	.	H	α-helix	trans	-68.6	-42.6	177.2	-70.3	161.5	0	0	0	110.4	M67 Q68 E69 K73 V74 I75	M67-I71 WeakPolarHBondContact O-CB 3.46Å; M67-I71 WeakPolarHBondContact O-CD1 3.23Å; M67-I71 WeakPolarHBondContact O-CG1 3.41Å; M67-I71 PolarHBondContact O-N 2.87Å; Q68-I71 PolarHBondContact O-N 2.79Å; E69-I71 VanDerWaalsContact C-N 3.33Å; E69-I71 PolarHBondContact O-N 3.13Å; I71-K73 VanDerWaalsContact C-N 3.32Å; I71-K73 PolarHBondContact O-N 2.96Å; I71-V74 WeakPolarHBondContact O-CG1 3.3Å; I71-V74 PolarHBondContact O-N 3.41Å; I71-I75 HydrophobicContact CG2-CD1 3.9Å; I71-I75 VanDerWaalsContact O-CG1 3.29Å; I71-I75 WeakPolarHBondContact O-CG1 3.2Å; I71-I75 PolarHBondContact O-N 3.39Å
72	T	92.3	Very high	91.7	Very high	82 Å²	82	100.2 Å²	100.2	50%	0.503	50%	0.5	S	S	.	.	H	α-helix	trans	-63.1	-41.9	174.9	55	0	0	0	0	111.1	Q68 E69 V74 I75 E76	Q68-T72 PolarHBondContact O-N 3.49Å; Q68-T72 VanDerWaalsContact O-N 3.08Å; Q68-T72 PolarHBondContact O-OG1 3.27Å; E69-T72 PolarHBondContact O-N 3.11Å; E69-T72 PolarHBondContact O-OG1 3.33Å; T72-V74 PolarHBondContact O-N 2.63Å; T72-I75 PolarHBondContact O-N 3Å; T72-E76 PolarHBondContact O-N 3.41Å; T72-E76 VanDerWaalsContact O-N 3.11Å
73	K	92.5	Very high	91.7	Very high	97 Å²	97	98.6 Å²	98.6	42%	0.422	49%	0.493	S	S	.	.	H	α-helix	trans	-62.1	-39.3	173.3	-72.3	169.5	-176.5	163.8	0	112.9	E69 N70 I71 R77	E69-K73 HydrophobicContact CG-CD 4.45Å; E69-K73 WeakPolarHBondContact O-CB 3.35Å; E69-K73 VanDerWaalsContact O-CG 3.23Å; E69-K73 WeakPolarHBondContact O-CG 3.29Å; E69-K73 PolarHBondContact O-N 3.01Å; E69-K73 WeakPolarHBondContact OE1-CE 3.44Å; E69-K73 IonicContact OE1-NZ 3.01Å; E69-K73 PolarHBondContact OE1-NZ 3.33Å; E69-K73 IonicContact OE2-NZ 3.83Å; E69-K73 PolarHBondContact OE2-NZ 3.15Å; N70-K73 PolarHBondContact O-N 2.73Å; I71-K73 VanDerWaalsContact C-N 3.32Å; I71-K73 PolarHBondContact O-N 2.96Å; K73-R77 VanDerWaalsContact O-CB 3.26Å; K73-R77 WeakPolarHBondContact O-CB 3.26Å; K73-R77 PolarHBondContact O-N 3.32Å
74	V	93.2	Very high	91.9	Very high	89 Å²	89	99 Å²	99	54%	0.539	49%	0.492	S	S	.	.	H	α-helix	trans	-72.3	-33.6	-179.2	86.5	0	0	0	0	111.9	N70 I71 T72 R77 G78	N70-V74 WeakPolarHBondContact O-CB 3.11Å; N70-V74 PolarHBondContact O-N 2.67Å; I71-V74 WeakPolarHBondContact O-CG1 3.3Å; I71-V74 PolarHBondContact O-N 3.41Å; T72-V74 PolarHBondContact O-N 2.63Å; V74-R77 PolarHBondContact O-N 3.49Å; V74-G78 PolarHBondContact O-N 2.89Å
75	I	90.8	Very high	92	Very high	111 Å²	111	100.3 Å²	100.3	57%	0.569	50%	0.496	S	S	*	.	H	α-helix	trans	-66.1	-49	174.1	-67.9	165.5	0	0	0	110.2	I71 T72 R77 G78 E79	I71-I75 HydrophobicContact CG2-CD1 3.9Å; I71-I75 VanDerWaalsContact O-CG1 3.29Å; I71-I75 WeakPolarHBondContact O-CG1 3.2Å; I71-I75 PolarHBondContact O-N 3.39Å; T72-I75 PolarHBondContact O-N 3Å; I75-R77 VanDerWaalsContact C-N 3.25Å; I75-R77 PolarHBondContact O-N 3.26Å; I75-G78 WeakPolarHBondContact O-CA 3.36Å; I75-G78 PolarHBondContact O-N 3.34Å; I75-E79 PolarHBondContact O-N 3.2Å
76	E	91.3	Very high	92	Very high	87 Å²	87	99.9 Å²	99.9	41%	0.407	49%	0.493	S	S	.	.	H	α-helix	trans	-60.4	-38	176	-173.6	-175	-176.8	0	0	111.4	T72 R80	T72-E76 PolarHBondContact O-N 3.41Å; T72-E76 VanDerWaalsContact O-N 3.11Å; E76-R80 WeakPolarHBondContact O-CG 3.43Å; E76-R80 PolarHBondContact O-N 3.25Å; E76-R80 VanDerWaalsContact O-N 3.13Å; E76-R80 IonicContact OE1-CZ 2.69Å; E76-R80 IonicContact OE1-NE 3.49Å; E76-R80 IonicContact OE1-NH1 2.63Å; E76-R80 PolarHBondContact OE1-NH1 2.81Å; E76-R80 IonicContact OE1-NH2 3.17Å; E76-R80 PolarHBondContact OE1-NH2 3.09Å
77	R	91.3	Very high	92	Very high	170 Å²	170	102.8 Å²	102.8	64%	0.642	50%	0.501	S	S	*	.	H	α-helix	trans	-65.7	-38.1	173	-174.8	176.3	-179	165.6	0.4	112.1	K73 V74 I75 R80 L81	K73-R77 VanDerWaalsContact O-CB 3.26Å; K73-R77 WeakPolarHBondContact O-CB 3.26Å; K73-R77 PolarHBondContact O-N 3.32Å; V74-R77 PolarHBondContact O-N 3.49Å; I75-R77 VanDerWaalsContact C-N 3.25Å; I75-R77 PolarHBondContact O-N 3.26Å; R77-R80 PolarHBondContact O-N 3.43Å; R77-L81 HydrophobicContact CG-CD1 4Å; R77-L81 HydrophobicContact CG-CG 4.31Å; R77-L81 VanDerWaalsContact O-CB 3.3Å; R77-L81 WeakPolarHBondContact O-CB 3.43Å; R77-L81 WeakPolarHBondContact O-CG 3.22Å; R77-L81 PolarHBondContact O-N 3.3Å
78	G	90.5	Very high	92.2	Very high	26 Å²	26	101 Å²	101	27%	0.268	50%	0.498	S	S	.	.	H	α-helix	trans	-60.4	-50.6	175.9	0	0	0	0	0	111.8	V74 I75 R80 L81 D82	V74-G78 PolarHBondContact O-N 2.89Å; I75-G78 WeakPolarHBondContact O-CA 3.36Å; I75-G78 PolarHBondContact O-N 3.34Å; G78-R80 VanDerWaalsContact C-N 3.35Å; G78-R80 PolarHBondContact O-N 3.38Å; G78-L81 WeakPolarHBondContact O-CB 3.46Å; G78-L81 PolarHBondContact O-N 2.81Å; G78-D82 PolarHBondContact O-N 3.22Å
79	E	91.1	Very high	92.2	Very high	126 Å²	126	100.3 Å²	100.3	59%	0.589	50%	0.495	S	S	*	.	H	α-helix	trans	-58.7	-45.1	176.8	-176.8	176.9	-158.5	0	0	111.9	I75 L81 D82 E83	I75-E79 PolarHBondContact O-N 3.2Å; E79-L81 VanDerWaalsContact C-N 3.31Å; E79-L81 PolarHBondContact O-N 2.76Å; E79-D82 PolarHBondContact O-N 3.44Å; E79-E83 PolarHBondContact O-N 3.06Å
80	R	89.8	Confident	92.1	Very high	155 Å²	155	98.3 Å²	98.3	59%	0.585	49%	0.491	S	S	*	.	H	α-helix	trans	-64.8	-34	175.2	-72.1	178.8	177.1	157.7	5.9	113.1	E76 R77 G78 L84	E76-R80 WeakPolarHBondContact O-CG 3.43Å; E76-R80 PolarHBondContact O-N 3.25Å; E76-R80 VanDerWaalsContact O-N 3.13Å; E76-R80 IonicContact OE1-CZ 2.69Å; E76-R80 IonicContact OE1-NE 3.49Å; E76-R80 IonicContact OE1-NH1 2.63Å; E76-R80 PolarHBondContact OE1-NH1 2.81Å; E76-R80 IonicContact OE1-NH2 3.17Å; E76-R80 PolarHBondContact OE1-NH2 3.09Å; R77-R80 PolarHBondContact O-N 3.43Å; G78-R80 VanDerWaalsContact C-N 3.35Å; G78-R80 PolarHBondContact O-N 3.38Å; R80-L84 WeakPolarHBondContact O-CB 3.19Å; R80-L84 PolarHBondContact O-N 3.01Å
81	L	92.5	Very high	92.1	Very high	87 Å²	87	100.8 Å²	100.8	46%	0.455	50%	0.504	S	S	.	.	H	α-helix	trans	-70.7	-40.5	176.5	-80.7	171.5	0	0	0	111.1	R77 G78 E79 L84 Q85	R77-L81 HydrophobicContact CG-CD1 4Å; R77-L81 HydrophobicContact CG-CG 4.31Å; R77-L81 VanDerWaalsContact O-CB 3.3Å; R77-L81 WeakPolarHBondContact O-CB 3.43Å; R77-L81 WeakPolarHBondContact O-CG 3.22Å; R77-L81 PolarHBondContact O-N 3.3Å; G78-L81 WeakPolarHBondContact O-CB 3.46Å; G78-L81 PolarHBondContact O-N 2.81Å; E79-L81 VanDerWaalsContact C-N 3.31Å; E79-L81 PolarHBondContact O-N 2.76Å; L81-L84 CarbonylContact O-C 3.57Å; L81-L84 PolarHBondContact O-N 2.88Å; L81-Q85 VanDerWaalsContact O-CB 3.22Å; L81-Q85 WeakPolarHBondContact O-CB 3.4Å; L81-Q85 PolarHBondContact O-N 2.92Å
82	D	91.8	Very high	92.1	Very high	100 Å²	100	99.6 Å²	99.6	54%	0.535	50%	0.504	S	S	.	.	H	α-helix	trans	-62.7	-47.7	175.1	-74.2	-16.6	0	0	0	110.4	G78 E79 L84 Q85 D86	G78-D82 PolarHBondContact O-N 3.22Å; E79-D82 PolarHBondContact O-N 3.44Å; D82-L84 VanDerWaalsContact C-N 3.29Å; D82-L84 PolarHBondContact O-N 2.92Å; D82-Q85 WeakPolarHBondContact O-CB 3.17Å; D82-Q85 PolarHBondContact O-N 2.93Å; D82-Q85 VanDerWaalsContact O-N 3.15Å; D82-D86 PolarHBondContact O-N 3.01Å
83	E	92.3	Very high	92.1	Very high	100 Å²	100	100 Å²	100	47%	0.467	50%	0.503	S	S	.	.	H	α-helix	trans	-59.8	-40	173.8	-73.9	-169.4	-173.5	0	0	112.8	E79 Q85 K87	E79-E83 PolarHBondContact O-N 3.06Å; E83-Q85 VanDerWaalsContact C-N 3.34Å; E83-K87 WeakPolarHBondContact O-CB 3.49Å; E83-K87 VanDerWaalsContact O-CG 3.31Å; E83-K87 WeakPolarHBondContact O-CG 3.23Å; E83-K87 PolarHBondContact O-N 3.3Å; E83-K87 IonicContact OE2-NZ 3.96Å
84	L	91	Very high	92.1	Very high	100 Å²	100	100.5 Å²	100.5	52%	0.524	51%	0.51	S	S	.	.	H	α-helix	trans	-70.2	-34.9	178.4	-174.3	64.1	0	0	0	111	R80 L81 D82 K87 S88	R80-L84 WeakPolarHBondContact O-CB 3.19Å; R80-L84 PolarHBondContact O-N 3.01Å; L81-L84 CarbonylContact O-C 3.57Å; L81-L84 PolarHBondContact O-N 2.88Å; D82-L84 VanDerWaalsContact C-N 3.29Å; D82-L84 PolarHBondContact O-N 2.92Å; L84-K87 PolarHBondContact O-N 2.81Å; L84-S88 WeakPolarHBondContact O-CB 3.17Å; L84-S88 PolarHBondContact O-N 3.29Å; L84-S88 PolarHBondContact O-OG 2.86Å
85	Q	93	Very high	92	Very high	121 Å²	121	98.9 Å²	98.9	57%	0.565	51%	0.506	S	S	*	.	H	α-helix	trans	-65.4	-48.2	175.3	-177.7	175.5	-53.1	0	0	109.9	L81 D82 E83 K87 S88 E89	L81-Q85 VanDerWaalsContact O-CB 3.22Å; L81-Q85 WeakPolarHBondContact O-CB 3.4Å; L81-Q85 PolarHBondContact O-N 2.92Å; D82-Q85 WeakPolarHBondContact O-CB 3.17Å; D82-Q85 PolarHBondContact O-N 2.93Å; D82-Q85 VanDerWaalsContact O-N 3.15Å; E83-Q85 VanDerWaalsContact C-N 3.34Å; Q85-K87 VanDerWaalsContact C-N 3.32Å; Q85-K87 PolarHBondContact O-N 2.83Å; Q85-S88 CarbonylContact O-C 3.59Å; Q85-S88 PolarHBondContact O-N 3.34Å; Q85-E89 WeakPolarHBondContact O-CB 3.11Å; Q85-E89 PolarHBondContact O-N 2.78Å
86	D	93.5	Very high	91.9	Very high	100 Å²	100	96.8 Å²	96.8	54%	0.535	50%	0.499	S	S	.	.	H	α-helix	trans	-59.4	-42.9	175.5	-72.3	-10.9	0	0	0	111.7	D82 S88 S90	D82-D86 PolarHBondContact O-N 3.01Å; D86-S88 VanDerWaalsContact C-N 3.35Å; D86-S90 WeakPolarHBondContact O-CB 3.5Å; D86-S90 PolarHBondContact O-N 3.27Å; D86-S90 PolarHBondContact O-OG 3.44Å
87	K	92.5	Very high	91.8	Very high	126 Å²	126	94.7 Å²	94.7	55%	0.548	50%	0.496	S	S	.	.	H	α-helix	trans	-65.8	-37	174.3	-76	172.2	-174.8	160.8	0	112.2	E83 L84 Q85 S90 L91	E83-K87 WeakPolarHBondContact O-CB 3.49Å; E83-K87 VanDerWaalsContact O-CG 3.31Å; E83-K87 WeakPolarHBondContact O-CG 3.23Å; E83-K87 PolarHBondContact O-N 3.3Å; E83-K87 IonicContact OE2-NZ 3.96Å; L84-K87 PolarHBondContact O-N 2.81Å; Q85-K87 VanDerWaalsContact C-N 3.32Å; Q85-K87 PolarHBondContact O-N 2.83Å; K87-S90 WeakPolarHBondContact CA-OG 3.2Å; K87-S90 PolarHBondContact O-OG 2.9Å; K87-L91 WeakPolarHBondContact O-CB 3.43Å; K87-L91 PolarHBondContact O-N 2.96Å
88	S	93.8	Very high	91.7	Very high	62 Å²	62	93.6 Å²	93.6	43%	0.434	50%	0.496	S	S	.	.	H	α-helix	trans	-74.1	-38.3	179.9	-62.3	0	0	0	0	111.8	L84 Q85 D86 L91 S92	L84-S88 WeakPolarHBondContact O-CB 3.17Å; L84-S88 PolarHBondContact O-N 3.29Å; L84-S88 PolarHBondContact O-OG 2.86Å; Q85-S88 CarbonylContact O-C 3.59Å; Q85-S88 PolarHBondContact O-N 3.34Å; D86-S88 VanDerWaalsContact C-N 3.35Å; S88-L91 PolarHBondContact O-N 3.25Å; S88-S92 VanDerWaalsContact O-CB 3.23Å; S88-S92 WeakPolarHBondContact O-CB 3.33Å; S88-S92 PolarHBondContact O-N 2.78Å
89	E	93.9	Very high	91.6	Very high	111 Å²	111	94.6 Å²	94.6	52%	0.519	50%	0.499	S	S	.	.	H	α-helix	trans	-64.5	-52.3	173.3	-177.2	169.6	-156.2	0	0	109.9	Q85 L91 S92 D93	Q85-E89 WeakPolarHBondContact O-CB 3.11Å; Q85-E89 PolarHBondContact O-N 2.78Å; E89-L91 VanDerWaalsContact C-N 3.27Å; E89-L91 PolarHBondContact O-N 3.45Å; E89-S92 WeakPolarHBondContact O-CB 3.36Å; E89-S92 PolarHBondContact O-N 3.43Å; E89-S92 VanDerWaalsContact O-N 3.09Å; E89-D93 WeakPolarHBondContact O-CB 3.31Å; E89-D93 PolarHBondContact O-N 2.94Å
90	S	92.1	Very high	91.4	Very high	56 Å²	56	92.7 Å²	92.7	39%	0.392	49%	0.493	S	S	.	.	H	α-helix	trans	-60.7	-35.8	175.6	60	0	0	0	0	112.6	D86 K87 N94	D86-S90 WeakPolarHBondContact O-CB 3.5Å; D86-S90 PolarHBondContact O-N 3.27Å; D86-S90 PolarHBondContact O-OG 3.44Å; K87-S90 WeakPolarHBondContact CA-OG 3.2Å; K87-S90 PolarHBondContact O-OG 2.9Å; S90-N94 WeakPolarHBondContact O-CB 3.43Å; S90-N94 PolarHBondContact O-N 3.45Å; S90-N94 PolarHBondContact O-ND2 2.87Å
91	L	92.4	Very high	91.1	Very high	120 Å²	120	93.4 Å²	93.4	63%	0.628	50%	0.496	S	S	*	.	H	α-helix	trans	-67.5	-42.6	173.6	-177.9	62.1	0	0	0	111.9	K87 S88 E89 N94 A95	K87-L91 WeakPolarHBondContact O-CB 3.43Å; K87-L91 PolarHBondContact O-N 2.96Å; S88-L91 PolarHBondContact O-N 3.25Å; E89-L91 VanDerWaalsContact C-N 3.27Å; E89-L91 PolarHBondContact O-N 3.45Å; L91-N94 PolarHBondContact O-N 3.48Å; L91-A95 WeakPolarHBondContact O-CB 3.42Å; L91-A95 PolarHBondContact O-N 3.48Å
92	S	92.9	Very high	90.9	Very high	65 Å²	65	91.4 Å²	91.4	46%	0.455	49%	0.489	S	S	.	.	H	α-helix	trans	-63	-46.3	176.7	178	0	0	0	0	111.3	S88 E89 A95 T96	S88-S92 VanDerWaalsContact O-CB 3.23Å; S88-S92 WeakPolarHBondContact O-CB 3.33Å; S88-S92 PolarHBondContact O-N 2.78Å; E89-S92 WeakPolarHBondContact O-CB 3.36Å; E89-S92 PolarHBondContact O-N 3.43Å; E89-S92 VanDerWaalsContact O-N 3.09Å; S92-A95 PolarHBondContact O-N 2.79Å; S92-T96 WeakPolarHBondContact O-CB 3.47Å; S92-T96 WeakPolarHBondContact O-CG2 3.12Å; S92-T96 PolarHBondContact O-N 2.82Å; S92-T96 PolarHBondContact O-OG1 2.76Å
93	D	92.7	Very high	90.6	Very high	90 Å²	90	93.5 Å²	93.5	48%	0.481	49%	0.493	S	S	.	.	H	α-helix	trans	-63	-44.1	176.1	-77.9	-5.3	0	0	0	111.4	E89 A95 T96 A97	E89-D93 WeakPolarHBondContact O-CB 3.31Å; E89-D93 PolarHBondContact O-N 2.94Å; D93-A95 VanDerWaalsContact C-N 3.34Å; D93-A95 PolarHBondContact O-N 3.19Å; D93-T96 WeakPolarHBondContact CA-OG1 3.3Å; D93-T96 PolarHBondContact O-N 3.28Å; D93-T96 PolarHBondContact O-OG1 3.46Å; D93-A97 WeakPolarHBondContact O-CB 3.14Å; D93-A97 PolarHBondContact O-N 3.29Å
94	N	91	Very high	90.3	Very high	108 Å²	108	94.2 Å²	94.2	58%	0.578	50%	0.496	S	S	*	.	H	α-helix	trans	-65.4	-37.5	174.5	-76.8	-42.2	0	0	0	112.1	S90 L91 F98	S90-N94 WeakPolarHBondContact O-CB 3.43Å; S90-N94 PolarHBondContact O-N 3.45Å; S90-N94 PolarHBondContact O-ND2 2.87Å; L91-N94 PolarHBondContact O-N 3.48Å; N94-F98 WeakPolarHBondContact O-CA 3.4Å; N94-F98 WeakPolarHBondContact O-CB 3.36Å; N94-F98 PolarHBondContact O-N 3.36Å
95	A	91.1	Very high	90.1	Very high	55 Å²	55	93.1 Å²	93.1	46%	0.455	49%	0.491	S	S	.	.	H	α-helix	trans	-67.9	-42.9	177.3	0	0	0	0	0	111.6	L91 S92 D93 F98 S99	L91-A95 WeakPolarHBondContact O-CB 3.42Å; L91-A95 PolarHBondContact O-N 3.48Å; S92-A95 PolarHBondContact O-N 2.79Å; D93-A95 VanDerWaalsContact C-N 3.34Å; D93-A95 PolarHBondContact O-N 3.19Å; A95-F98 PolarHBondContact O-N 3.41Å; A95-S99 WeakPolarHBondContact O-CB 3.11Å; A95-S99 PolarHBondContact O-N 2.9Å
96	T	90	Very high	89.8	Confident	68 Å²	68	97.4 Å²	97.4	42%	0.417	50%	0.502	S	S	.	.	H	α-helix	trans	-67.5	-44.8	176.5	63.1	0	0	0	0	110.6	S92 D93 S99 N100	S92-T96 WeakPolarHBondContact O-CB 3.47Å; S92-T96 WeakPolarHBondContact O-CG2 3.12Å; S92-T96 PolarHBondContact O-N 2.82Å; S92-T96 PolarHBondContact O-OG1 2.76Å; D93-T96 WeakPolarHBondContact CA-OG1 3.3Å; D93-T96 PolarHBondContact O-N 3.28Å; D93-T96 PolarHBondContact O-OG1 3.46Å; T96-S99 PolarHBondContact O-N 3.49Å; T96-S99 PolarHBondContact O-OG 3.25Å; T96-N100 WeakPolarHBondContact O-CB 3.19Å; T96-N100 PolarHBondContact O-N 3.3Å
97	A	89.1	Confident	89.5	Confident	42 Å²	42	101.3 Å²	101.3	35%	0.347	51%	0.509	S	S	.	.	H	α-helix	trans	-59.6	-47	173.2	0	0	0	0	0	111.1	D93 S99 N100 R101	D93-A97 WeakPolarHBondContact O-CB 3.14Å; D93-A97 PolarHBondContact O-N 3.29Å; A97-S99 PolarHBondContact O-N 2.74Å; A97-N100 PolarHBondContact O-N 3.04Å; A97-R101 VanDerWaalsContact O-CB 3.3Å; A97-R101 WeakPolarHBondContact O-CB 3.5Å; A97-R101 WeakPolarHBondContact O-CG 3.35Å; A97-R101 PolarHBondContact O-N 3.47Å
98	F	89.7	Confident	89.3	Confident	148 Å²	148	99.8 Å²	99.8	65%	0.649	50%	0.504	S	S	*	.	H	α-helix	trans	-58.1	-47.8	175.7	-178.5	-100.6	0	0	0	110.7	N94 A95 N100 R101 S102	N94-F98 WeakPolarHBondContact O-CA 3.4Å; N94-F98 WeakPolarHBondContact O-CB 3.36Å; N94-F98 PolarHBondContact O-N 3.36Å; A95-F98 PolarHBondContact O-N 3.41Å; F98-N100 VanDerWaalsContact C-N 3.32Å; F98-N100 PolarHBondContact O-N 2.75Å; F98-R101 CarbonylContact O-C 3.56Å; F98-R101 PolarHBondContact O-N 3.09Å; F98-S102 WeakPolarHBondContact O-CB 3.15Å; F98-S102 PolarHBondContact O-N 2.74Å; F98-S102 PolarHBondContact O-OG 3.03Å
99	S	87.1	Confident	89.1	Confident	47 Å²	47	102.2 Å²	102.2	33%	0.329	51%	0.51	S	S	.	.	H	α-helix	trans	-59.7	-41.7	178.2	83.4	0	0	0	0	112.6	A95 T96 A97 S102 K103	A95-S99 WeakPolarHBondContact O-CB 3.11Å; A95-S99 PolarHBondContact O-N 2.9Å; T96-S99 PolarHBondContact O-N 3.49Å; T96-S99 PolarHBondContact O-OG 3.25Å; A97-S99 PolarHBondContact O-N 2.74Å; S99-S102 PolarHBondContact O-N 3.1Å; S99-K103 WeakPolarHBondContact O-CG 2.97Å; S99-K103 PolarHBondContact O-N 3.41Å; S99-K103 VanDerWaalsContact O-N 3.09Å
100	N	88	Confident	88.9	Confident	85 Å²	85	105.4 Å²	105.4	46%	0.455	52%	0.517	S	S	.	.	H	α-helix	trans	-68.9	-43.8	178.3	-75	-15.9	0	0	0	111.1	T96 A97 F98 K103 Q104	T96-N100 WeakPolarHBondContact O-CB 3.19Å; T96-N100 PolarHBondContact O-N 3.3Å; A97-N100 PolarHBondContact O-N 3.04Å; F98-N100 VanDerWaalsContact C-N 3.32Å; F98-N100 PolarHBondContact O-N 2.75Å; N100-K103 PolarHBondContact O-N 3.2Å; N100-Q104 WeakPolarHBondContact O-CG 3.44Å; N100-Q104 PolarHBondContact O-N 3.48Å
101	R	83.7	Confident	88.9	Confident	171 Å²	171	109.4 Å²	109.4	65%	0.645	52%	0.524	S	S	*	.	H	α-helix	trans	-64.3	-40.7	175.2	-67.1	-67.2	-174.1	-150.3	2.1	111.3	A97 F98 K103 Q104 L105	A97-R101 VanDerWaalsContact O-CB 3.3Å; A97-R101 WeakPolarHBondContact O-CB 3.5Å; A97-R101 WeakPolarHBondContact O-CG 3.35Å; A97-R101 PolarHBondContact O-N 3.47Å; F98-R101 CarbonylContact O-C 3.56Å; F98-R101 PolarHBondContact O-N 3.09Å; R101-K103 PolarHBondContact O-N 3.14Å; R101-Q104 PolarHBondContact O-N 3.45Å; R101-L105 WeakPolarHBondContact O-CB 3.39Å; R101-L105 PolarHBondContact O-N 3.11Å
102	S	86.7	Confident	88.9	Confident	44 Å²	44	110.1 Å²	110.1	31%	0.308	52%	0.518	S	S	.	.	H	α-helix	trans	-62.6	-40.4	176.1	-61.1	0	0	0	0	112	F98 S99 L105 R106	F98-S102 WeakPolarHBondContact O-CB 3.15Å; F98-S102 PolarHBondContact O-N 2.74Å; F98-S102 PolarHBondContact O-OG 3.03Å; S99-S102 PolarHBondContact O-N 3.1Å; S102-L105 PolarHBondContact O-N 3.21Å; S102-R106 PolarHBondContact O-N 2.85Å
103	K	86.6	Confident	88.9	Confident	145 Å²	145	108.7 Å²	108.7	63%	0.63	51%	0.514	S	S	*	.	H	α-helix	trans	-63.1	-47	174.2	-72.5	170.4	-174.9	167.9	0	111.5	S99 N100 R101 R106 R107	S99-K103 WeakPolarHBondContact O-CG 2.97Å; S99-K103 PolarHBondContact O-N 3.41Å; S99-K103 VanDerWaalsContact O-N 3.09Å; N100-K103 PolarHBondContact O-N 3.2Å; R101-K103 PolarHBondContact O-N 3.14Å; K103-R106 PolarHBondContact O-N 3.48Å; K103-R107 PolarHBondContact O-N 2.97Å
104	Q	86.5	Confident	88.9	Confident	114 Å²	114	107.6 Å²	107.6	53%	0.533	51%	0.512	S	S	.	.	H	α-helix	trans	-63.9	-42	176.9	-70.9	176.5	-15	0	0	111.7	N100 R101 R106 R107 Q108	N100-Q104 WeakPolarHBondContact O-CG 3.44Å; N100-Q104 PolarHBondContact O-N 3.48Å; R101-Q104 PolarHBondContact O-N 3.45Å; Q104-R106 PolarHBondContact O-N 3.04Å; Q104-R107 PolarHBondContact O-N 2.98Å; Q104-Q108 WeakPolarHBondContact O-CB 3.49Å; Q104-Q108 PolarHBondContact O-N 2.92Å
105	L	85.8	Confident	89.1	Confident	78 Å²	78	108.9 Å²	108.9	41%	0.408	51%	0.513	S	S	.	.	H	α-helix	trans	-61.5	-43.4	178.7	-175.6	64.6	0	0	0	111.2	R101 S102 R107 Q108 M109	R101-L105 WeakPolarHBondContact O-CB 3.39Å; R101-L105 PolarHBondContact O-N 3.11Å; S102-L105 PolarHBondContact O-N 3.21Å; L105-R107 VanDerWaalsContact C-N 3.33Å; L105-R107 PolarHBondContact O-N 3.2Å; L105-Q108 PolarHBondContact O-N 3.12Å; L105-M109 HydrophobicContact CD1-CE 4.12Å; L105-M109 HydrophobicContact CD1-CG 4.46Å; L105-M109 HydrophobicContact CD2-CE 4.23Å; L105-M109 HydrophobicContact CG-CE 4.07Å; L105-M109 HydrophobicContact CG-CG 4.5Å; L105-M109 HydrophobicContact CG-SD 4.39Å; L105-M109 WeakPolarHBondContact O-CB 3.34Å; L105-M109 WeakPolarHBondContact O-CG 3.4Å; L105-M109 PolarHBondContact O-N 3.27Å
106	R	86.5	Confident	89.3	Confident	211 Å²	211	111.5 Å²	111.5	80%	0.796	52%	0.518	S	S	*	.	H	α-helix	trans	-57.4	-46.6	174.8	-177.2	177.4	177.7	177.6	-0.4	111.4	S102 K103 Q104 M109 W110	S102-R106 PolarHBondContact O-N 2.85Å; K103-R106 PolarHBondContact O-N 3.48Å; Q104-R106 PolarHBondContact O-N 3.04Å; R106-M109 PolarHBondContact O-N 3.37Å; R106-W110 PolarHBondContact O-N 2.82Å; R106-W110 VanDerWaalsContact O-N 3.14Å
107	R	88.3	Confident	89.6	Confident	181 Å²	181	115.8 Å²	115.8	68%	0.683	53%	0.531	S	S	*	.	H	α-helix	trans	-64.9	-47	178.1	-168.4	142.1	87.8	179	6.5	110.6	K103 Q104 L105 M109 W110 W111	K103-R107 PolarHBondContact O-N 2.97Å; Q104-R107 PolarHBondContact O-N 2.98Å; L105-R107 VanDerWaalsContact C-N 3.33Å; L105-R107 PolarHBondContact O-N 3.2Å; R107-M109 VanDerWaalsContact C-N 3.32Å; R107-M109 PolarHBondContact O-N 2.89Å; R107-W110 WeakPolarHBondContact O-CB 3.45Å; R107-W110 PolarHBondContact O-N 2.9Å; R107-W110 VanDerWaalsContact O-N 3.14Å; R107-W111 PolarHBondContact O-N 3.05Å
108	Q	87.2	Confident	89.9	Confident	94 Å²	94	116.5 Å²	116.5	44%	0.439	54%	0.537	S	S	.	.	H	α-helix	trans	-60	-40.5	179.2	-166.2	-177.8	14.9	0	0	112.3	Q104 L105 W111 R112	Q104-Q108 WeakPolarHBondContact O-CB 3.49Å; Q104-Q108 PolarHBondContact O-N 2.92Å; L105-Q108 PolarHBondContact O-N 3.12Å; Q108-W111 PolarHBondContact O-N 3.32Å; Q108-R112 WeakPolarHBondContact O-CB 3.26Å; Q108-R112 VanDerWaalsContact O-CG 3.26Å; Q108-R112 WeakPolarHBondContact O-CG 3.43Å; Q108-R112 PolarHBondContact O-N 3.33Å
109	M	89.7	Confident	90.3	Very high	113 Å²	113	114.7 Å²	114.7	56%	0.557	53%	0.533	S	S	*	.	H	α-helix	trans	-62.6	-41.5	175	-77.5	-175.5	170.4	0	0	112	L105 R106 R107 R112 G113	L105-M109 HydrophobicContact CD1-CE 4.12Å; L105-M109 HydrophobicContact CD1-CG 4.46Å; L105-M109 HydrophobicContact CD2-CE 4.23Å; L105-M109 HydrophobicContact CG-CE 4.07Å; L105-M109 HydrophobicContact CG-CG 4.5Å; L105-M109 HydrophobicContact CG-SD 4.39Å; L105-M109 WeakPolarHBondContact O-CB 3.34Å; L105-M109 WeakPolarHBondContact O-CG 3.4Å; L105-M109 PolarHBondContact O-N 3.27Å; R106-M109 PolarHBondContact O-N 3.37Å; R107-M109 VanDerWaalsContact C-N 3.32Å; R107-M109 PolarHBondContact O-N 2.89Å; M109-R112 PolarHBondContact O-N 2.91Å; M109-G113 PolarHBondContact O-N 3.14Å
110	W	90.7	Very high	90.7	Very high	179 Å²	179	118.3 Å²	118.3	68%	0.678	55%	0.546	S	S	*	.	H	α-helix	trans	-63	-45	176.5	-170.7	70.2	0	0	0	112.1	R106 R107 R112 G113 C114	R106-W110 PolarHBondContact O-N 2.82Å; R106-W110 VanDerWaalsContact O-N 3.14Å; R107-W110 WeakPolarHBondContact O-CB 3.45Å; R107-W110 PolarHBondContact O-N 2.9Å; R107-W110 VanDerWaalsContact O-N 3.14Å; W110-R112 PolarHBondContact O-N 2.92Å; W110-G113 PolarHBondContact O-N 3.38Å; W110-C114 WeakPolarHBondContact O-CB 3.36Å; W110-C114 PolarHBondContact O-N 3.49Å
111	W	91.9	Very high	91.2	Very high	139 Å²	139	117.2 Å²	117.2	53%	0.527	55%	0.549	S	S	.	.	H	α-helix	trans	-62.6	-41.6	174.4	-74.1	105.1	0	0	0	112.5	R107 Q108 C114 K115	R107-W111 PolarHBondContact O-N 3.05Å; Q108-W111 PolarHBondContact O-N 3.32Å; W111-C114 PolarHBondContact O-N 2.9Å; W111-K115 WeakPolarHBondContact O-CB 3.27Å; W111-K115 VanDerWaalsContact O-CG 3.27Å; W111-K115 WeakPolarHBondContact O-CG 3.46Å; W111-K115 PolarHBondContact O-N 3.4Å
112	R	91.7	Very high	91.8	Very high	135 Å²	135	114.3 Å²	114.3	51%	0.509	55%	0.546	S	S	.	.	H	α-helix	trans	-60.9	-46.1	175.7	-74.5	175.3	-174.1	-168.2	5.5	111.2	Q108 M109 W110 K115 I116	Q108-R112 WeakPolarHBondContact O-CB 3.26Å; Q108-R112 VanDerWaalsContact O-CG 3.26Å; Q108-R112 WeakPolarHBondContact O-CG 3.43Å; Q108-R112 PolarHBondContact O-N 3.33Å; M109-R112 PolarHBondContact O-N 2.91Å; W110-R112 PolarHBondContact O-N 2.92Å; R112-K115 PolarHBondContact O-N 3.35Å; R112-I116 WeakPolarHBondContact O-CG1 3.43Å; R112-I116 PolarHBondContact O-N 2.99Å
113	G	92.4	Very high	92.3	Very high	35 Å²	35	115.7 Å²	115.7	36%	0.361	55%	0.552	S	S	.	*	H	α-helix	trans	-60.6	-45.4	175.8	0	0	0	0	0	112.5	M109 W110 K115 I116 K117	M109-G113 PolarHBondContact O-N 3.14Å; W110-G113 PolarHBondContact O-N 3.38Å; G113-K115 PolarHBondContact O-N 2.9Å; G113-I116 PolarHBondContact O-N 3.01Å; G113-K117 WeakPolarHBondContact O-CG 3.36Å; G113-K117 PolarHBondContact O-N 3.36Å
114	C	93.9	Very high	92.9	Very high	67 Å²	67	111 Å²	111	45%	0.453	54%	0.541	S	S	.	.	H	α-helix	trans	-61.9	-42.3	176.9	-168.5	0	0	0	0	112.3	W110 W111 K117 A118	W110-C114 WeakPolarHBondContact O-CB 3.36Å; W110-C114 PolarHBondContact O-N 3.49Å; W111-C114 PolarHBondContact O-N 2.9Å; C114-K117 PolarHBondContact O-N 3.06Å; C114-A118 WeakPolarHBondContact O-CB 3.32Å; C114-A118 PolarHBondContact O-N 3.48Å
115	K	95.4	Very high	93.4	Very high	135 Å²	135	107.8 Å²	107.8	59%	0.587	53%	0.533	S	S	*	.	H	α-helix	trans	-60.7	-46.8	175.9	-75.7	175.5	178.3	-173.3	0	111.9	W111 R112 G113 K117 A118 I119	W111-K115 WeakPolarHBondContact O-CB 3.27Å; W111-K115 VanDerWaalsContact O-CG 3.27Å; W111-K115 WeakPolarHBondContact O-CG 3.46Å; W111-K115 PolarHBondContact O-N 3.4Å; R112-K115 PolarHBondContact O-N 3.35Å; G113-K115 PolarHBondContact O-N 2.9Å; K115-K117 VanDerWaalsContact C-N 3.33Å; K115-K117 PolarHBondContact O-N 3.3Å; K115-A118 PolarHBondContact O-N 2.99Å; K115-I119 WeakPolarHBondContact O-CG1 3.45Å; K115-I119 PolarHBondContact O-N 3.33Å
116	I	95	Very high	93.9	Very high	110 Å²	110	108.4 Å²	108.4	56%	0.564	54%	0.536	S	S	*	.	H	α-helix	trans	-61.4	-43.8	177.4	-69.2	170.7	0	0	0	110.6	R112 G113 A118 I119 M120	R112-I116 WeakPolarHBondContact O-CG1 3.43Å; R112-I116 PolarHBondContact O-N 2.99Å; G113-I116 PolarHBondContact O-N 3.01Å; I116-A118 PolarHBondContact O-N 3.42Å; I116-I119 PolarHBondContact O-N 3.39Å; I116-M120 WeakPolarHBondContact O-CG 3.41Å; I116-M120 PolarHBondContact O-N 3.47Å
117	K	95.4	Very high	94.4	Very high	158 Å²	158	103.3 Å²	103.3	69%	0.687	52%	0.524	S	S	*	.	H	α-helix	trans	-62.2	-40.4	176.5	-70.7	-68.8	-171	175.6	0	112.5	G113 C114 K115 M120 A121	G113-K117 WeakPolarHBondContact O-CG 3.36Å; G113-K117 PolarHBondContact O-N 3.36Å; C114-K117 PolarHBondContact O-N 3.06Å; K115-K117 VanDerWaalsContact C-N 3.33Å; K115-K117 PolarHBondContact O-N 3.3Å; K117-M120 PolarHBondContact O-N 3.26Å; K117-A121 PolarHBondContact O-N 3.21Å
118	A	96.9	Very high	94.8	Very high	58 Å²	58	99.7 Å²	99.7	48%	0.479	52%	0.518	S	S	.	.	H	α-helix	trans	-64.4	-43.7	176.8	0	0	0	0	0	112.3	C114 K115 I116 A121 L122	C114-A118 WeakPolarHBondContact O-CB 3.32Å; C114-A118 PolarHBondContact O-N 3.48Å; K115-A118 PolarHBondContact O-N 2.99Å; I116-A118 PolarHBondContact O-N 3.42Å; A118-A121 PolarHBondContact O-N 3Å; A118-L122 PolarHBondContact O-N 3.26Å
119	I	96.6	Very high	95.3	Very high	109 Å²	109	100.1 Å²	100.1	56%	0.559	52%	0.523	S	S	*	.	H	α-helix	trans	-62.3	-45.1	175.9	-66	166.5	0	0	0	110.5	K115 I116 A121 L122 V123	K115-I119 WeakPolarHBondContact O-CG1 3.45Å; K115-I119 PolarHBondContact O-N 3.33Å; I116-I119 PolarHBondContact O-N 3.39Å; I119-A121 VanDerWaalsContact C-N 3.32Å; I119-A121 PolarHBondContact O-N 3.01Å; I119-L122 PolarHBondContact O-N 2.94Å; I119-V123 WeakPolarHBondContact O-CG2 3.35Å; I119-V123 PolarHBondContact O-N 2.98Å
120	M	96.7	Very high	95.6	Very high	124 Å²	124	98.2 Å²	98.2	61%	0.611	52%	0.517	S	S	*	.	H	α-helix	trans	-59	-41.6	176.2	-75	-62.4	-61.4	0	0	112.5	I116 K117 V123 A124	I116-M120 WeakPolarHBondContact O-CG 3.41Å; I116-M120 PolarHBondContact O-N 3.47Å; K117-M120 PolarHBondContact O-N 3.26Å; M120-V123 PolarHBondContact O-N 3.46Å; M120-A124 WeakPolarHBondContact O-CB 3.35Å; M120-A124 PolarHBondContact O-N 3.38Å
121	A	97.1	Very high	95.9	Very high	62 Å²	62	94 Å²	94	51%	0.512	51%	0.507	S	S	.	.	H	α-helix	trans	-65.1	-40.3	176.7	0	0	0	0	0	112.2	K117 A118 I119 A124 A125	K117-A121 PolarHBondContact O-N 3.21Å; A118-A121 PolarHBondContact O-N 3Å; I119-A121 VanDerWaalsContact C-N 3.32Å; I119-A121 PolarHBondContact O-N 3.01Å; A121-A124 PolarHBondContact O-N 3.46Å; A121-A125 WeakPolarHBondContact O-CB 3.47Å; A121-A125 PolarHBondContact O-N 3.02Å
122	L	97.5	Very high	96	Very high	110 Å²	110	92 Å²	92	58%	0.576	51%	0.505	S	S	*	.	H	α-helix	trans	-62.5	-46.1	176.3	-177.5	67.1	0	0	0	111.6	A118 I119 A124 A125 I126	A118-L122 PolarHBondContact O-N 3.26Å; I119-L122 PolarHBondContact O-N 2.94Å; L122-A124 VanDerWaalsContact C-N 3.34Å; L122-A124 PolarHBondContact O-N 3.04Å; L122-A125 PolarHBondContact O-N 2.94Å; L122-I126 HydrophobicContact CD1-CD1 4.47Å; L122-I126 HydrophobicContact CG-CD1 4.14Å; L122-I126 WeakPolarHBondContact O-CG1 3.46Å; L122-I126 PolarHBondContact O-N 2.96Å
123	V	97.7	Very high	96.2	Very high	72 Å²	72	90.7 Å²	90.7	44%	0.436	51%	0.507	S	S	.	.	H	α-helix	trans	-61	-44.4	177.1	174	0	0	0	0	110.9	I119 M120 A125 I126 L127	I119-V123 WeakPolarHBondContact O-CG2 3.35Å; I119-V123 PolarHBondContact O-N 2.98Å; M120-V123 PolarHBondContact O-N 3.46Å; V123-A125 PolarHBondContact O-N 3.39Å; V123-I126 PolarHBondContact O-N 3.38Å; V123-L127 HydrophobicContact CG1-CD1 4.19Å; V123-L127 WeakPolarHBondContact O-CG 3.46Å; V123-L127 PolarHBondContact O-N 3.39Å
124	A	97.6	Very high	96.3	Very high	48 Å²	48	93.6 Å²	93.6	40%	0.397	51%	0.514	S	S	.	.	H	α-helix	trans	-61.6	-41.7	176.4	0	0	0	0	0	112.4	M120 A121 L122 L127 L128	M120-A124 WeakPolarHBondContact O-CB 3.35Å; M120-A124 PolarHBondContact O-N 3.38Å; A121-A124 PolarHBondContact O-N 3.46Å; L122-A124 VanDerWaalsContact C-N 3.34Å; L122-A124 PolarHBondContact O-N 3.04Å; A124-L127 PolarHBondContact O-N 3.48Å; A124-L128 WeakPolarHBondContact O-CG 3.23Å; A124-L128 PolarHBondContact O-N 3.34Å
125	A	97.5	Very high	96.4	Very high	46 Å²	46	94.9 Å²	94.9	38%	0.38	52%	0.515	S	S	.	.	H	α-helix	trans	-63.4	-41.5	177.1	0	0	0	0	0	112.4	A121 L122 V123 L128 L129	A121-A125 WeakPolarHBondContact O-CB 3.47Å; A121-A125 PolarHBondContact O-N 3.02Å; L122-A125 PolarHBondContact O-N 2.94Å; V123-A125 PolarHBondContact O-N 3.39Å; A125-L128 PolarHBondContact O-N 3.47Å; A125-L129 WeakPolarHBondContact O-CG 3.38Å; A125-L129 PolarHBondContact O-N 3.03Å
126	I	97.3	Very high	96.4	Very high	91 Å²	91	92.7 Å²	92.7	47%	0.467	51%	0.513	S	S	.	.	H	α-helix	trans	-63.5	-45.9	176.3	-66.5	165.6	0	0	0	110.6	L122 V123 L128 L129 V130	L122-I126 HydrophobicContact CD1-CD1 4.47Å; L122-I126 HydrophobicContact CG-CD1 4.14Å; L122-I126 WeakPolarHBondContact O-CG1 3.46Å; L122-I126 PolarHBondContact O-N 2.96Å; V123-I126 PolarHBondContact O-N 3.38Å; I126-L128 VanDerWaalsContact C-N 3.34Å; I126-L128 PolarHBondContact O-N 3.33Å; I126-L129 PolarHBondContact O-N 2.97Å; I126-V130 WeakPolarHBondContact O-CG2 3.4Å; I126-V130 PolarHBondContact O-N 2.88Å
127	L	97.1	Very high	96.3	Very high	103 Å²	103	92.9 Å²	92.9	54%	0.539	51%	0.513	S	S	.	.	H	α-helix	trans	-60.2	-43.6	176.9	-71.1	173	0	0	0	111.7	V123 A124 V130 I131	V123-L127 HydrophobicContact CG1-CD1 4.19Å; V123-L127 WeakPolarHBondContact O-CG 3.46Å; V123-L127 PolarHBondContact O-N 3.39Å; A124-L127 PolarHBondContact O-N 3.48Å; L127-V130 PolarHBondContact O-N 3.44Å; L127-I131 WeakPolarHBondContact O-CD1 3.39Å; L127-I131 VanDerWaalsContact O-CG1 3.25Å; L127-I131 WeakPolarHBondContact O-CG1 3.2Å; L127-I131 PolarHBondContact O-N 2.92Å
128	L	96.9	Very high	96.1	Very high	105 Å²	105	92.7 Å²	92.7	55%	0.55	51%	0.512	S	S	.	.	H	α-helix	trans	-61.5	-43.3	175.4	-73.4	174.4	0	0	0	112	A124 A125 I126 V130 I131 I132	A124-L128 WeakPolarHBondContact O-CG 3.23Å; A124-L128 PolarHBondContact O-N 3.34Å; A125-L128 PolarHBondContact O-N 3.47Å; I126-L128 VanDerWaalsContact C-N 3.34Å; I126-L128 PolarHBondContact O-N 3.33Å; L128-V130 PolarHBondContact O-N 2.97Å; L128-I131 PolarHBondContact O-N 3.49Å; L128-I132 WeakPolarHBondContact O-CB 3.33Å; L128-I132 WeakPolarHBondContact O-CD1 3.32Å; L128-I132 WeakPolarHBondContact O-CG1 3.49Å; L128-I132 PolarHBondContact O-N 3.34Å
129	L	96.3	Very high	96	Very high	104 Å²	104	99.7 Å²	99.7	55%	0.545	53%	0.528	S	S	.	.	H	α-helix	trans	-60.9	-44.2	176.2	-76.7	171.3	0	0	0	112	A125 I126 I132 I133	A125-L129 WeakPolarHBondContact O-CG 3.38Å; A125-L129 PolarHBondContact O-N 3.03Å; I126-L129 PolarHBondContact O-N 2.97Å; L129-I132 PolarHBondContact O-N 3.23Å; L129-I133 WeakPolarHBondContact O-CB 3.49Å; L129-I133 WeakPolarHBondContact O-CD1 3.45Å; L129-I133 VanDerWaalsContact O-CG1 3.23Å; L129-I133 WeakPolarHBondContact O-CG1 3.48Å; L129-I133 PolarHBondContact O-N 3.31Å
130	V	96.5	Very high	95.7	Very high	73 Å²	73	105.5 Å²	105.5	44%	0.442	54%	0.543	S	S	.	.	H	α-helix	trans	-61.7	-45.3	176.5	173.3	0	0	0	0	110.8	I126 L127 L128 I132 I133 L134	I126-V130 WeakPolarHBondContact O-CG2 3.4Å; I126-V130 PolarHBondContact O-N 2.88Å; L127-V130 PolarHBondContact O-N 3.44Å; L128-V130 PolarHBondContact O-N 2.97Å; V130-I132 PolarHBondContact O-N 3.35Å; V130-I133 PolarHBondContact O-N 3.4Å; V130-L134 HydrophobicContact CG1-CD1 4.14Å; V130-L134 HydrophobicContact CG1-CG 4.49Å; V130-L134 WeakPolarHBondContact O-CG 3.25Å; V130-L134 PolarHBondContact O-N 2.92Å
131	I	95.9	Very high	94.7	Very high	91 Å²	91	106.9 Å²	106.9	47%	0.467	56%	0.558	S	S	.	*	H	α-helix	trans	-60.7	-45.3	177.1	-68.3	164.4	0	0	0	110.8	L127 L128 L134 I135	L127-I131 WeakPolarHBondContact O-CD1 3.39Å; L127-I131 VanDerWaalsContact O-CG1 3.25Å; L127-I131 WeakPolarHBondContact O-CG1 3.2Å; L127-I131 PolarHBondContact O-N 2.92Å; L128-I131 PolarHBondContact O-N 3.49Å; I131-L134 PolarHBondContact O-N 3.48Å; I131-I135 HydrophobicContact CG2-CD1 3.76Å; I131-I135 HydrophobicContact CG2-CG1 4.47Å; I131-I135 VanDerWaalsContact O-CG1 3.29Å; I131-I135 WeakPolarHBondContact O-CG1 3.29Å; I131-I135 PolarHBondContact O-N 3.47Å
132	I	95.6	Very high	94.6	Very high	95 Å²	95	109.1 Å²	109.1	49%	0.487	56%	0.56	S	S	.	*	H	α-helix	trans	-61.7	-45.4	178.2	-69.3	163.9	0	0	0	110.8	L128 L129 V130 L134 I135 V136	L128-I132 WeakPolarHBondContact O-CB 3.33Å; L128-I132 WeakPolarHBondContact O-CD1 3.32Å; L128-I132 WeakPolarHBondContact O-CG1 3.49Å; L128-I132 PolarHBondContact O-N 3.34Å; L129-I132 PolarHBondContact O-N 3.23Å; V130-I132 PolarHBondContact O-N 3.35Å; I132-L134 PolarHBondContact O-N 2.98Å; I132-I135 PolarHBondContact O-N 2.98Å; I132-V136 HydrophobicContact CG2-CG2 4.34Å; I132-V136 WeakPolarHBondContact O-CG2 3.35Å; I132-V136 PolarHBondContact O-N 2.92Å
133	I	95.2	Very high	94.5	Very high	108 Å²	108	109.1 Å²	109.1	55%	0.554	56%	0.56	S	S	*	*	H	α-helix	trans	-61.3	-44.4	178.6	-69.4	164	0	0	0	110.8	L129 V130 V136 M137	L129-I133 WeakPolarHBondContact O-CB 3.49Å; L129-I133 WeakPolarHBondContact O-CD1 3.45Å; L129-I133 VanDerWaalsContact O-CG1 3.23Å; L129-I133 WeakPolarHBondContact O-CG1 3.48Å; L129-I133 PolarHBondContact O-N 3.31Å; V130-I133 PolarHBondContact O-N 3.4Å; I133-V136 PolarHBondContact O-N 3.34Å; I133-M137 WeakPolarHBondContact O-CB 3.34Å; I133-M137 PolarHBondContact O-N 3.3Å
134	L	94.7	Very high	94.3	Very high	97 Å²	97	111.1 Å²	111.1	51%	0.508	57%	0.566	S	S	.	*	H	α-helix	trans	-62.8	-42.2	177.5	-71.1	175.8	0	0	0	112	V130 I131 I132 M137 K138	V130-L134 HydrophobicContact CG1-CD1 4.14Å; V130-L134 HydrophobicContact CG1-CG 4.49Å; V130-L134 WeakPolarHBondContact O-CG 3.25Å; V130-L134 PolarHBondContact O-N 2.92Å; I131-L134 PolarHBondContact O-N 3.48Å; I132-L134 PolarHBondContact O-N 2.98Å; L134-M137 HydrophobicContact CD2-CE 4.27Å; L134-K138 VanDerWaalsContact O-CB 3.26Å; L134-K138 WeakPolarHBondContact O-CB 3.33Å; L134-K138 PolarHBondContact O-N 2.84Å
135	I	95.5	Very high	94.1	Very high	93 Å²	93	114.8 Å²	114.8	48%	0.477	58%	0.576	S	S	.	*	H	α-helix	trans	-64	-47.1	177	-69.3	168.3	0	0	0	110.7	I131 I132 M137 K138 Y139	I131-I135 HydrophobicContact CG2-CD1 3.76Å; I131-I135 HydrophobicContact CG2-CG1 4.47Å; I131-I135 VanDerWaalsContact O-CG1 3.29Å; I131-I135 WeakPolarHBondContact O-CG1 3.29Å; I131-I135 PolarHBondContact O-N 3.47Å; I132-I135 PolarHBondContact O-N 2.98Å; I135-M137 PolarHBondContact O-N 3Å; I135-K138 PolarHBondContact O-N 3.45Å; I135-Y139 HydrophobicContact CG2-CD2 4.18Å; I135-Y139 WeakPolarHBondContact O-CB 3.44Å; I135-Y139 PolarHBondContact O-N 2.95Å
136	V	94.9	Very high	93.9	Very high	89 Å²	89	119.1 Å²	119.1	54%	0.539	59%	0.589	S	S	.	*	H	α-helix	trans	-62.4	-44.1	179.3	170.7	0	0	0	0	111.1	I132 I133 K138 Y139 R140	I132-V136 HydrophobicContact CG2-CG2 4.34Å; I132-V136 WeakPolarHBondContact O-CG2 3.35Å; I132-V136 PolarHBondContact O-N 2.92Å; I133-V136 PolarHBondContact O-N 3.34Å; V136-K138 VanDerWaalsContact C-N 3.31Å; V136-K138 PolarHBondContact O-N 3.25Å; V136-Y139 PolarHBondContact O-N 3.49Å; V136-R140 WeakPolarHBondContact O-CB 3.26Å; V136-R140 PolarHBondContact O-N 2.93Å
137	M	94	Very high	93.6	Very high	115 Å²	115	121 Å²	121	57%	0.567	60%	0.597	S	S	*	*	H	α-helix	trans	-63.4	-38.8	177.3	-169.9	178	70.9	0	0	111.7	I133 L134 I135 T141	I133-M137 WeakPolarHBondContact O-CB 3.34Å; I133-M137 PolarHBondContact O-N 3.3Å; L134-M137 HydrophobicContact CD2-CE 4.27Å; I135-M137 PolarHBondContact O-N 3Å; M137-T141 PolarHBondContact O-N 3.3Å; M137-T141 PolarHBondContact O-OG1 3.36Å
138	K	91.8	Very high	93.4	Very high	153 Å²	153	122.3 Å²	122.3	67%	0.665	60%	0.601	S	S	*	*	H	α-helix	trans	-73.4	-32.3	178.1	-176.9	57	-178.6	152.5	0	113.2	L134 I135 V136 T141	L134-K138 VanDerWaalsContact O-CB 3.26Å; L134-K138 WeakPolarHBondContact O-CB 3.33Å; L134-K138 PolarHBondContact O-N 2.84Å; I135-K138 PolarHBondContact O-N 3.45Å; V136-K138 VanDerWaalsContact C-N 3.31Å; V136-K138 PolarHBondContact O-N 3.25Å; K138-T141 VanDerWaalsContact O-OXT 3.11Å
139	Y	93.9	Very high	93.1	Very high	206 Å²	206	123.6 Å²	123.6	81%	0.808	61%	0.605	S	S	*	*	H	α-helix	trans	-77.1	-28.1	176.2	-111.5	-89.7	0	0	0	112.9	I135 V136	I135-Y139 HydrophobicContact CG2-CD2 4.18Å; I135-Y139 WeakPolarHBondContact O-CB 3.44Å; I135-Y139 PolarHBondContact O-N 2.95Å; V136-Y139 PolarHBondContact O-N 3.49Å
140	R	90.3	Very high	92.9	Very high	231 Å²	231	125.3 Å²	125.3	87%	0.872	61%	0.61	S	S	*	*	H	α-helix	trans	-79.4	-22.7	178.3	-165	-177.1	-178.2	177.3	2.4	113	V136	V136-R140 WeakPolarHBondContact O-CB 3.26Å; V136-R140 PolarHBondContact O-N 2.93Å
141	T	76.1	Confident	92.5	Very high	152 Å²	152	130 Å²	130	93%	0.933	63%	0.625	S	S	*	*			trans	-97.3	0	179.8	-51.5	0	0	0	0	110.7	M137 K138	M137-T141 PolarHBondContact O-N 3.3Å; M137-T141 PolarHBondContact O-OG1 3.36Å; K138-T141 VanDerWaalsContact O-OXT 3.11Å

Retrieved 141 of 141 residues in 136.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).