SNPC5_HUMAN Loading...

snRNA-activating protein complex subunit 5

Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.

AlphaFold DB , UniProt , Accession O75971, Species HUMAN (Homo sapiens, Human), Gene SNAPC5, Length 98 aa.

						>SNPC5_HUMAN|O75971|SNAPC5
MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSHDMLVHVDNEASINQTTLELSTKSHVTEEEEEEEEEESDS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	82	Confident	95.3	Very high	214 Å²	214	121.5 Å²	121.5	100%	1.054	58%	0.575	S	S	*	*				0	-51.3	0	-95.7	-172.8	-78.8	0	0	113.1	S3 R4 L5	M1-S3 PolarHBondContact O-N 2.84Å; M1-R4 PolarHBondContact O-N 3.09Å; M1-R4 VanDerWaalsContact O-N 3.16Å; M1-L5 PolarHBondContact O-N 3.46Å; M1-L5 VanDerWaalsContact O-N 3.13Å
2	L	91.2	Very high	95.5	Very high	119 Å²	119	121.3 Å²	121.3	62%	0.623	57%	0.574	S	S	*	*	H	α-helix	trans	-55.5	-43.6	-176.8	-172.7	64.7	0	0	0	113.9	R4 L5 Q6	L2-R4 PolarHBondContact O-N 2.97Å; L2-L5 PolarHBondContact O-N 2.78Å; L2-Q6 WeakPolarHBondContact O-CG 3.3Å; L2-Q6 PolarHBondContact O-N 2.85Å
3	S	95.3	Very high	95.7	Very high	76 Å²	76	119.5 Å²	119.5	53%	0.531	57%	0.565	S	S	.	*	H	α-helix	trans	-60	-44.4	177.7	-41.5	0	0	0	0	112.4	M1 L5 Q6 E7	M1-S3 PolarHBondContact O-N 2.84Å; S3-L5 VanDerWaalsContact C-N 3.29Å; S3-L5 PolarHBondContact O-N 2.96Å; S3-Q6 WeakPolarHBondContact O-CB 3.19Å; S3-Q6 PolarHBondContact O-N 3.12Å; S3-Q6 VanDerWaalsContact O-N 3.14Å; S3-E7 WeakPolarHBondContact O-CG 3.43Å; S3-E7 PolarHBondContact O-N 3.48Å
4	R	96.1	Very high	95.9	Very high	150 Å²	150	115.7 Å²	115.7	57%	0.566	55%	0.553	S	S	*	*	H	α-helix	trans	-61.9	-38.3	177.3	-177.3	57.5	175	-167.8	2.4	112	M1 L2 E7 L8	M1-R4 PolarHBondContact O-N 3.09Å; M1-R4 VanDerWaalsContact O-N 3.16Å; L2-R4 PolarHBondContact O-N 2.97Å; R4-E7 IonicContact NH1-OE2 3.74Å; R4-E7 PolarHBondContact O-N 3.41Å; R4-L8 HydrophobicContact CG-CD1 4.32Å; R4-L8 WeakPolarHBondContact O-CG 3.5Å; R4-L8 PolarHBondContact O-N 3.28Å
5	L	97.4	Very high	96.1	Very high	96 Å²	96	114.8 Å²	114.8	50%	0.503	55%	0.552	S	S	.	*	H	α-helix	trans	-70	-33.8	177.2	-168.5	135.1	0	0	0	112	M1 L2 S3 R9	M1-L5 PolarHBondContact O-N 3.46Å; M1-L5 VanDerWaalsContact O-N 3.13Å; L2-L5 PolarHBondContact O-N 2.78Å; S3-L5 VanDerWaalsContact C-N 3.29Å; S3-L5 PolarHBondContact O-N 2.96Å; L5-R9 WeakPolarHBondContact O-CB 3.27Å; L5-R9 PolarHBondContact O-N 3.46Å; L5-R9 VanDerWaalsContact O-N 3.12Å
6	Q	97.6	Very high	96.3	Very high	98 Å²	98	114.1 Å²	114.1	46%	0.458	55%	0.551	S	S	.	*	H	α-helix	trans	-69.3	-40	172.8	-70.9	174	-23.2	0	0	112.2	L2 S3 R9 K10	L2-Q6 WeakPolarHBondContact O-CG 3.3Å; L2-Q6 PolarHBondContact O-N 2.85Å; S3-Q6 WeakPolarHBondContact O-CB 3.19Å; S3-Q6 PolarHBondContact O-N 3.12Å; S3-Q6 VanDerWaalsContact O-N 3.14Å; Q6-R9 PolarHBondContact O-N 2.77Å; Q6-K10 WeakPolarHBondContact O-CG 3.41Å; Q6-K10 PolarHBondContact O-N 3.43Å; Q6-K10 VanDerWaalsContact O-N 3.1Å
7	E	97.4	Very high	96.4	Very high	101 Å²	101	116.4 Å²	116.4	47%	0.472	55%	0.553	S	S	.	*	H	α-helix	trans	-59.7	-51.6	173.2	-73.6	163.2	-158.1	0	0	111.2	S3 R4 R9 K10 E11	S3-E7 WeakPolarHBondContact O-CG 3.43Å; S3-E7 PolarHBondContact O-N 3.48Å; R4-E7 IonicContact NH1-OE2 3.74Å; R4-E7 PolarHBondContact O-N 3.41Å; E7-R9 VanDerWaalsContact C-N 3.27Å; E7-R9 PolarHBondContact O-N 3.29Å; E7-K10 WeakPolarHBondContact O-CB 3.46Å; E7-K10 PolarHBondContact O-N 3.2Å; E7-K10 VanDerWaalsContact O-N 3.09Å; E7-E11 PolarHBondContact O-N 3.47Å
8	L	98.1	Very high	96.5	Very high	85 Å²	85	115.8 Å²	115.8	45%	0.445	55%	0.553	S	S	.	*	H	α-helix	trans	-58.8	-38.4	178.9	-73.7	171.4	0	0	0	112.3	R4 E11 E12	R4-L8 HydrophobicContact CG-CD1 4.32Å; R4-L8 WeakPolarHBondContact O-CG 3.5Å; R4-L8 PolarHBondContact O-N 3.28Å; L8-E11 PolarHBondContact O-N 3.28Å; L8-E12 WeakPolarHBondContact O-CB 3.21Å; L8-E12 PolarHBondContact O-N 2.89Å
9	R	97.2	Very high	96.7	Very high	152 Å²	152	117.5 Å²	117.5	57%	0.574	56%	0.558	S	S	*	*	H	α-helix	trans	-64.7	-42	175.8	-170.2	-171.2	-53.4	173.7	2	112.3	L5 Q6 E7 E11 E13	L5-R9 WeakPolarHBondContact O-CB 3.27Å; L5-R9 PolarHBondContact O-N 3.46Å; L5-R9 VanDerWaalsContact O-N 3.12Å; Q6-R9 PolarHBondContact O-N 2.77Å; E7-R9 VanDerWaalsContact C-N 3.27Å; E7-R9 PolarHBondContact O-N 3.29Å; R9-E11 VanDerWaalsContact C-N 3.35Å; R9-E13 WeakPolarHBondContact O-CB 3.46Å; R9-E13 PolarHBondContact O-N 3.16Å
10	K	97.7	Very high	96.8	Very high	143 Å²	143	114.3 Å²	114.3	62%	0.622	55%	0.552	S	S	*	*	H	α-helix	trans	-65	-42.7	176.2	-72	175.9	179.7	-179.4	0	110.7	Q6 E7 E13 T14	Q6-K10 WeakPolarHBondContact O-CG 3.41Å; Q6-K10 PolarHBondContact O-N 3.43Å; Q6-K10 VanDerWaalsContact O-N 3.1Å; E7-K10 WeakPolarHBondContact O-CB 3.46Å; E7-K10 PolarHBondContact O-N 3.2Å; E7-K10 VanDerWaalsContact O-N 3.09Å; K10-E13 PolarHBondContact O-N 3.24Å; K10-T14 WeakPolarHBondContact O-CG2 3.42Å; K10-T14 PolarHBondContact O-N 3.23Å; K10-T14 PolarHBondContact O-OG1 3.04Å
11	E	98	Very high	96.8	Very high	103 Å²	103	111.3 Å²	111.3	48%	0.481	55%	0.546	S	S	.	.	H	α-helix	trans	-62.3	-47.2	177.6	-171.3	173.7	-175.2	0	0	111.3	E7 L8 R9 E13 T14 L15	E7-E11 PolarHBondContact O-N 3.47Å; L8-E11 PolarHBondContact O-N 3.28Å; R9-E11 VanDerWaalsContact C-N 3.35Å; E11-E13 VanDerWaalsContact C-N 3.33Å; E11-E13 PolarHBondContact O-N 3.42Å; E11-T14 WeakPolarHBondContact CA-OG1 3.4Å; E11-T14 PolarHBondContact O-N 3.07Å; E11-T14 VanDerWaalsContact O-N 3.15Å; E11-T14 PolarHBondContact O-OG1 3.5Å; E11-L15 HydrophobicContact CG-CD1 4.27Å; E11-L15 WeakPolarHBondContact O-CG 3.33Å; E11-L15 PolarHBondContact O-N 2.79Å
12	E	98.3	Very high	97.6	Very high	119 Å²	119	106.3 Å²	106.3	56%	0.556	52%	0.523	S	S	*	.	H	α-helix	trans	-55.6	-46.6	174	-178.1	-177.9	-165.2	0	0	111.7	L8 T14 L15 L16	L8-E12 WeakPolarHBondContact O-CB 3.21Å; L8-E12 PolarHBondContact O-N 2.89Å; E12-T14 VanDerWaalsContact C-N 3.35Å; E12-T14 PolarHBondContact O-N 3.45Å; E12-L15 PolarHBondContact O-N 3.33Å; E12-L16 HydrophobicContact CG-CD1 4.37Å; E12-L16 WeakPolarHBondContact O-CG 3.38Å; E12-L16 PolarHBondContact O-N 2.89Å
13	E	98.3	Very high	98	Very high	98 Å²	98	105.7 Å²	105.7	46%	0.458	52%	0.517	S	S	.	.	H	α-helix	trans	-60.6	-44	177	-172.9	-177.8	178.3	0	0	111.7	R9 K10 E11 L16 R17	R9-E13 WeakPolarHBondContact O-CB 3.46Å; R9-E13 PolarHBondContact O-N 3.16Å; K10-E13 PolarHBondContact O-N 3.24Å; E11-E13 VanDerWaalsContact C-N 3.33Å; E11-E13 PolarHBondContact O-N 3.42Å; E13-L16 PolarHBondContact O-N 2.96Å; E13-R17 VanDerWaalsContact CD-NH2 3.33Å; E13-R17 WeakPolarHBondContact O-CG 3.38Å; E13-R17 PolarHBondContact O-N 2.89Å; E13-R17 VanDerWaalsContact O-N 3.12Å; E13-R17 IonicContact OE1-CZ 2.78Å; E13-R17 IonicContact OE1-NE 3.99Å; E13-R17 IonicContact OE1-NH2 3.58Å; E13-R17 PolarHBondContact OE1-NH2 2.74Å; E13-R17 IonicContact OE2-NH2 2.65Å
14	T	98.5	Very high	98.2	Very high	66 Å²	66	107.2 Å²	107.2	41%	0.405	52%	0.519	S	S	.	.	H	α-helix	trans	-63.8	-41.6	176.4	59.3	0	0	0	0	111.9	K10 E11 E12 L16 R17 L18	K10-T14 WeakPolarHBondContact O-CG2 3.42Å; K10-T14 PolarHBondContact O-N 3.23Å; K10-T14 PolarHBondContact O-OG1 3.04Å; E11-T14 WeakPolarHBondContact CA-OG1 3.4Å; E11-T14 PolarHBondContact O-N 3.07Å; E11-T14 VanDerWaalsContact O-N 3.15Å; E11-T14 PolarHBondContact O-OG1 3.5Å; E12-T14 VanDerWaalsContact C-N 3.35Å; E12-T14 PolarHBondContact O-N 3.45Å; T14-L16 VanDerWaalsContact C-N 3.33Å; T14-L16 PolarHBondContact O-N 2.91Å; T14-R17 PolarHBondContact O-N 3.17Å; T14-L18 WeakPolarHBondContact O-CD1 3.32Å; T14-L18 PolarHBondContact O-N 3.31Å
15	L	98.8	Very high	98.3	Very high	102 Å²	102	106 Å²	106	53%	0.534	52%	0.519	S	S	.	.	H	α-helix	trans	-63.1	-39.7	177.5	-75.2	171.1	0	0	0	111.8	E11 E12 L18 K19	E11-L15 HydrophobicContact CG-CD1 4.27Å; E11-L15 WeakPolarHBondContact O-CG 3.33Å; E11-L15 PolarHBondContact O-N 2.79Å; E12-L15 PolarHBondContact O-N 3.33Å; L15-L18 PolarHBondContact O-N 3.37Å; L15-K19 VanDerWaalsContact O-CB 3.26Å; L15-K19 WeakPolarHBondContact O-CB 3.49Å; L15-K19 PolarHBondContact O-N 3.46Å
16	L	98.7	Very high	98.4	Very high	103 Å²	103	106.7 Å²	106.7	54%	0.539	52%	0.523	S	S	.	.	H	α-helix	trans	-62.7	-42.2	175.1	-74.1	172.6	0	0	0	111.8	E12 E13 T14 K19 A20	E12-L16 HydrophobicContact CG-CD1 4.37Å; E12-L16 WeakPolarHBondContact O-CG 3.38Å; E12-L16 PolarHBondContact O-N 2.89Å; E13-L16 PolarHBondContact O-N 2.96Å; T14-L16 VanDerWaalsContact C-N 3.33Å; T14-L16 PolarHBondContact O-N 2.91Å; L16-K19 PolarHBondContact O-N 3.34Å; L16-A20 PolarHBondContact O-N 3.46Å
17	R	98.6	Very high	98.4	Very high	154 Å²	154	105.3 Å²	105.3	58%	0.581	52%	0.519	S	S	*	.	H	α-helix	trans	-64.2	-44.6	175	-65.8	179	-159.9	178.4	3.5	111.9	E13 T14 A20 A21	E13-R17 VanDerWaalsContact CD-NH2 3.33Å; E13-R17 WeakPolarHBondContact O-CG 3.38Å; E13-R17 PolarHBondContact O-N 2.89Å; E13-R17 VanDerWaalsContact O-N 3.12Å; E13-R17 IonicContact OE1-CZ 2.78Å; E13-R17 IonicContact OE1-NE 3.99Å; E13-R17 IonicContact OE1-NH2 3.58Å; E13-R17 PolarHBondContact OE1-NH2 2.74Å; E13-R17 IonicContact OE2-NH2 2.65Å; T14-R17 PolarHBondContact O-N 3.17Å; R17-A20 PolarHBondContact O-N 2.77Å; R17-A21 PolarHBondContact O-N 3.34Å
18	L	98.7	Very high	98.5	Very high	105 Å²	105	108.6 Å²	108.6	55%	0.55	53%	0.527	S	S	.	.	H	α-helix	trans	-62.8	-43.2	177.3	-93.6	74.1	0	0	0	111.3	T14 L15 A20 A21 L22	T14-L18 WeakPolarHBondContact O-CD1 3.32Å; T14-L18 PolarHBondContact O-N 3.31Å; L15-L18 PolarHBondContact O-N 3.37Å; L18-A20 VanDerWaalsContact C-N 3.33Å; L18-A20 PolarHBondContact O-N 3.24Å; L18-A21 PolarHBondContact O-N 3.31Å; L18-L22 WeakPolarHBondContact O-CB 3.33Å; L18-L22 WeakPolarHBondContact O-CG 3.36Å; L18-L22 PolarHBondContact O-N 3.35Å
19	K	98.6	Very high	98.5	Very high	149 Å²	149	109.7 Å²	109.7	65%	0.648	53%	0.532	S	S	*	.	H	α-helix	trans	-59.2	-44.6	176.5	-178.7	-178	177.5	-177.2	0	111.5	L15 L16 L22 H23	L15-K19 VanDerWaalsContact O-CB 3.26Å; L15-K19 WeakPolarHBondContact O-CB 3.49Å; L15-K19 PolarHBondContact O-N 3.46Å; L16-K19 PolarHBondContact O-N 3.34Å; K19-L22 PolarHBondContact O-N 3.45Å; K19-H23 WeakPolarHBondContact O-CB 3.45Å; K19-H23 PolarHBondContact O-N 3.17Å
20	A	98.7	Very high	98.6	Very high	53 Å²	53	108.5 Å²	108.5	44%	0.438	53%	0.532	S	S	.	.	H	α-helix	trans	-62.5	-47.9	176.6	0	0	0	0	0	111.4	L16 R17 L18 L22 H23 D24	L16-A20 PolarHBondContact O-N 3.46Å; R17-A20 PolarHBondContact O-N 2.77Å; L18-A20 VanDerWaalsContact C-N 3.33Å; L18-A20 PolarHBondContact O-N 3.24Å; A20-L22 VanDerWaalsContact C-N 3.34Å; A20-L22 PolarHBondContact O-N 2.95Å; A20-H23 PolarHBondContact O-N 3.48Å; A20-D24 PolarHBondContact O-N 3.05Å
21	A	98.6	Very high	98.6	Very high	51 Å²	51	106.5 Å²	106.5	42%	0.421	53%	0.531	S	S	.	.	H	α-helix	trans	-60.2	-41.6	178.3	0	0	0	0	0	112.8	R17 L18 D24 Q25	R17-A21 PolarHBondContact O-N 3.34Å; L18-A21 PolarHBondContact O-N 3.31Å; A21-D24 PolarHBondContact O-N 2.96Å; A21-Q25 WeakPolarHBondContact O-CG 3.33Å; A21-Q25 PolarHBondContact O-N 3.07Å
22	L	98.8	Very high	98.6	Very high	109 Å²	109	105.2 Å²	105.2	57%	0.571	53%	0.525	S	S	*	.	H	α-helix	trans	-66.3	-40.1	176	-75	169.5	0	0	0	112.2	L18 K19 A20 Q25 L26	L18-L22 WeakPolarHBondContact O-CB 3.33Å; L18-L22 WeakPolarHBondContact O-CG 3.36Å; L18-L22 PolarHBondContact O-N 3.35Å; K19-L22 PolarHBondContact O-N 3.45Å; A20-L22 VanDerWaalsContact C-N 3.34Å; A20-L22 PolarHBondContact O-N 2.95Å; L22-Q25 PolarHBondContact O-N 2.96Å; L22-L26 WeakPolarHBondContact O-CB 3.45Å; L22-L26 PolarHBondContact O-N 3.45Å
23	H	98.7	Very high	98.6	Very high	107 Å²	107	104.7 Å²	104.7	50%	0.495	52%	0.522	S	S	.	.	H	α-helix	trans	-63.3	-43	177	-169.5	65.7	0	0	0	111.5	K19 A20 L26 N27	K19-H23 WeakPolarHBondContact O-CB 3.45Å; K19-H23 PolarHBondContact O-N 3.17Å; A20-H23 PolarHBondContact O-N 3.48Å; H23-L26 PolarHBondContact O-N 3.42Å; H23-N27 PolarHBondContact CD2-ND2 2.99Å; H23-N27 VanDerWaalsContact CD2-ND2 3.26Å; H23-N27 PolarHBondContact NE2-ND2 2.82Å; H23-N27 VanDerWaalsContact NE2-ND2 3.15Å; H23-N27 WeakPolarHBondContact O-CB 3.46Å; H23-N27 VanDerWaalsContact O-CG 3.26Å; H23-N27 PolarHBondContact O-N 3.01Å; H23-N27 PolarHBondContact O-ND2 3.29Å
24	D	98.7	Very high	98.6	Very high	108 Å²	108	104.1 Å²	104.1	58%	0.578	52%	0.522	S	S	*	.	H	α-helix	trans	-63.4	-43.8	175.7	-80.5	9.9	0	0	0	112.2	A20 A21 L26 N27 R28	A20-D24 PolarHBondContact O-N 3.05Å; A21-D24 PolarHBondContact O-N 2.96Å; D24-L26 VanDerWaalsContact C-N 3.35Å; D24-L26 PolarHBondContact O-N 3.42Å; D24-N27 PolarHBondContact O-N 3.41Å; D24-R28 WeakPolarHBondContact O-CB 3.33Å; D24-R28 PolarHBondContact O-N 3.15Å
25	Q	98.8	Very high	98.6	Very high	123 Å²	123	103.3 Å²	103.3	58%	0.575	52%	0.522	S	S	*	.	H	α-helix	trans	-61.1	-43.1	176	-76.5	179.8	-15.9	0	0	112.1	A21 L22 R28 L29	A21-Q25 WeakPolarHBondContact O-CG 3.33Å; A21-Q25 PolarHBondContact O-N 3.07Å; L22-Q25 PolarHBondContact O-N 2.96Å; Q25-R28 PolarHBondContact O-N 3.24Å; Q25-L29 WeakPolarHBondContact O-CG 3.35Å; Q25-L29 PolarHBondContact O-N 3.41Å
26	L	98.8	Very high	98.5	Very high	112 Å²	112	103.1 Å²	103.1	59%	0.586	52%	0.521	S	S	*	.	H	α-helix	trans	-64.1	-43	177.3	-176.8	63.5	0	0	0	111.6	L22 H23 D24 R28 L29 K30	L22-L26 WeakPolarHBondContact O-CB 3.45Å; L22-L26 PolarHBondContact O-N 3.45Å; H23-L26 PolarHBondContact O-N 3.42Å; D24-L26 VanDerWaalsContact C-N 3.35Å; D24-L26 PolarHBondContact O-N 3.42Å; L26-R28 VanDerWaalsContact C-N 3.34Å; L26-R28 PolarHBondContact O-N 2.92Å; L26-L29 PolarHBondContact O-N 3.33Å; L26-K30 WeakPolarHBondContact O-CB 3.39Å; L26-K30 PolarHBondContact O-N 2.86Å
27	N	98.6	Very high	98.5	Very high	68 Å²	68	103.2 Å²	103.2	36%	0.364	52%	0.519	S	S	.	.	H	α-helix	trans	-62	-43.1	176.8	-73.6	-28.2	0	0	0	111.4	H23 D24 K30 V31	H23-N27 PolarHBondContact CD2-ND2 2.99Å; H23-N27 VanDerWaalsContact CD2-ND2 3.26Å; H23-N27 PolarHBondContact NE2-ND2 2.82Å; H23-N27 VanDerWaalsContact NE2-ND2 3.15Å; H23-N27 WeakPolarHBondContact O-CB 3.46Å; H23-N27 VanDerWaalsContact O-CG 3.26Å; H23-N27 PolarHBondContact O-N 3.01Å; H23-N27 PolarHBondContact O-ND2 3.29Å; D24-N27 PolarHBondContact O-N 3.41Å; N27-K30 PolarHBondContact O-N 2.83Å; N27-V31 WeakPolarHBondContact O-CG2 3.48Å; N27-V31 PolarHBondContact O-N 3.47Å; N27-V31 VanDerWaalsContact O-N 3.1Å
28	R	98.6	Very high	98.3	Very high	171 Å²	171	99.1 Å²	99.1	65%	0.645	51%	0.514	S	S	*	.	H	α-helix	trans	-60.2	-49.9	175.3	179.7	-178.6	166.1	-148.6	-11.6	111.8	D24 Q25 L26 K30 V31 E32	D24-R28 WeakPolarHBondContact O-CB 3.33Å; D24-R28 PolarHBondContact O-N 3.15Å; Q25-R28 PolarHBondContact O-N 3.24Å; L26-R28 VanDerWaalsContact C-N 3.34Å; L26-R28 PolarHBondContact O-N 2.92Å; R28-K30 VanDerWaalsContact C-N 3.29Å; R28-K30 PolarHBondContact O-N 3.03Å; R28-V31 PolarHBondContact O-N 2.95Å; R28-V31 VanDerWaalsContact O-N 3.15Å; R28-E32 IonicContact CZ-OE1 3.21Å; R28-E32 IonicContact NE-OE1 3.58Å; R28-E32 PolarHBondContact NE-OE1 2.84Å; R28-E32 IonicContact NH2-OE1 2.84Å; R28-E32 PolarHBondContact NH2-OE1 3.26Å; R28-E32 PolarHBondContact O-N 2.95Å
29	L	98.7	Very high	98.1	Very high	107 Å²	107	99.6 Å²	99.6	56%	0.56	52%	0.515	S	S	*	.	H	α-helix	trans	-59.7	-40.1	179.1	-77.4	170.3	0	0	0	112.1	Q25 L26 V31 E32 E33	Q25-L29 WeakPolarHBondContact O-CG 3.35Å; Q25-L29 PolarHBondContact O-N 3.41Å; L26-L29 PolarHBondContact O-N 3.33Å; L29-V31 VanDerWaalsContact C-N 3.34Å; L29-V31 PolarHBondContact O-N 3.18Å; L29-E32 PolarHBondContact O-N 3.42Å; L29-E33 WeakPolarHBondContact O-CB 3.42Å; L29-E33 PolarHBondContact O-N 2.78Å
30	K	98.7	Very high	97.9	Very high	128 Å²	128	97.7 Å²	97.7	56%	0.557	51%	0.511	S	S	*	.	H	α-helix	trans	-62.2	-40.8	176	-176.4	177.1	-180	179	0	112.4	L26 N27 R28 E33 L34	L26-K30 WeakPolarHBondContact O-CB 3.39Å; L26-K30 PolarHBondContact O-N 2.86Å; N27-K30 PolarHBondContact O-N 2.83Å; R28-K30 VanDerWaalsContact C-N 3.29Å; R28-K30 PolarHBondContact O-N 3.03Å; K30-E33 PolarHBondContact O-N 3.3Å; K30-L34 HydrophobicContact CG-CD1 4.4Å; K30-L34 WeakPolarHBondContact O-CG 3.41Å; K30-L34 PolarHBondContact O-N 3.48Å
31	V	98.6	Very high	97.7	Very high	100 Å²	100	98.6 Å²	98.6	61%	0.606	51%	0.513	S	S	*	.	H	α-helix	trans	-65.4	-43.3	176.3	171.5	0	0	0	0	110.9	N27 R28 L29 L34 A35	N27-V31 WeakPolarHBondContact O-CG2 3.48Å; N27-V31 PolarHBondContact O-N 3.47Å; N27-V31 VanDerWaalsContact O-N 3.1Å; R28-V31 PolarHBondContact O-N 2.95Å; R28-V31 VanDerWaalsContact O-N 3.15Å; L29-V31 VanDerWaalsContact C-N 3.34Å; L29-V31 PolarHBondContact O-N 3.18Å; V31-L34 PolarHBondContact O-N 2.88Å; V31-A35 WeakPolarHBondContact O-CB 3.42Å; V31-A35 PolarHBondContact O-N 3.38Å
32	E	98.4	Very high	97.2	Very high	77 Å²	77	99.8 Å²	99.8	36%	0.36	52%	0.519	S	S	.	.	H	α-helix	trans	-63	-41.4	176.8	-70	177.2	-170.1	0	0	111.8	R28 L29 A35 L36	R28-E32 IonicContact CZ-OE1 3.21Å; R28-E32 IonicContact NE-OE1 3.58Å; R28-E32 PolarHBondContact NE-OE1 2.84Å; R28-E32 IonicContact NH2-OE1 2.84Å; R28-E32 PolarHBondContact NH2-OE1 3.26Å; R28-E32 PolarHBondContact O-N 2.95Å; L29-E32 PolarHBondContact O-N 3.42Å; E32-A35 PolarHBondContact O-N 2.74Å; E32-L36 WeakPolarHBondContact O-CG 3.15Å; E32-L36 PolarHBondContact O-N 2.97Å
33	E	98.2	Very high	96.7	Very high	107 Å²	107	102.5 Å²	102.5	50%	0.5	52%	0.522	S	S	.	.	H	α-helix	trans	-63.1	-46.1	176.6	-174.3	-106.8	158.7	0	0	112.2	L29 K30 A35 L36 Q37	L29-E33 WeakPolarHBondContact O-CB 3.42Å; L29-E33 PolarHBondContact O-N 2.78Å; K30-E33 PolarHBondContact O-N 3.3Å; E33-A35 VanDerWaalsContact C-N 3.32Å; E33-A35 PolarHBondContact O-N 2.98Å; E33-L36 PolarHBondContact O-N 3.02Å; E33-Q37 WeakPolarHBondContact O-CB 3.35Å; E33-Q37 PolarHBondContact O-N 3.37Å
34	L	98.2	Very high	95.8	Very high	86 Å²	86	106.1 Å²	106.1	45%	0.45	53%	0.531	S	S	.	.	H	α-helix	trans	-62.5	-38.2	174.8	-71.6	172.9	0	0	0	112.3	K30 V31 Q37 S38	K30-L34 HydrophobicContact CG-CD1 4.4Å; K30-L34 WeakPolarHBondContact O-CG 3.41Å; K30-L34 PolarHBondContact O-N 3.48Å; V31-L34 PolarHBondContact O-N 2.88Å; L34-Q37 PolarHBondContact O-N 3.45Å; L34-S38 WeakPolarHBondContact O-CB 3.43Å; L34-S38 PolarHBondContact O-N 3.03Å
35	A	97.6	Very high	94.3	Very high	49 Å²	49	102.6 Å²	102.6	41%	0.405	52%	0.52	S	S	.	.	H	α-helix	trans	-64.1	-44.6	175.7	0	0	0	0	0	111.4	V31 E32 E33 S38 M39	V31-A35 WeakPolarHBondContact O-CB 3.42Å; V31-A35 PolarHBondContact O-N 3.38Å; E32-A35 PolarHBondContact O-N 2.74Å; E33-A35 VanDerWaalsContact C-N 3.32Å; E33-A35 PolarHBondContact O-N 2.98Å; A35-S38 WeakPolarHBondContact O-CB 3.36Å; A35-S38 PolarHBondContact O-N 3.3Å; A35-M39 WeakPolarHBondContact O-CG 3.43Å; A35-M39 PolarHBondContact O-N 3.39Å
36	L	98	Very high	92.6	Very high	99 Å²	99	102 Å²	102	52%	0.518	52%	0.521	S	S	.	.	H	α-helix	trans	-63	-45.7	175.4	-71.1	164.3	0	0	0	111.7	E32 E33 S38 M39 I40	E32-L36 WeakPolarHBondContact O-CG 3.15Å; E32-L36 PolarHBondContact O-N 2.97Å; E33-L36 PolarHBondContact O-N 3.02Å; L36-S38 VanDerWaalsContact C-N 3.29Å; L36-S38 PolarHBondContact O-N 3.47Å; L36-M39 HydrophobicContact CB-CE 4.47Å; L36-M39 HydrophobicContact CD2-CE 3.55Å; L36-M39 HydrophobicContact CG-CE 4.17Å; L36-M39 PolarHBondContact O-N 3.15Å; L36-I40 WeakPolarHBondContact O-CG1 3.26Å; L36-I40 PolarHBondContact O-N 2.96Å
37	Q	96.9	Very high	90.7	Very high	104 Å²	104	102 Å²	102	49%	0.486	52%	0.518	S	S	.	.	H	α-helix	trans	-59.2	-42.4	175.9	-172.6	-178.3	37.7	0	0	111.2	E33 L34 I40 S41	E33-Q37 WeakPolarHBondContact O-CB 3.35Å; E33-Q37 PolarHBondContact O-N 3.37Å; L34-Q37 PolarHBondContact O-N 3.45Å; Q37-I40 PolarHBondContact O-N 3.01Å; Q37-S41 VanDerWaalsContact O-CB 3.32Å; Q37-S41 WeakPolarHBondContact O-CB 3.42Å; Q37-S41 PolarHBondContact O-N 3.47Å; Q37-S41 PolarHBondContact O-OG 2.93Å
38	S	95.6	Very high	88.8	Confident	69 Å²	69	105 Å²	105	48%	0.483	53%	0.531	S	S	.	.	H	α-helix	trans	-60.8	-47.5	174.8	-172.3	0	0	0	0	111	L34 A35 L36 I40 S41 S42	L34-S38 WeakPolarHBondContact O-CB 3.43Å; L34-S38 PolarHBondContact O-N 3.03Å; A35-S38 WeakPolarHBondContact O-CB 3.36Å; A35-S38 PolarHBondContact O-N 3.3Å; L36-S38 VanDerWaalsContact C-N 3.29Å; L36-S38 PolarHBondContact O-N 3.47Å; S38-I40 VanDerWaalsContact C-N 3.35Å; S38-I40 PolarHBondContact O-N 3.41Å; S38-S41 PolarHBondContact O-N 3.49Å; S38-S42 WeakPolarHBondContact O-CB 3.48Å; S38-S42 PolarHBondContact O-N 2.96Å; S38-S42 PolarHBondContact O-OG 3.1Å
39	M	95.2	Very high	86.6	Confident	114 Å²	114	102.2 Å²	102.2	56%	0.562	53%	0.528	S	S	*	.	H	α-helix	trans	-61.5	-41.9	179.5	-71.9	-174	-64.6	0	0	112.3	A35 L36 R43	A35-M39 WeakPolarHBondContact O-CG 3.43Å; A35-M39 PolarHBondContact O-N 3.39Å; L36-M39 HydrophobicContact CB-CE 4.47Å; L36-M39 HydrophobicContact CD2-CE 3.55Å; L36-M39 HydrophobicContact CG-CE 4.17Å; L36-M39 PolarHBondContact O-N 3.15Å; M39-R43 WeakPolarHBondContact O-CB 3.35Å; M39-R43 PolarHBondContact O-N 2.96Å
40	I	94.2	Very high	84.4	Confident	110 Å²	110	101.1 Å²	101.1	56%	0.564	53%	0.53	S	S	*	.	H	α-helix	trans	-65.3	-43	176.8	-66.4	165.9	0	0	0	110.6	L36 Q37 S38 R43 R44	L36-I40 WeakPolarHBondContact O-CG1 3.26Å; L36-I40 PolarHBondContact O-N 2.96Å; Q37-I40 PolarHBondContact O-N 3.01Å; S38-I40 VanDerWaalsContact C-N 3.35Å; S38-I40 PolarHBondContact O-N 3.41Å; I40-R43 PolarHBondContact O-N 3.3Å; I40-R44 WeakPolarHBondContact O-CB 3.49Å; I40-R44 PolarHBondContact O-N 3.38Å
41	S	93.2	Very high	82.2	Confident	71 Å²	71	98.8 Å²	98.8	50%	0.497	53%	0.53	S	S	.	.	H	α-helix	trans	-67.2	-41.4	179.9	-56.2	0	0	0	0	111.6	Q37 S38 R44 G45	Q37-S41 VanDerWaalsContact O-CB 3.32Å; Q37-S41 WeakPolarHBondContact O-CB 3.42Å; Q37-S41 PolarHBondContact O-N 3.47Å; Q37-S41 PolarHBondContact O-OG 2.93Å; S38-S41 PolarHBondContact O-N 3.49Å; S41-R44 PolarHBondContact O-N 3.22Å; S41-G45 PolarHBondContact O-N 3.37Å; S41-G45 VanDerWaalsContact O-N 3.15Å
42	S	89.7	Confident	79.9	Confident	77 Å²	77	101.1 Å²	101.1	54%	0.538	53%	0.534	S	S	.	.	H	α-helix	trans	-60.8	-45.8	174.1	-65.9	0	0	0	0	111.3	S38 R44 G45 D46	S38-S42 WeakPolarHBondContact O-CB 3.48Å; S38-S42 PolarHBondContact O-N 2.96Å; S38-S42 PolarHBondContact O-OG 3.1Å; S42-R44 PolarHBondContact O-N 3.32Å; S42-G45 PolarHBondContact O-N 3.37Å; S42-D46 PolarHBondContact O-N 3.47Å
43	R	86.8	Confident	77	Confident	166 Å²	166	102.4 Å²	102.4	63%	0.626	55%	0.547	S	S	*	.	H	α-helix	trans	-64.2	-40.2	179	-174.4	174.2	173.9	-140.2	-15	112.7	M39 I40 G45 D46 E47	M39-R43 WeakPolarHBondContact O-CB 3.35Å; M39-R43 PolarHBondContact O-N 2.96Å; I40-R43 PolarHBondContact O-N 3.3Å; R43-G45 VanDerWaalsContact C-N 3.31Å; R43-G45 PolarHBondContact O-N 3.45Å; R43-D46 PolarHBondContact O-N 2.9Å; R43-E47 IonicContact CZ-OE1 3.38Å; R43-E47 IonicContact NE-OE1 3.35Å; R43-E47 PolarHBondContact NE-OE1 3.18Å; R43-E47 IonicContact NH2-OE1 2.79Å; R43-E47 PolarHBondContact NH2-OE1 3.5Å; R43-E47 PolarHBondContact O-N 2.96Å
44	R	79.5	Confident	74.2	Confident	183 Å²	183	102.4 Å²	102.4	69%	0.691	55%	0.554	S	S	*	*	H	α-helix	trans	-64.3	-35.8	177.3	-173.5	178.9	-72.1	-111	-0.7	112.2	I40 S41 S42 M48	I40-R44 WeakPolarHBondContact O-CB 3.49Å; I40-R44 PolarHBondContact O-N 3.38Å; S41-R44 PolarHBondContact O-N 3.22Å; S42-R44 PolarHBondContact O-N 3.32Å; R44-M48 PolarHBondContact O-N 3.02Å
45	G	68.2	Low	71.6	Confident	34 Å²	34	103.7 Å²	103.7	35%	0.351	57%	0.568	S	S	.	*	H	α-helix	trans	-66.8	-39.3	172.2	0	0	0	0	0	112.5	S41 S42 R43 M48 L49	S41-G45 PolarHBondContact O-N 3.37Å; S41-G45 VanDerWaalsContact O-N 3.15Å; S42-G45 PolarHBondContact O-N 3.37Å; R43-G45 VanDerWaalsContact C-N 3.31Å; R43-G45 PolarHBondContact O-N 3.45Å; G45-M48 PolarHBondContact O-N 3.15Å; G45-L49 WeakPolarHBondContact O-CG 3.38Å; G45-L49 PolarHBondContact O-N 2.99Å
46	D	62.7	Low	69.1	Low	111 Å²	111	110.6 Å²	110.6	59%	0.594	59%	0.591	S	S	*	*	H	α-helix	trans	-71.8	-34.7	-179	-140.2	18.3	0	0	0	112.7	S42 R43 M48 L49 S50	S42-D46 PolarHBondContact O-N 3.47Å; R43-D46 PolarHBondContact O-N 2.9Å; D46-M48 VanDerWaalsContact C-N 3.32Å; D46-M48 PolarHBondContact O-N 3.26Å; D46-L49 PolarHBondContact O-N 3.34Å; D46-S50 WeakPolarHBondContact O-CB 3.42Å; D46-S50 PolarHBondContact O-N 2.86Å
47	E	59.8	Low	66.5	Low	110 Å²	110	115.2 Å²	115.2	51%	0.514	61%	0.61	S	S	.	*	H	α-helix	trans	-63.9	-36.6	171.9	-91.5	160	-172.5	0	0	112	R43 S51	R43-E47 IonicContact CZ-OE1 3.38Å; R43-E47 IonicContact NE-OE1 3.35Å; R43-E47 PolarHBondContact NE-OE1 3.18Å; R43-E47 IonicContact NH2-OE1 2.79Å; R43-E47 PolarHBondContact NH2-OE1 3.5Å; R43-E47 PolarHBondContact O-N 2.96Å; E47-S51 PolarHBondContact O-N 2.97Å
48	M	57.7	Low	64.1	Low	133 Å²	133	114.8 Å²	114.8	66%	0.655	62%	0.619	S	S	*	*	H	α-helix	trans	-67.1	-41.4	172.3	-74.1	-175.2	141.1	0	0	111.8	R44 G45 D46 S51 H52	R44-M48 PolarHBondContact O-N 3.02Å; G45-M48 PolarHBondContact O-N 3.15Å; D46-M48 VanDerWaalsContact C-N 3.32Å; D46-M48 PolarHBondContact O-N 3.26Å; M48-S51 PolarHBondContact O-OG 2.68Å; M48-H52 PolarHBondContact O-CD2 3.45Å
49	L	53.3	Low	61.9	Low	111 Å²	111	119.7 Å²	119.7	58%	0.581	63%	0.634	S	S	*	*	H	α-helix	trans	-77.7	-36.4	-178.3	-65.5	175.5	0	0	0	113.4	G45 D46 S51 H52 T53	G45-L49 WeakPolarHBondContact O-CG 3.38Å; G45-L49 PolarHBondContact O-N 2.99Å; D46-L49 PolarHBondContact O-N 3.34Å; L49-S51 PolarHBondContact O-N 3.25Å; L49-H52 WeakPolarHBondContact O-CA 3.47Å; L49-H52 PolarHBondContact O-N 3.41Å; L49-T53 PolarHBondContact O-N 2.91Å
50	S	53	Low	59.8	Low	84 Å²	84	122 Å²	122	59%	0.587	65%	0.649	S	S	*	*	H	α-helix	trans	-66.4	-26.2	176.4	-173.6	0	0	0	0	111.9	D46 H52	D46-S50 WeakPolarHBondContact O-CB 3.42Å; D46-S50 PolarHBondContact O-N 2.86Å; S50-H52 PolarHBondContact O-N 3.22Å
51	S	50.8	Low	57.8	Low	80 Å²	80	125 Å²	125	56%	0.559	66%	0.662	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.1	-11.2	169.3	71.9	0	0	0	0	113.9	E47 M48 L49	E47-S51 PolarHBondContact O-N 2.97Å; M48-S51 PolarHBondContact O-OG 2.68Å; L49-S51 PolarHBondContact O-N 3.25Å
52	H	50.9	Low	56	Low	148 Å²	148	127.9 Å²	127.9	69%	0.685	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-113.3	-4.1	-174.6	-66.3	-41	0	0	0	114.9	M48 L49 S50	M48-H52 PolarHBondContact O-CD2 3.45Å; L49-H52 WeakPolarHBondContact O-CA 3.47Å; L49-H52 PolarHBondContact O-N 3.41Å; S50-H52 PolarHBondContact O-N 3.22Å
53	T	37.7	Very low	54.7	Low	104 Å²	104	129.1 Å²	129.1	64%	0.638	68%	0.676	S	S	*	*			trans	-125.8	71.3	-178.6	65.1	0	0	0	0	112.7	L49	L49-T53 PolarHBondContact O-N 2.91Å
54	V	39.2	Very low	53.6	Low	107 Å²	107	127 Å²	127	65%	0.648	67%	0.672	S	S	*	*	S	Bend	trans	-134.4	122.2	149.8	-174.9	0	0	0	0	107.1
55	P	43.4	Very low	53.2	Low	114 Å²	114	124.2 Å²	124.2	74%	0.74	68%	0.676	S	S	*	*			trans	-67.4	145.6	-166.4	28.9	-34.2	0	0	0	111	Q57	P55-Q57 PolarHBondContact O-N 2.83Å
56	E	44.6	Very low	53.5	Low	193 Å²	193	129.3 Å²	129.3	90%	0.902	70%	0.695	S	S	*	*	S	Bend	trans	-36.5	92.9	172.5	-65.1	177.7	124.9	0	0	113.2
57	Q	44.5	Very low	54.3	Low	196 Å²	196	127 Å²	127	92%	0.916	68%	0.683	S	S	*	*	S	Bend	trans	-174.7	7.7	144.4	-114.7	175.2	22.4	0	0	117	P55	P55-Q57 PolarHBondContact O-N 2.83Å
58	S	46.5	Very low	55.3	Low	96 Å²	96	129 Å²	129	67%	0.671	69%	0.692	S	S	*	*			trans	-140.1	50.6	172.9	49.7	0	0	0	0	111.6	D60	S58-D60 VanDerWaalsContact C-N 3.33Å; S58-D60 PolarHBondContact O-N 3.45Å
59	H	49.6	Very low	56.5	Low	171 Å²	171	125 Å²	125	79%	0.792	68%	0.68	S	S	*	*	G	3₁₀ helix	trans	-81.4	-3.3	-174.6	-160.9	58.8	0	0	0	114.6	M61	H59-M61 PolarHBondContact O-N 3.37Å
60	D	50	Low	57.7	Low	163 Å²	163	121.6 Å²	121.6	87%	0.872	67%	0.666	S	S	*	*	G	3₁₀ helix	trans	-83.7	-3.1	-173.6	-105.2	-4.6	0	0	0	115.5	S58	S58-D60 VanDerWaalsContact C-N 3.33Å; S58-D60 PolarHBondContact O-N 3.45Å
61	M	52.9	Low	59	Low	173 Å²	173	122 Å²	122	85%	0.852	66%	0.66	S	S	*	*	G	3₁₀ helix	trans	-128.2	8.2	-175.8	-75.9	-173.4	-83.3	0	0	115.4	H59 V63	H59-M61 PolarHBondContact O-N 3.37Å; M61-V63 PolarHBondContact O-N 2.95Å
62	L	55.5	Low	60.5	Low	132 Å²	132	124 Å²	124	69%	0.691	66%	0.664	S	S	*	*			trans	-85.9	57	173.5	-141.2	134.1	0	0	0	109.9	H64	L62-H64 PolarHBondContact O-N 3.44Å
63	V	61.8	Low	62.1	Low	103 Å²	103	124 Å²	124	62%	0.624	67%	0.665	S	S	*	*			trans	-62.9	104.8	174.4	-175.9	0	0	0	0	106.7	M61 V65	M61-V63 PolarHBondContact O-N 2.95Å; V63-V65 PolarHBondContact O-N 2.92Å
64	H	64.1	Low	64	Low	120 Å²	120	124.6 Å²	124.6	56%	0.556	67%	0.668	S	S	*	*			trans	-56.5	102.2	176.3	-174.7	-69.8	0	0	0	108.9	L62 D66 N67	L62-H64 PolarHBondContact O-N 3.44Å; H64-D66 PolarHBondContact CE1-O 2.65Å; H64-D66 VanDerWaalsContact ND1-C 3.28Å; H64-D66 PolarHBondContact O-N 3.12Å; H64-N67 HydrophobicContact CB-CB 4.05Å; H64-N67 WeakPolarHBondContact ND1-CB 3.39Å; H64-N67 PolarHBondContact ND1-N 2.89Å; H64-N67 WeakPolarHBondContact O-CB 3.35Å; H64-N67 PolarHBondContact O-N 3.37Å; H64-N67 VanDerWaalsContact O-N 3.16Å
65	V	71.8	Confident	66.2	Low	125 Å²	125	125.4 Å²	125.4	76%	0.758	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62	-30.7	-169.8	-114.9	0	0	0	0	112.5	V63	V63-V65 PolarHBondContact O-N 2.92Å
66	D	73.6	Confident	68.2	Low	141 Å²	141	126.8 Å²	126.8	75%	0.754	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.1	30.2	180	-67.3	-26	0	0	0	112.7	H64	H64-D66 PolarHBondContact CE1-O 2.65Å; H64-D66 VanDerWaalsContact ND1-C 3.28Å; H64-D66 PolarHBondContact O-N 3.12Å
67	N	80.6	Confident	70.2	Confident	63 Å²	63	126 Å²	126	34%	0.337	67%	0.671	S	S	.	*			trans	-89.6	112.8	174.1	-175.4	42.8	0	0	0	109.2	H64 A69 S70 I71	H64-N67 HydrophobicContact CB-CB 4.05Å; H64-N67 WeakPolarHBondContact ND1-CB 3.39Å; H64-N67 PolarHBondContact ND1-N 2.89Å; H64-N67 WeakPolarHBondContact O-CB 3.35Å; H64-N67 PolarHBondContact O-N 3.37Å; H64-N67 VanDerWaalsContact O-N 3.16Å; N67-A69 PolarHBondContact O-N 3.09Å; N67-S70 WeakPolarHBondContact CB-OG 3.32Å; N67-S70 PolarHBondContact ND2-N 3.15Å; N67-S70 PolarHBondContact ND2-OG 3.39Å; N67-S70 WeakPolarHBondContact O-CB 3.43Å; N67-S70 PolarHBondContact O-N 3.29Å; N67-I71 PolarHBondContact O-N 3.1Å; N67-I71 VanDerWaalsContact O-N 3.07Å
68	E	79.8	Confident	72	Confident	151 Å²	151	123.2 Å²	123.2	71%	0.706	66%	0.662	S	S	*	*	H	α-helix	trans	-51.4	-41.8	179.3	-175.5	179.9	-178.8	0	0	111.8	S70 I71 N72	E68-S70 PolarHBondContact O-N 3.38Å; E68-I71 PolarHBondContact O-N 3.34Å; E68-N72 PolarHBondContact O-N 2.86Å; E68-N72 PolarHBondContact O-ND2 3.44Å
69	A	82.4	Confident	73.5	Confident	50 Å²	50	124.3 Å²	124.3	41%	0.413	67%	0.669	S	S	.	*	H	α-helix	trans	-66.5	-34	178.2	0	0	0	0	0	113.1	N67 Q73	N67-A69 PolarHBondContact O-N 3.09Å; A69-Q73 VanDerWaalsContact O-CG 3.3Å; A69-Q73 WeakPolarHBondContact O-CG 3.43Å; A69-Q73 PolarHBondContact O-N 3.36Å
70	S	79.7	Confident	74.7	Confident	40 Å²	40	122.7 Å²	122.7	28%	0.28	67%	0.671	S	S	.	*	H	α-helix	trans	-72.2	-38.6	177.6	-60	0	0	0	0	111.8	N67 E68 N72 Q73	N67-S70 WeakPolarHBondContact CB-OG 3.32Å; N67-S70 PolarHBondContact ND2-N 3.15Å; N67-S70 PolarHBondContact ND2-OG 3.39Å; N67-S70 WeakPolarHBondContact O-CB 3.43Å; N67-S70 PolarHBondContact O-N 3.29Å; E68-S70 PolarHBondContact O-N 3.38Å; S70-N72 VanDerWaalsContact C-N 3.32Å; S70-N72 PolarHBondContact O-N 3Å; S70-Q73 PolarHBondContact O-N 2.9Å
71	I	79.4	Confident	75.7	Confident	92 Å²	92	124.3 Å²	124.3	47%	0.472	67%	0.671	S	S	.	*	H	α-helix	trans	-61.6	-44	177.4	-66	169.3	0	0	0	110.1	N67 E68 Q73 T74	N67-I71 PolarHBondContact O-N 3.1Å; N67-I71 VanDerWaalsContact O-N 3.07Å; E68-I71 PolarHBondContact O-N 3.34Å; I71-Q73 PolarHBondContact O-N 3.03Å; I71-T74 PolarHBondContact O-N 3.14Å; I71-T74 PolarHBondContact O-OG1 3.44Å
72	N	83.5	Confident	75.9	Confident	121 Å²	121	120.4 Å²	120.4	65%	0.647	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.5	-14.2	-178.5	-70.3	-26.9	0	0	0	114.4	E68 S70	E68-N72 PolarHBondContact O-N 2.86Å; E68-N72 PolarHBondContact O-ND2 3.44Å; S70-N72 VanDerWaalsContact C-N 3.32Å; S70-N72 PolarHBondContact O-N 3Å
73	Q	82.7	Confident	75.9	Confident	149 Å²	149	119.2 Å²	119.2	70%	0.696	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.2	-1.6	177.3	-73.2	176.2	16.8	0	0	113.3	A69 S70 I71 T75	A69-Q73 VanDerWaalsContact O-CG 3.3Å; A69-Q73 WeakPolarHBondContact O-CG 3.43Å; A69-Q73 PolarHBondContact O-N 3.36Å; S70-Q73 PolarHBondContact O-N 2.9Å; I71-Q73 PolarHBondContact O-N 3.03Å; Q73-T75 PolarHBondContact O-N 2.99Å; Q73-T75 VanDerWaalsContact O-N 3.09Å
74	T	79.6	Confident	75.6	Confident	116 Å²	116	120 Å²	120	71%	0.712	66%	0.655	S	S	*	*			trans	-66	111.8	178.1	54.1	0	0	0	0	110.5	I71	I71-T74 PolarHBondContact O-N 3.14Å; I71-T74 PolarHBondContact O-OG1 3.44Å
75	T	84.2	Confident	75.1	Confident	125 Å²	125	120.8 Å²	120.8	77%	0.767	67%	0.669	S	S	*	*			trans	-91.5	120.9	177.8	-58.1	0	0	0	0	108.7	Q73 E77	Q73-T75 PolarHBondContact O-N 2.99Å; Q73-T75 VanDerWaalsContact O-N 3.09Å; T75-E77 PolarHBondContact O-N 3.12Å
76	L	85.7	Confident	74.1	Confident	143 Å²	143	122.2 Å²	122.2	75%	0.749	67%	0.667	S	S	*	*			trans	-84.3	112	-179.5	-172.2	70.4	0	0	0	110.2	L78	L76-L78 HydrophobicContact CD1-CD2 4.32Å; L76-L78 HydrophobicContact CD2-CD1 3.93Å; L76-L78 HydrophobicContact CD2-CD2 3.96Å; L76-L78 HydrophobicContact CD2-CG 3.92Å; L76-L78 HydrophobicContact CG-CD1 4.49Å; L76-L78 HydrophobicContact CG-CD2 3.93Å; L76-L78 HydrophobicContact CG-CG 3.95Å
77	E	86.8	Confident	73.1	Confident	176 Å²	176	123.9 Å²	123.9	82%	0.822	67%	0.671	S	S	*	*			trans	-91.4	102	174.2	-66.5	-176.5	-175.1	0	0	110.2	T75	T75-E77 PolarHBondContact O-N 3.12Å
78	L	81.4	Confident	71.7	Confident	138 Å²	138	129.9 Å²	129.9	72%	0.723	70%	0.697	S	S	*	*			trans	-99.2	107.6	173.8	-61	178.9	0	0	0	109.2	L76	L76-L78 HydrophobicContact CD1-CD2 4.32Å; L76-L78 HydrophobicContact CD2-CD1 3.93Å; L76-L78 HydrophobicContact CD2-CD2 3.96Å; L76-L78 HydrophobicContact CD2-CG 3.92Å; L76-L78 HydrophobicContact CG-CD1 4.49Å; L76-L78 HydrophobicContact CG-CD2 3.93Å; L76-L78 HydrophobicContact CG-CG 3.95Å
79	S	79.3	Confident	70.1	Confident	118 Å²	118	131.7 Å²	131.7	83%	0.825	71%	0.705	S	S	*	*			trans	-84.6	115.1	169	-71.2	0	0	0	0	109.4	K81	S79-K81 PolarHBondContact O-N 3.45Å; S79-K81 VanDerWaalsContact O-N 3.12Å
80	T	74	Confident	68.4	Low	137 Å²	137	138.5 Å²	138.5	84%	0.84	73%	0.728	S	S	*	*			trans	-76.1	95.5	164.2	47.7	0	0	0	0	107.5	S82	T80-S82 PolarHBondContact O-N 3.16Å
81	K	70.7	Confident	66.9	Low	198 Å²	198	145.8 Å²	145.8	86%	0.861	76%	0.758	S	S	*	*			trans	-61.4	109.8	164.8	-168.2	173.2	179.2	-173.6	0	105.4	S79 H83	S79-K81 PolarHBondContact O-N 3.45Å; S79-K81 VanDerWaalsContact O-N 3.12Å; K81-H83 VanDerWaalsContact C-N 3.35Å; K81-H83 PolarHBondContact O-N 3.31Å
82	S	57.4	Low	65.5	Low	90 Å²	90	150.1 Å²	150.1	63%	0.629	78%	0.776	S	S	*	*			trans	-57.3	102.5	176.8	58.9	0	0	0	0	107.2	T80 V84	T80-S82 PolarHBondContact O-N 3.16Å; S82-V84 PolarHBondContact O-N 3.2Å
83	H	55.7	Low	63.8	Low	108 Å²	108	153.5 Å²	153.5	50%	0.5	79%	0.788	S	S	.	*			trans	-67.1	71.8	171.1	178.4	-55.3	0	0	0	107.6	K81 E86	K81-H83 VanDerWaalsContact C-N 3.35Å; K81-H83 PolarHBondContact O-N 3.31Å; H83-E86 IonicContact CD2-OE2 3.71Å; H83-E86 VanDerWaalsContact CE1-C 3.49Å; H83-E86 WeakPolarHBondContact CE1-CB 3.47Å; H83-E86 VanDerWaalsContact NE2-CB 3.27Å; H83-E86 WeakPolarHBondContact NE2-CB 3.47Å; H83-E86 IonicContact NE2-OE2 3.64Å
84	V	55.9	Low	62.1	Low	118 Å²	118	155.5 Å²	155.5	72%	0.715	80%	0.798	S	S	*	*			trans	-105.2	27.7	176.5	-178.9	0	0	0	0	108.8	S82	S82-V84 PolarHBondContact O-N 3.2Å
85	T	52.9	Low	60.5	Low	137 Å²	137	159 Å²	159	84%	0.84	81%	0.806	S	S	*	*	S	Bend	trans	-156.7	18.2	-180	3	0	0	0	0	115.7
86	E	51.7	Low	58.7	Low	156 Å²	156	159.2 Å²	159.2	73%	0.729	81%	0.813	S	S	*	*	S	Bend	trans	-118.8	0.9	171.6	-98.9	169.7	-172.9	0	0	112.8	H83	H83-E86 IonicContact CD2-OE2 3.71Å; H83-E86 VanDerWaalsContact CE1-C 3.49Å; H83-E86 WeakPolarHBondContact CE1-CB 3.47Å; H83-E86 VanDerWaalsContact NE2-CB 3.27Å; H83-E86 WeakPolarHBondContact NE2-CB 3.47Å; H83-E86 IonicContact NE2-OE2 3.64Å
87	E	51.8	Low	57.1	Low	175 Å²	175	160 Å²	160	82%	0.818	82%	0.818	S	S	*	*	S	Bend	trans	-92.2	9.4	176.1	-70.5	-155.4	162.2	0	0	114.8
88	E	50.5	Low	55.6	Low	190 Å²	190	160.9 Å²	160.9	89%	0.888	84%	0.843	S	S	*	*	S	Bend	trans	-116	0	179.9	-73.1	-164.4	167.8	0	0	116.1
89	E	46.6	Very low	54.3	Low	189 Å²	189	162 Å²	162	88%	0.883	85%	0.849	S	S	*	*	S	Bend	trans	-124.2	3.1	-176.3	-73.8	-164.3	168.7	0	0	117.8
90	E	46.2	Very low	53	Low	193 Å²	193	164.3 Å²	164.3	90%	0.902	85%	0.85	S	S	*	*	S	Bend	trans	-121.8	18.3	175.1	-72.1	-166.6	-177.4	0	0	115.4	E92	E90-E92 VanDerWaalsContact C-N 3.3Å; E90-E92 PolarHBondContact O-N 3.13Å
91	E	49.7	Very low	51.8	Low	192 Å²	192	165.8 Å²	165.8	90%	0.897	85%	0.851	S	S	*	*	S	Bend	trans	-91	46.8	160	-74.4	-162.8	172.9	0	0	111.5
92	E	50.2	Low	50.7	Low	184 Å²	184	163.9 Å²	163.9	86%	0.86	85%	0.85	S	S	*	*	S	Bend	trans	-143.1	22.6	172.3	-83.1	-153.6	179.3	0	0	115.9	E90	E90-E92 VanDerWaalsContact C-N 3.3Å; E90-E92 PolarHBondContact O-N 3.13Å
93	E	46.8	Very low	50.3	Low	192 Å²	192	168.6 Å²	168.6	90%	0.897	86%	0.864	S	S	*	*			trans	-143.5	50.9	166.1	-71.7	-158.1	-163.8	0	0	114.3
94	E	46.3	Very low	49.9	Very low	191 Å²	191	172.6 Å²	172.6	89%	0.893	89%	0.888	S	S	*	*			trans	-110.4	64.9	162.6	-77.3	-78.5	-178.4	0	0	109.5
95	E	46.9	Very low	49.5	Very low	189 Å²	189	176.5 Å²	176.5	88%	0.883	90%	0.9	S	S	*	*			trans	-164.2	74	162	-120.5	-174.3	-158.2	0	0	112.4
96	S	47.3	Very low	49.2	Very low	130 Å²	130	179.5 Å²	179.5	91%	0.909	91%	0.905	S	S	*	*			trans	-162.2	88.6	151	-89.8	0	0	0	0	113
97	D	52	Low	49	Very low	160 Å²	160	181.5 Å²	181.5	86%	0.856	92%	0.92	S	S	*	*			trans	-43.5	126.7	163	-169	19.8	0	0	0	115.1
98	S	53.7	Low	48.8	Very low	193 Å²	193	182.1 Å²	182.1	100%	1.35	93%	0.929	S	S	*	*			trans	-167.2	0	155.4	-77.5	0	0	0	0	112.7

Retrieved 98 of 98 residues in 249.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).