CSPD_ECOLI Loading...

Cold shock-like protein CspD

Inhibits DNA replication at both initiation and elongation steps, most probably by binding to the opened, single-stranded regions at replication forks. Plays a regulatory role in chromosomal replication in nutrient-depleted cells. Involved in persister cell formation, acting downstream of mRNA interferase (toxin) MqsR. Overproduction is toxic.

AlphaFold DB , UniProt , Accession P0A968, Species ECOLI (Escherichia coli (strain K12)), Gene cspD, Length 74 aa.

						>CSPD_ECOLI|P0A968|cspD
MEKGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAGQSVQFDVHQGPKGNHASVIVPVEVEAAVA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	81.3	Confident	91.7	Very high	139 Å²	139	68.9 Å²	68.9	69%	0.685	33%	0.326	S	S	*	.				0	109.3	0	-65.8	-173.5	173.9	0	0	109.9	Q49 F50 D51 V63	M1-Q49 HydrophobicContact CB-CG 4.41Å; M1-F50 CarbonylContact C-O 3.51Å; M1-F50 WeakPolarHBondContact CA-O 3.36Å; M1-D51 WeakPolarHBondContact CA-OD2 3.36Å; M1-D51 WeakPolarHBondContact CG-OD2 3.46Å; M1-D51 PolarHBondContact N-OD2 2.84Å; M1-V63 HydrophobicContact CE-CG1 3.98Å
2	E	90.3	Very high	91.5	Very high	94 Å²	94	71.5 Å²	71.5	44%	0.439	37%	0.368	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.4	163.2	173.9	-135.7	155.5	89.9	0	0	110.1	Q49 F50 V52	E2-Q49 CarbonylContact O-C 3.56Å; E2-Q49 VanDerWaalsContact O-CA 3.3Å; E2-Q49 WeakPolarHBondContact O-CA 3.23Å; E2-Q49 WeakPolarHBondContact O-CG 3.19Å; E2-F50 HydrophobicContact CB-CE2 4.35Å; E2-F50 PolarHBondContact N-O 2.96Å; E2-F50 PolarHBondContact O-N 3.41Å; E2-V52 HydrophobicContact CB-CG2 4.45Å
3	K	92.2	Very high	91.5	Very high	105 Å²	105	76.7 Å²	76.7	46%	0.457	39%	0.386	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	151.3	172.6	-77	-178.4	-179	-175.9	0	109.6	E21 Q49	K3-E21 WeakPolarHBondContact O-CB 3.1Å; K3-E21 PolarHBondContact O-N 2.89Å; K3-Q49 VanDerWaalsContact CE-NE2 3.28Å; K3-Q49 HydrophobicContact CG-CG 3.83Å
4	G	93.7	Very high	91.5	Very high	0 Å²	0	71.9 Å²	71.9	0%	0	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-167.3	177.6	173.6	0	0	0	0	0	111.8	C19 S47 V48	G4-C19 CarbonylContact C-O 3.48Å; G4-C19 WeakPolarHBondContact CA-O 3.44Å; G4-S47 CarbonylContact O-C 3.51Å; G4-S47 WeakPolarHBondContact O-CA 3.44Å; G4-V48 PolarHBondContact N-O 3.01Å; G4-V48 PolarHBondContact O-N 2.91Å
5	T	93.6	Very high	91.6	Very high	54 Å²	54	70.9 Å²	70.9	33%	0.331	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	128.7	-177.2	-55.4	0	0	0	0	108.8	K7 C19	T5-K7 PolarHBondContact O-N 2.95Å; T5-C19 PolarHBondContact N-O 2.78Å; T5-C19 PolarHBondContact O-N 2.91Å
6	V	94.1	Very high	91.8	Very high	1 Å²	1	66.4 Å²	66.4	1%	0.006	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.9	113.8	177.8	177.4	0	0	0	0	108.2	F9 I18 L42 K43 A44 G45 Q46 V48	V6-F9 HydrophobicContact CG1-CB 4Å; V6-I18 HydrophobicContact CG2-CG1 4.2Å; V6-L42 HydrophobicContact CG1-CB 4.1Å; V6-L42 HydrophobicContact CG2-CB 3.97Å; V6-L42 HydrophobicContact CG2-CD1 3.98Å; V6-L42 HydrophobicContact CG2-CG 4.37Å; V6-K43 VanDerWaalsContact CB-O 3.26Å; V6-K43 WeakPolarHBondContact CB-O 3.45Å; V6-K43 WeakPolarHBondContact CG1-O 3.36Å; V6-A44 CarbonylContact O-C 3.59Å; V6-A44 WeakPolarHBondContact O-CA 3.01Å; V6-G45 PolarHBondContact O-N 2.8Å; V6-Q46 HydrophobicContact CG2-CB 4.5Å; V6-Q46 WeakPolarHBondContact CG2-O 3.16Å; V6-Q46 PolarHBondContact N-O 3.28Å; V6-V48 HydrophobicContact CG2-CB 4.35Å; V6-V48 HydrophobicContact CG2-CG1 3.49Å; V6-V48 VanDerWaalsContact CG2-CG1 3.49Å; V6-V48 HydrophobicContact CG2-CG2 3.8Å
7	K	93.6	Very high	91.9	Very high	105 Å²	105	66 Å²	66	46%	0.457	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.1	-48.3	177.6	-170	179.9	-166.8	157.2	0	109.7	T5 F17 D26	T5-K7 PolarHBondContact O-N 2.95Å; K7-F17 WeakPolarHBondContact CB-O 3.05Å; K7-F17 PolarHBondContact N-O 3.25Å; K7-D26 WeakPolarHBondContact CD-OD1 3.4Å; K7-D26 IonicContact NZ-OD1 2.85Å; K7-D26 PolarHBondContact NZ-OD1 2.87Å; K7-D26 IonicContact NZ-OD2 2.71Å; K7-D26 PolarHBondContact NZ-OD2 2.79Å
8	W	94.1	Very high	92.1	Very high	101 Å²	101	62.3 Å²	62.3	38%	0.383	31%	0.312	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-161.9	152.8	173.2	63.3	-87.2	0	0	0	109.7	N10 F15 G16 F17	W8-N10 HydrophobicContact CE3-CB 4.38Å; W8-N10 HydrophobicContact CZ3-CB 3.93Å; W8-F15 AromaticContact CH2-CD2 3.98Å; W8-F15 HydrophobicContact CH2-CD2 3.98Å; W8-F15 AromaticContact CH2-CE2 3.64Å; W8-F15 HydrophobicContact CH2-CE2 3.64Å; W8-F15 HydrophobicContact CZ3-CD2 4.31Å; W8-F15 HydrophobicContact CZ3-CE2 4.19Å; W8-G16 CarbonylContact O-C 3.56Å; W8-G16 WeakPolarHBondContact O-CA 3.3Å; W8-F17 AromaticContact CE2-CD2 3.61Å; W8-F17 HydrophobicContact CH2-CD2 4.2Å; W8-F17 HydrophobicContact CH2-CE2 4.44Å; W8-F17 AromaticContact CZ2-CD2 3.35Å; W8-F17 HydrophobicContact CZ2-CD2 3.35Å; W8-F17 AromaticContact CZ2-CE2 3.73Å; W8-F17 HydrophobicContact CZ2-CE2 3.73Å; W8-F17 PolarHBondContact N-O 2.73Å; W8-F17 AromaticContact NE1-CD2 3.68Å; W8-F17 PolarHBondContact O-N 2.7Å
9	F	93.6	Very high	92.2	Very high	21 Å²	21	61.4 Å²	61.4	9%	0.092	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.9	129.4	174.1	-166.4	-93.1	0	0	0	110	V6 N11 A29 I34 L42	V6-F9 HydrophobicContact CG1-CB 4Å; F9-N11 VanDerWaalsContact CD1-OD1 3.23Å; F9-N11 WeakPolarHBondContact CD1-OD1 3.15Å; F9-N11 WeakPolarHBondContact CE1-OD1 3.35Å; F9-A29 HydrophobicContact CE2-CB 4.49Å; F9-I34 HydrophobicContact CE1-CD1 4.44Å; F9-I34 HydrophobicContact CE2-CD1 4.04Å; F9-I34 HydrophobicContact CZ-CD1 3.7Å; F9-L42 HydrophobicContact CB-CB 3.89Å; F9-L42 HydrophobicContact CD1-CB 4.19Å; F9-L42 HydrophobicContact CD2-CB 4.07Å; F9-L42 HydrophobicContact CD2-CD1 3.84Å; F9-L42 HydrophobicContact CD2-CG 4.28Å; F9-L42 HydrophobicContact CE2-CD1 4.04Å; F9-L42 HydrophobicContact CE2-CG 4.48Å; F9-L42 HydrophobicContact CG-CB 3.8Å; F9-L42 HydrophobicContact CG-CD1 4.44Å; F9-L42 HydrophobicContact CG-CG 4.44Å
10	N	94	Very high	92.2	Very high	57 Å²	57	59 Å²	59	31%	0.305	30%	0.3	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	100.2	178.4	-173.3	-31.5	0	0	0	109.4	W8 A12 K13 G14 F15	W8-N10 HydrophobicContact CE3-CB 4.38Å; W8-N10 HydrophobicContact CZ3-CB 3.93Å; N10-A12 PolarHBondContact O-N 3.12Å; N10-A12 WeakPolarHBondContact OD1-CB 3.38Å; N10-A12 PolarHBondContact OD1-N 2.75Å; N10-K13 HydrophobicContact CB-CB 4.32Å; N10-K13 PolarHBondContact O-N 2.76Å; N10-K13 PolarHBondContact OD1-N 3.23Å; N10-G14 PolarHBondContact O-N 3.23Å; N10-F15 PolarHBondContact N-O 2.86Å; N10-F15 PolarHBondContact O-N 3.12Å
11	N	88.1	Confident	92.1	Very high	81 Å²	81	62.9 Å²	62.9	43%	0.433	32%	0.317	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.5	-27.6	-180	-62.1	-58.1	0	0	0	113.4	F9 T41	F9-N11 VanDerWaalsContact CD1-OD1 3.23Å; F9-N11 WeakPolarHBondContact CD1-OD1 3.15Å; F9-N11 WeakPolarHBondContact CE1-OD1 3.35Å; N11-T41 HydrophobicContact CB-CG2 4.11Å; N11-T41 WeakPolarHBondContact OD1-CA 3.46Å; N11-T41 WeakPolarHBondContact OD1-CB 3.4Å; N11-T41 WeakPolarHBondContact OD1-CG2 3.49Å
12	A	89.8	Confident	92.3	Very high	100 Å²	100	60 Å²	60	83%	0.826	32%	0.323	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74	-33.5	177.3	0	0	0	0	0	112.2	N10	N10-A12 PolarHBondContact O-N 3.12Å; N10-A12 WeakPolarHBondContact OD1-CB 3.38Å; N10-A12 PolarHBondContact OD1-N 2.75Å
13	K	91.5	Very high	91.8	Very high	139 Å²	139	57.9 Å²	57.9	60%	0.604	33%	0.326	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.7	-17.8	176.7	-63.9	-160.4	176.6	-169.2	0	114.1	N10 F15	N10-K13 HydrophobicContact CB-CB 4.32Å; N10-K13 PolarHBondContact O-N 2.76Å; N10-K13 PolarHBondContact OD1-N 3.23Å; K13-F15 HydrophobicContact CB-CD1 3.58Å; K13-F15 HydrophobicContact CB-CE1 3.41Å; K13-F15 VanDerWaalsContact CB-CE1 3.41Å; K13-F15 HydrophobicContact CB-CZ 4.31Å; K13-F15 HydrophobicContact CD-CD1 4.46Å; K13-F15 HydrophobicContact CD-CE1 3.45Å; K13-F15 VanDerWaalsContact CD-CE1 3.45Å; K13-F15 HydrophobicContact CD-CZ 3.77Å; K13-F15 HydrophobicContact CG-CE1 4.07Å
14	G	91.7	Very high	91.4	Very high	9 Å²	9	56.3 Å²	56.3	9%	0.093	34%	0.34	C	S	.	.	T	Hydrogen-bonded Turn	trans	74.8	24.6	-177.8	0	0	0	0	0	114.5	N10 H30 Y31	N10-G14 PolarHBondContact O-N 3.23Å; G14-H30 PolarHBondContact O-CD2 2.91Å; G14-Y31 WeakPolarHBondContact O-CB 3.42Å; G14-Y31 VanDerWaalsContact O-CD1 3.3Å; G14-Y31 WeakPolarHBondContact O-CD1 3.02Å; G14-Y31 PolarHBondContact O-N 3.18Å
15	F	92.7	Very high	91.1	Very high	57 Å²	57	62.7 Å²	62.7	25%	0.25	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.5	162.3	175.6	71.1	-97	0	0	0	112.6	W8 N10 K13 F28 A29	W8-F15 AromaticContact CH2-CD2 3.98Å; W8-F15 HydrophobicContact CH2-CD2 3.98Å; W8-F15 AromaticContact CH2-CE2 3.64Å; W8-F15 HydrophobicContact CH2-CE2 3.64Å; W8-F15 HydrophobicContact CZ3-CD2 4.31Å; W8-F15 HydrophobicContact CZ3-CE2 4.19Å; N10-F15 PolarHBondContact N-O 2.86Å; N10-F15 PolarHBondContact O-N 3.12Å; K13-F15 HydrophobicContact CB-CD1 3.58Å; K13-F15 HydrophobicContact CB-CE1 3.41Å; K13-F15 VanDerWaalsContact CB-CE1 3.41Å; K13-F15 HydrophobicContact CB-CZ 4.31Å; K13-F15 HydrophobicContact CD-CD1 4.46Å; K13-F15 HydrophobicContact CD-CE1 3.45Å; K13-F15 VanDerWaalsContact CD-CE1 3.45Å; K13-F15 HydrophobicContact CD-CZ 3.77Å; K13-F15 HydrophobicContact CG-CE1 4.07Å; F15-F28 HydrophobicContact CB-CE2 3.9Å; F15-F28 HydrophobicContact CB-CZ 3.83Å; F15-F28 AromaticContact CD2-CE2 3.86Å; F15-F28 HydrophobicContact CD2-CE2 3.86Å; F15-F28 HydrophobicContact CG-CE2 4.11Å; F15-F28 HydrophobicContact CG-CZ 4.32Å; F15-A29 CarbonylContact C-O 3.57Å; F15-A29 VanDerWaalsContact CA-O 3.23Å; F15-A29 WeakPolarHBondContact CA-O 3.41Å; F15-A29 WeakPolarHBondContact CB-O 3.41Å
16	G	94.5	Very high	91.1	Very high	0 Å²	0	63.1 Å²	63.1	0%	0	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-166	-162.7	179.3	0	0	0	0	0	111.9	W8 A29	W8-G16 CarbonylContact O-C 3.56Å; W8-G16 WeakPolarHBondContact O-CA 3.3Å; G16-A29 PolarHBondContact N-O 3.44Å; G16-A29 PolarHBondContact O-N 3.07Å
17	F	94.3	Very high	91	Very high	59 Å²	59	63.2 Å²	63.2	26%	0.259	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.3	144.2	176.9	-77.8	-93.7	0	0	0	111	K7 W8 D26 I27 F28	K7-F17 WeakPolarHBondContact CB-O 3.05Å; K7-F17 PolarHBondContact N-O 3.25Å; W8-F17 AromaticContact CE2-CD2 3.61Å; W8-F17 HydrophobicContact CH2-CD2 4.2Å; W8-F17 HydrophobicContact CH2-CE2 4.44Å; W8-F17 AromaticContact CZ2-CD2 3.35Å; W8-F17 HydrophobicContact CZ2-CD2 3.35Å; W8-F17 AromaticContact CZ2-CE2 3.73Å; W8-F17 HydrophobicContact CZ2-CE2 3.73Å; W8-F17 PolarHBondContact N-O 2.73Å; W8-F17 AromaticContact NE1-CD2 3.68Å; W8-F17 PolarHBondContact O-N 2.7Å; F17-D26 HydrophobicContact CB-CB 4.2Å; F17-D26 HydrophobicContact CD1-CB 3.53Å; F17-D26 HydrophobicContact CE1-CB 4.26Å; F17-D26 HydrophobicContact CG-CB 4.19Å; F17-I27 CarbonylContact C-O 3.4Å; F17-I27 VanDerWaalsContact CA-O 3.3Å; F17-I27 WeakPolarHBondContact CA-O 3.38Å; F17-F28 HydrophobicContact CE1-CB 4.16Å; F17-F28 HydrophobicContact CE1-CD2 4.31Å; F17-F28 HydrophobicContact CE2-CD2 4.16Å; F17-F28 AromaticContact CZ-CD2 3.95Å; F17-F28 HydrophobicContact CZ-CD2 3.95Å
18	I	94.9	Very high	91	Very high	0 Å²	0	61.7 Å²	61.7	0%	0	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	130.6	177.3	-58.4	161.5	0	0	0	107.8	V6 I27 A29 V48 F50 A61 I64	V6-I18 HydrophobicContact CG2-CG1 4.2Å; I18-I27 PolarHBondContact N-O 3.44Å; I18-I27 PolarHBondContact O-N 2.71Å; I18-A29 HydrophobicContact CD1-CB 3.6Å; I18-A29 HydrophobicContact CG1-CB 3.86Å; I18-V48 HydrophobicContact CB-CG2 4.46Å; I18-V48 HydrophobicContact CD1-CG2 3.69Å; I18-V48 HydrophobicContact CG1-CG2 3.95Å; I18-V48 HydrophobicContact CG2-CG2 3.63Å; I18-F50 HydrophobicContact CB-CE1 4.24Å; I18-F50 HydrophobicContact CB-CZ 4.4Å; I18-F50 HydrophobicContact CD1-CD1 4.03Å; I18-F50 HydrophobicContact CD1-CE1 4.37Å; I18-F50 HydrophobicContact CD1-CG 4.35Å; I18-F50 HydrophobicContact CG2-CD1 4.04Å; I18-F50 HydrophobicContact CG2-CE1 3.31Å; I18-F50 HydrophobicContact CG2-CZ 3.71Å; I18-A61 HydrophobicContact CD1-CB 4.05Å; I18-I64 HydrophobicContact CD1-CD1 4.09Å; I18-I64 HydrophobicContact CD1-CG1 4.41Å; I18-I64 HydrophobicContact CD1-CG2 4.3Å
19	C	93.5	Very high	91	Very high	44 Å²	44	56.9 Å²	56.9	30%	0.297	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.2	118.5	168	-78.4	0	0	0	0	108.7	G4 T5 D26	G4-C19 CarbonylContact C-O 3.48Å; G4-C19 WeakPolarHBondContact CA-O 3.44Å; T5-C19 PolarHBondContact N-O 2.78Å; T5-C19 PolarHBondContact O-N 2.91Å; C19-D26 PolarHBondContact SG-OD1 2.97Å
20	P	93.4	Very high	91	Very high	13 Å²	13	58.7 Å²	58.7	8%	0.084	36%	0.355	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.7	143.6	174.5	27.4	-29.3	0	0	0	110.3	G22 G23 E25 I27 F50	P20-G22 VanDerWaalsContact C-N 3.28Å; P20-G22 PolarHBondContact O-N 2.88Å; P20-G23 PolarHBondContact O-N 3.12Å; P20-G23 VanDerWaalsContact O-N 3.12Å; P20-E25 WeakPolarHBondContact CD-O 3.33Å; P20-I27 HydrophobicContact CB-CG1 4.42Å; P20-I27 HydrophobicContact CG-CG1 4.07Å; P20-F50 HydrophobicContact CB-CZ 4.24Å
21	E	90.2	Very high	90.8	Very high	141 Å²	141	61.4 Å²	61.4	66%	0.659	36%	0.361	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.9	-29	-176.5	-157.1	-177.7	114.1	0	0	111.9	K3 G23	K3-E21 WeakPolarHBondContact O-CB 3.1Å; K3-E21 PolarHBondContact O-N 2.89Å; E21-G23 PolarHBondContact O-N 2.83Å; E21-G23 VanDerWaalsContact O-N 3.12Å
22	G	84.2	Confident	91	Very high	78 Å²	78	60.7 Å²	60.7	80%	0.804	36%	0.362	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.8	-2.1	173.1	0	0	0	0	0	114.5	P20	P20-G22 VanDerWaalsContact C-N 3.28Å; P20-G22 PolarHBondContact O-N 2.88Å
23	G	79.3	Confident	91.1	Very high	50 Å²	50	57.3 Å²	57.3	52%	0.515	33%	0.332	S	S	.	.			trans	75.2	170	-170.5	0	0	0	0	0	112.4	P20 E21	P20-G23 PolarHBondContact O-N 3.12Å; P20-G23 VanDerWaalsContact O-N 3.12Å; E21-G23 PolarHBondContact O-N 2.83Å; E21-G23 VanDerWaalsContact O-N 3.12Å
24	G	83.7	Confident	91.1	Very high	72 Å²	72	50.7 Å²	50.7	74%	0.742	30%	0.303	S	S	*	.			trans	122.6	-155.3	-179.4	0	0	0	0	0	113
25	E	88.9	Confident	91	Very high	135 Å²	135	56.2 Å²	56.2	63%	0.631	33%	0.326	S	S	*	.	S	Bend	trans	-74.5	149.1	-176.2	-48.5	-176.7	105.9	0	0	111.3	P20 I27 N59	P20-E25 WeakPolarHBondContact CD-O 3.33Å; E25-I27 PolarHBondContact O-N 3.41Å; E25-N59 PolarHBondContact OE2-ND2 2.86Å
26	D	92.3	Very high	90.5	Very high	63 Å²	63	56.6 Å²	56.6	34%	0.337	33%	0.33	S	S	.	.	P	Polyproline II helix	trans	-62.9	124	173.5	-65.4	-43.2	0	0	0	109.6	K7 F17 C19	K7-D26 WeakPolarHBondContact CD-OD1 3.4Å; K7-D26 IonicContact NZ-OD1 2.85Å; K7-D26 PolarHBondContact NZ-OD1 2.87Å; K7-D26 IonicContact NZ-OD2 2.71Å; K7-D26 PolarHBondContact NZ-OD2 2.79Å; F17-D26 HydrophobicContact CB-CB 4.2Å; F17-D26 HydrophobicContact CD1-CB 3.53Å; F17-D26 HydrophobicContact CE1-CB 4.26Å; F17-D26 HydrophobicContact CG-CB 4.19Å; C19-D26 PolarHBondContact SG-OD1 2.97Å
27	I	93	Very high	89.6	Confident	3 Å²	3	64.7 Å²	64.7	2%	0.015	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.2	125.8	-179.3	-55	-66	0	0	0	109.3	F17 I18 P20 E25 A29 F50 V52 N59 A61	F17-I27 CarbonylContact C-O 3.4Å; F17-I27 VanDerWaalsContact CA-O 3.3Å; F17-I27 WeakPolarHBondContact CA-O 3.38Å; I18-I27 PolarHBondContact N-O 3.44Å; I18-I27 PolarHBondContact O-N 2.71Å; P20-I27 HydrophobicContact CB-CG1 4.42Å; P20-I27 HydrophobicContact CG-CG1 4.07Å; E25-I27 PolarHBondContact O-N 3.41Å; I27-A29 PolarHBondContact O-N 2.78Å; I27-F50 HydrophobicContact CB-CE2 4.2Å; I27-F50 HydrophobicContact CG1-CE2 3.89Å; I27-F50 HydrophobicContact CG1-CZ 4.32Å; I27-F50 HydrophobicContact CG2-CD2 4.28Å; I27-F50 HydrophobicContact CG2-CE2 4.04Å; I27-V52 HydrophobicContact CD1-CG1 4.06Å; I27-V52 HydrophobicContact CD1-CG2 3.91Å; I27-V52 HydrophobicContact CG1-CG2 4.27Å; I27-N59 HydrophobicContact CD1-CB 3.43Å; I27-N59 VanDerWaalsContact CD1-CB 3.43Å; I27-A61 HydrophobicContact CG2-CB 3.59Å; I27-A61 VanDerWaalsContact CG2-N 3.28Å
28	F	93.8	Very high	88.9	Confident	72 Å²	72	65.1 Å²	65.1	32%	0.316	39%	0.394	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.8	126.4	177.7	179.4	-104.6	0	0	0	111.4	F15 F17 H30 N59 H60 A61	F15-F28 HydrophobicContact CB-CE2 3.9Å; F15-F28 HydrophobicContact CB-CZ 3.83Å; F15-F28 AromaticContact CD2-CE2 3.86Å; F15-F28 HydrophobicContact CD2-CE2 3.86Å; F15-F28 HydrophobicContact CG-CE2 4.11Å; F15-F28 HydrophobicContact CG-CZ 4.32Å; F17-F28 HydrophobicContact CE1-CB 4.16Å; F17-F28 HydrophobicContact CE1-CD2 4.31Å; F17-F28 HydrophobicContact CE2-CD2 4.16Å; F17-F28 AromaticContact CZ-CD2 3.95Å; F17-F28 HydrophobicContact CZ-CD2 3.95Å; F28-H30 HydrophobicContact CE1-CB 3.93Å; F28-H30 HydrophobicContact CZ-CB 4.48Å; F28-N59 PolarHBondContact N-O 2.81Å; F28-H60 HydrophobicContact CB-CB 4.18Å; F28-H60 HydrophobicContact CD1-CB 4.2Å; F28-H60 CarbonylContact O-C 3.58Å; F28-H60 WeakPolarHBondContact O-CA 3Å; F28-A61 PolarHBondContact O-N 2.88Å
29	A	93.8	Very high	87.9	Confident	0 Å²	0	74.3 Å²	74.3	0%	0	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	127.9	179.8	0	0	0	0	0	110.8	F9 F15 G16 I18 I27 I64	F9-A29 HydrophobicContact CE2-CB 4.49Å; F15-A29 CarbonylContact C-O 3.57Å; F15-A29 VanDerWaalsContact CA-O 3.23Å; F15-A29 WeakPolarHBondContact CA-O 3.41Å; F15-A29 WeakPolarHBondContact CB-O 3.41Å; G16-A29 PolarHBondContact N-O 3.44Å; G16-A29 PolarHBondContact O-N 3.07Å; I18-A29 HydrophobicContact CD1-CB 3.6Å; I18-A29 HydrophobicContact CG1-CB 3.86Å; I27-A29 PolarHBondContact O-N 2.78Å; A29-I64 HydrophobicContact CB-CD1 3.71Å
30	H	93.4	Very high	87.4	Confident	59 Å²	59	77.1 Å²	77.1	27%	0.273	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	141.1	178.6	-168.2	-114.6	0	0	0	110.8	G14 F28 S32 T33	G14-H30 PolarHBondContact O-CD2 2.91Å; F28-H30 HydrophobicContact CE1-CB 3.93Å; F28-H30 HydrophobicContact CZ-CB 4.48Å; H30-S32 WeakPolarHBondContact ND1-CB 3.48Å; H30-S32 PolarHBondContact ND1-OG 3.36Å; H30-S32 PolarHBondContact O-N 2.78Å; H30-T33 PolarHBondContact O-N 3.47Å; H30-T33 PolarHBondContact O-OG1 3.32Å
31	Y	90.6	Very high	87.1	Confident	115 Å²	115	78.6 Å²	78.6	45%	0.451	44%	0.444	S	S	.	.	G	3₁₀ helix	trans	-58.1	-27.7	-176.8	81.1	-79.2	0	0	0	113.2	G14 T33 I34 R40	G14-Y31 WeakPolarHBondContact O-CB 3.42Å; G14-Y31 VanDerWaalsContact O-CD1 3.3Å; G14-Y31 WeakPolarHBondContact O-CD1 3.02Å; G14-Y31 PolarHBondContact O-N 3.18Å; Y31-T33 PolarHBondContact O-N 2.81Å; Y31-I34 PolarHBondContact O-N 3.27Å; Y31-R40 WeakPolarHBondContact O-CD 3.26Å; Y31-R40 PolarHBondContact O-NH1 2.98Å
32	S	91.5	Very high	87	Confident	65 Å²	65	72 Å²	72	46%	0.455	41%	0.413	S	S	.	.	G	3₁₀ helix	trans	-64.6	-26.5	178.9	70.2	0	0	0	0	112.8	H30 R40	H30-S32 WeakPolarHBondContact ND1-CB 3.48Å; H30-S32 PolarHBondContact ND1-OG 3.36Å; H30-S32 PolarHBondContact O-N 2.78Å; S32-R40 PolarHBondContact O-NH1 2.79Å
33	T	92.1	Very high	87.2	Confident	29 Å²	29	75.8 Å²	75.8	18%	0.178	41%	0.407	C	S	.	.	G	3₁₀ helix	trans	-91.8	-6.7	-178.1	68.5	0	0	0	0	112.9	H30 Y31 Q35 A61 V63 I64	H30-T33 PolarHBondContact O-N 3.47Å; H30-T33 PolarHBondContact O-OG1 3.32Å; Y31-T33 PolarHBondContact O-N 2.81Å; T33-Q35 PolarHBondContact O-N 2.8Å; T33-A61 WeakPolarHBondContact CB-O 3.45Å; T33-A61 PolarHBondContact OG1-O 3.4Å; T33-V63 CarbonylContact O-C 3.52Å; T33-V63 WeakPolarHBondContact O-CA 3.22Å; T33-V63 PolarHBondContact O-N 2.83Å; T33-I64 PolarHBondContact O-N 2.91Å; T33-I64 WeakPolarHBondContact OG1-CD1 3.43Å
34	I	91.8	Very high	87.8	Confident	1 Å²	1	76.8 Å²	76.8	1%	0.005	41%	0.411	C	S	.	.	B	Isolated β-bridge	trans	-73.7	118.6	177.1	-53.7	173.9	0	0	0	109.9	F9 Y31 M36 R40 L42 I64	F9-I34 HydrophobicContact CE1-CD1 4.44Å; F9-I34 HydrophobicContact CE2-CD1 4.04Å; F9-I34 HydrophobicContact CZ-CD1 3.7Å; Y31-I34 PolarHBondContact O-N 3.27Å; I34-M36 VanDerWaalsContact C-N 3.33Å; I34-M36 HydrophobicContact CG2-CB 3.78Å; I34-M36 PolarHBondContact O-N 2.82Å; I34-R40 HydrophobicContact CB-CB 4.13Å; I34-R40 HydrophobicContact CB-CG 4.46Å; I34-R40 HydrophobicContact CD1-CB 4.28Å; I34-R40 HydrophobicContact CG2-CB 4.35Å; I34-R40 PolarHBondContact O-NE 2.79Å; I34-L42 HydrophobicContact CD1-CD1 3.97Å; I34-L42 HydrophobicContact CD1-CD2 4.45Å; I34-L42 HydrophobicContact CD1-CG 3.82Å; I34-L42 HydrophobicContact CG1-CD1 4.42Å; I34-I64 CarbonylContact C-O 3.53Å; I34-I64 WeakPolarHBondContact CA-O 3.42Å; I34-I64 HydrophobicContact CG1-CB 4.18Å; I34-I64 HydrophobicContact CG1-CD1 4.1Å; I34-I64 HydrophobicContact CG1-CG2 4.49Å
35	Q	88.8	Confident	88.2	Confident	125 Å²	125	76.1 Å²	76.1	58%	0.584	40%	0.404	S	S	*	.			trans	-83.3	77.7	172	-69.4	-94.4	55	0	0	108.6	T33 V63 I64 V65	T33-Q35 PolarHBondContact O-N 2.8Å; Q35-V63 HydrophobicContact CG-CG1 3.79Å; Q35-I64 PolarHBondContact N-O 3.15Å; Q35-V65 HydrophobicContact CB-CG2 3.99Å; Q35-V65 HydrophobicContact CG-CG2 4.38Å
36	M	82.7	Confident	88.2	Confident	65 Å²	65	72 Å²	72	32%	0.32	38%	0.384	S	S	.	.			trans	-141.9	137.6	176.5	160.5	175	-90.3	0	0	108.8	I34 R40 P66	I34-M36 VanDerWaalsContact C-N 3.33Å; I34-M36 HydrophobicContact CG2-CB 3.78Å; I34-M36 PolarHBondContact O-N 2.82Å; M36-R40 HydrophobicContact CB-CG 4.44Å; M36-P66 HydrophobicContact CE-CG 4.15Å
37	D	75.7	Confident	88.3	Confident	169 Å²	169	70.5 Å²	70.5	90%	0.904	38%	0.379	S	S	*	.	S	Bend	trans	-76.7	135.5	168.4	-93.2	-88.4	0	0	0	111
38	G	79.5	Confident	88.3	Confident	69 Å²	69	70.4 Å²	70.4	71%	0.711	38%	0.378	S	S	*	.	S	Bend	trans	81.4	-126.4	-178.8	0	0	0	0	0	113.9	R40	G38-R40 PolarHBondContact O-N 3.26Å; G38-R40 VanDerWaalsContact O-N 3.15Å
39	Y	73.3	Confident	88.3	Confident	193 Å²	193	69.7 Å²	69.7	76%	0.757	38%	0.376	S	S	*	.	S	Bend	trans	-86.6	89.2	-167.9	-134.9	-99.8	0	0	0	111.4	T41	Y39-T41 VanDerWaalsContact C-N 3.33Å; Y39-T41 HydrophobicContact CD1-CG2 3.53Å; Y39-T41 HydrophobicContact CE1-CG2 4.15Å; Y39-T41 PolarHBondContact O-N 3.37Å; Y39-T41 PolarHBondContact O-OG1 2.87Å
40	R	84.5	Confident	88.3	Confident	103 Å²	103	69.7 Å²	69.7	39%	0.389	38%	0.376	S	S	.	.			trans	-60.1	82	-176.8	-62.6	-176.2	-178.7	-166.4	-2.8	113.4	Y31 S32 I34 M36 G38	Y31-R40 WeakPolarHBondContact O-CD 3.26Å; Y31-R40 PolarHBondContact O-NH1 2.98Å; S32-R40 PolarHBondContact O-NH1 2.79Å; I34-R40 HydrophobicContact CB-CB 4.13Å; I34-R40 HydrophobicContact CB-CG 4.46Å; I34-R40 HydrophobicContact CD1-CB 4.28Å; I34-R40 HydrophobicContact CG2-CB 4.35Å; I34-R40 PolarHBondContact O-NE 2.79Å; M36-R40 HydrophobicContact CB-CG 4.44Å; G38-R40 PolarHBondContact O-N 3.26Å; G38-R40 VanDerWaalsContact O-N 3.15Å
41	T	85.2	Confident	88.3	Confident	44 Å²	44	69.3 Å²	69.3	27%	0.27	38%	0.376	S	S	.	.			trans	-131	148.8	-172.8	54.9	0	0	0	0	110.7	N11 Y39	N11-T41 HydrophobicContact CB-CG2 4.11Å; N11-T41 WeakPolarHBondContact OD1-CA 3.46Å; N11-T41 WeakPolarHBondContact OD1-CB 3.4Å; N11-T41 WeakPolarHBondContact OD1-CG2 3.49Å; Y39-T41 VanDerWaalsContact C-N 3.33Å; Y39-T41 HydrophobicContact CD1-CG2 3.53Å; Y39-T41 HydrophobicContact CE1-CG2 4.15Å; Y39-T41 PolarHBondContact O-N 3.37Å; Y39-T41 PolarHBondContact O-OG1 2.87Å
42	L	89.7	Confident	88.4	Confident	3 Å²	3	66 Å²	66	2%	0.016	37%	0.368	C	S	.	.			trans	-123.6	146.3	177.1	-62.9	174.6	0	0	0	109.1	V6 F9 I34 V48 I64 P66	V6-L42 HydrophobicContact CG1-CB 4.1Å; V6-L42 HydrophobicContact CG2-CB 3.97Å; V6-L42 HydrophobicContact CG2-CD1 3.98Å; V6-L42 HydrophobicContact CG2-CG 4.37Å; F9-L42 HydrophobicContact CB-CB 3.89Å; F9-L42 HydrophobicContact CD1-CB 4.19Å; F9-L42 HydrophobicContact CD2-CB 4.07Å; F9-L42 HydrophobicContact CD2-CD1 3.84Å; F9-L42 HydrophobicContact CD2-CG 4.28Å; F9-L42 HydrophobicContact CE2-CD1 4.04Å; F9-L42 HydrophobicContact CE2-CG 4.48Å; F9-L42 HydrophobicContact CG-CB 3.8Å; F9-L42 HydrophobicContact CG-CD1 4.44Å; F9-L42 HydrophobicContact CG-CG 4.44Å; I34-L42 HydrophobicContact CD1-CD1 3.97Å; I34-L42 HydrophobicContact CD1-CD2 4.45Å; I34-L42 HydrophobicContact CD1-CG 3.82Å; I34-L42 HydrophobicContact CG1-CD1 4.42Å; L42-V48 HydrophobicContact CD1-CG1 4.48Å; L42-V48 HydrophobicContact CD2-CG1 3.71Å; L42-I64 HydrophobicContact CD1-CG2 4.13Å; L42-I64 HydrophobicContact CD2-CG2 4.48Å; L42-P66 HydrophobicContact CD2-CB 4.34Å
43	K	88.8	Confident	88.3	Confident	157 Å²	157	67 Å²	67	68%	0.683	37%	0.365	S	S	*	.			trans	-99.9	140.8	173.8	-67.5	177.5	-179.2	175.7	0	110.2	V6 G45 Q46	V6-K43 VanDerWaalsContact CB-O 3.26Å; V6-K43 WeakPolarHBondContact CB-O 3.45Å; V6-K43 WeakPolarHBondContact CG1-O 3.36Å; K43-G45 PolarHBondContact O-N 3.05Å; K43-Q46 HydrophobicContact CB-CB 4.18Å; K43-Q46 WeakPolarHBondContact O-CB 3.4Å; K43-Q46 PolarHBondContact O-N 3.17Å
44	A	91.6	Very high	88.1	Confident	71 Å²	71	73.9 Å²	73.9	59%	0.587	40%	0.395	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.8	136.6	170.1	0	0	0	0	0	110	V6 Q46	V6-A44 CarbonylContact O-C 3.59Å; V6-A44 WeakPolarHBondContact O-CA 3.01Å; A44-Q46 VanDerWaalsContact C-N 3.26Å; A44-Q46 PolarHBondContact O-N 3.44Å
45	G	91	Very high	87.8	Confident	58 Å²	58	75 Å²	75	60%	0.598	41%	0.407	S	S	*	.	T	Hydrogen-bonded Turn	trans	81.1	-5.8	-174.2	0	0	0	0	0	115	V6 K43	V6-G45 PolarHBondContact O-N 2.8Å; K43-G45 PolarHBondContact O-N 3.05Å
46	Q	90.3	Very high	87.5	Confident	47 Å²	47	76 Å²	76	22%	0.22	42%	0.424	C	S	.	.			trans	-74.6	134.5	176.1	-172.6	176.4	-4.6	0	0	110.3	V6 K43 A44 P66	V6-Q46 HydrophobicContact CG2-CB 4.5Å; V6-Q46 WeakPolarHBondContact CG2-O 3.16Å; V6-Q46 PolarHBondContact N-O 3.28Å; K43-Q46 HydrophobicContact CB-CB 4.18Å; K43-Q46 WeakPolarHBondContact O-CB 3.4Å; K43-Q46 PolarHBondContact O-N 3.17Å; A44-Q46 VanDerWaalsContact C-N 3.26Å; A44-Q46 PolarHBondContact O-N 3.44Å; Q46-P66 VanDerWaalsContact NE2-CB 3.33Å
47	S	92.8	Very high	87.4	Confident	33 Å²	33	83 Å²	83	23%	0.231	45%	0.453	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.8	141.2	169.5	-55.4	0	0	0	0	110.8	G4 V67 V69	G4-S47 CarbonylContact O-C 3.51Å; G4-S47 WeakPolarHBondContact O-CA 3.44Å; S47-V67 VanDerWaalsContact O-CG2 3.23Å; S47-V67 WeakPolarHBondContact O-CG2 3.3Å; S47-V67 PolarHBondContact O-N 3.03Å; S47-V69 WeakPolarHBondContact OG-CG2 3.39Å
48	V	93.2	Very high	87.9	Confident	0 Å²	0	76.7 Å²	76.7	0%	0	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.7	148.5	-178.3	-65	0	0	0	0	108.8	G4 V6 I18 L42 F50 I64 P66	G4-V48 PolarHBondContact N-O 3.01Å; G4-V48 PolarHBondContact O-N 2.91Å; V6-V48 HydrophobicContact CG2-CB 4.35Å; V6-V48 HydrophobicContact CG2-CG1 3.49Å; V6-V48 VanDerWaalsContact CG2-CG1 3.49Å; V6-V48 HydrophobicContact CG2-CG2 3.8Å; I18-V48 HydrophobicContact CB-CG2 4.46Å; I18-V48 HydrophobicContact CD1-CG2 3.69Å; I18-V48 HydrophobicContact CG1-CG2 3.95Å; I18-V48 HydrophobicContact CG2-CG2 3.63Å; L42-V48 HydrophobicContact CD1-CG1 4.48Å; L42-V48 HydrophobicContact CD2-CG1 3.71Å; V48-F50 HydrophobicContact CG2-CD1 3.89Å; V48-F50 HydrophobicContact CG2-CE1 4.13Å; V48-I64 HydrophobicContact CB-CG2 4.08Å; V48-I64 HydrophobicContact CG1-CG2 4.36Å; V48-P66 HydrophobicContact CG1-CB 4.47Å
49	Q	93.8	Very high	88.4	Confident	57 Å²	57	74.8 Å²	74.8	27%	0.266	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.9	134.3	172	-135.4	163.8	19.6	0	0	108.1	M1 E2 K3 I64 V65 V67	M1-Q49 HydrophobicContact CB-CG 4.41Å; E2-Q49 CarbonylContact O-C 3.56Å; E2-Q49 VanDerWaalsContact O-CA 3.3Å; E2-Q49 WeakPolarHBondContact O-CA 3.23Å; E2-Q49 WeakPolarHBondContact O-CG 3.19Å; K3-Q49 VanDerWaalsContact CE-NE2 3.28Å; K3-Q49 HydrophobicContact CG-CG 3.83Å; Q49-I64 CarbonylContact O-C 3.58Å; Q49-I64 WeakPolarHBondContact O-CA 3.33Å; Q49-V65 HydrophobicContact CB-CB 4.45Å; Q49-V65 PolarHBondContact N-O 3.06Å; Q49-V65 PolarHBondContact O-N 2.85Å; Q49-V67 HydrophobicContact CB-CG1 4.27Å
50	F	94.1	Very high	89.3	Confident	0 Å²	0	68.7 Å²	68.7	0%	0	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.5	160.1	-176.4	54.2	-83.9	0	0	0	110.6	M1 E2 I18 P20 I27 V48 V52 A61 I64	M1-F50 CarbonylContact C-O 3.51Å; M1-F50 WeakPolarHBondContact CA-O 3.36Å; E2-F50 HydrophobicContact CB-CE2 4.35Å; E2-F50 PolarHBondContact N-O 2.96Å; E2-F50 PolarHBondContact O-N 3.41Å; I18-F50 HydrophobicContact CB-CE1 4.24Å; I18-F50 HydrophobicContact CB-CZ 4.4Å; I18-F50 HydrophobicContact CD1-CD1 4.03Å; I18-F50 HydrophobicContact CD1-CE1 4.37Å; I18-F50 HydrophobicContact CD1-CG 4.35Å; I18-F50 HydrophobicContact CG2-CD1 4.04Å; I18-F50 HydrophobicContact CG2-CE1 3.31Å; I18-F50 HydrophobicContact CG2-CZ 3.71Å; P20-F50 HydrophobicContact CB-CZ 4.24Å; I27-F50 HydrophobicContact CB-CE2 4.2Å; I27-F50 HydrophobicContact CG1-CE2 3.89Å; I27-F50 HydrophobicContact CG1-CZ 4.32Å; I27-F50 HydrophobicContact CG2-CD2 4.28Å; I27-F50 HydrophobicContact CG2-CE2 4.04Å; V48-F50 HydrophobicContact CG2-CD1 3.89Å; V48-F50 HydrophobicContact CG2-CE1 4.13Å; F50-V52 HydrophobicContact CD2-CG2 3.8Å; F50-V52 HydrophobicContact CE2-CG2 3.45Å; F50-V52 VanDerWaalsContact CE2-CG2 3.45Å; F50-A61 HydrophobicContact CB-CB 3.85Å; F50-A61 HydrophobicContact CD2-CB 3.74Å; F50-A61 HydrophobicContact CG-CB 3.92Å; F50-I64 HydrophobicContact CB-CB 4.44Å; F50-I64 HydrophobicContact CB-CG1 3.97Å
51	D	93.5	Very high	89.7	Confident	52 Å²	52	63.8 Å²	63.8	28%	0.278	36%	0.361	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.9	129.7	170.7	-127.3	-102.3	0	0	0	109.9	M1 H53 A61 S62	M1-D51 WeakPolarHBondContact CA-OD2 3.36Å; M1-D51 WeakPolarHBondContact CG-OD2 3.46Å; M1-D51 PolarHBondContact N-OD2 2.84Å; D51-H53 IonicContact OD1-NE2 3.9Å; D51-A61 CarbonylContact O-C 3.56Å; D51-A61 WeakPolarHBondContact O-CA 3.23Å; D51-S62 PolarHBondContact N-O 2.88Å; D51-S62 PolarHBondContact O-N 3.4Å
52	V	91.6	Very high	90.1	Very high	45 Å²	45	62.9 Å²	62.9	27%	0.273	36%	0.356	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88	122	179.2	172.1	0	0	0	0	109.2	E2 I27 F50 N59	E2-V52 HydrophobicContact CB-CG2 4.45Å; I27-V52 HydrophobicContact CD1-CG1 4.06Å; I27-V52 HydrophobicContact CD1-CG2 3.91Å; I27-V52 HydrophobicContact CG1-CG2 4.27Å; F50-V52 HydrophobicContact CD2-CG2 3.8Å; F50-V52 HydrophobicContact CE2-CG2 3.45Å; F50-V52 VanDerWaalsContact CE2-CG2 3.45Å; V52-N59 HydrophobicContact CG1-CB 4.07Å
53	H	90.8	Very high	90.3	Very high	86 Å²	86	65.3 Å²	65.3	40%	0.398	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.3	129	172.5	-76.7	-110.3	0	0	0	110.3	D51 G55 N59 H60	D51-H53 IonicContact OD1-NE2 3.9Å; H53-G55 PolarHBondContact O-N 3.28Å; H53-N59 WeakPolarHBondContact O-CA 3.23Å; H53-H60 WeakPolarHBondContact CB-NE2 3.46Å; H53-H60 PolarHBondContact N-O 2.99Å; H53-H60 PolarHBondContact O-N 2.82Å; H53-H60 PolarHBondContact O-ND1 3.06Å
54	Q	87.7	Confident	90.5	Very high	174 Å²	174	57.8 Å²	57.8	81%	0.813	34%	0.338	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.4	120.9	170.4	-93.1	175.9	17.7	0	0	110	N59	Q54-N59 WeakPolarHBondContact CG-OD1 3.3Å
55	G	84.8	Confident	90.5	Very high	24 Å²	24	56.8 Å²	56.8	25%	0.247	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.4	173.7	174.4	0	0	0	0	0	112.3	H53 K57 G58	H53-G55 PolarHBondContact O-N 3.28Å; G55-K57 PolarHBondContact O-N 3.02Å; G55-G58 PolarHBondContact N-O 2.77Å; G55-G58 PolarHBondContact O-N 3.22Å
56	P	83.4	Confident	90.5	Very high	146 Å²	146	55.3 Å²	55.3	95%	0.948	30%	0.304	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.8	-11.9	179.1	26.1	-34.5	0	0	0	114
57	K	80.7	Confident	90.3	Very high	213 Å²	213	54.8 Å²	54.8	93%	0.926	30%	0.304	S	S	*	.	T	Hydrogen-bonded Turn	trans	-111.2	18.1	177.7	-65.6	-171.4	174.6	-170.1	0	113.2	G55	G55-K57 PolarHBondContact O-N 3.02Å
58	G	85	Confident	89.3	Confident	35 Å²	35	62.3 Å²	62.3	36%	0.361	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	96.6	-170.3	-173.1	0	0	0	0	0	112.9	G55	G55-G58 PolarHBondContact N-O 2.77Å; G55-G58 PolarHBondContact O-N 3.22Å
59	N	89.8	Confident	87.8	Confident	30 Å²	30	66.6 Å²	66.6	16%	0.16	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.8	131.7	-175	-58	-27.8	0	0	0	110.8	E25 I27 F28 V52 H53 Q54	E25-N59 PolarHBondContact OE2-ND2 2.86Å; I27-N59 HydrophobicContact CD1-CB 3.43Å; I27-N59 VanDerWaalsContact CD1-CB 3.43Å; F28-N59 PolarHBondContact N-O 2.81Å; V52-N59 HydrophobicContact CG1-CB 4.07Å; H53-N59 WeakPolarHBondContact O-CA 3.23Å; Q54-N59 WeakPolarHBondContact CG-OD1 3.3Å
60	H	93.2	Very high	85.7	Confident	64 Å²	64	72.6 Å²	72.6	30%	0.296	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.8	149.1	173.9	65.6	-93.7	0	0	0	111.5	F28 H53	F28-H60 HydrophobicContact CB-CB 4.18Å; F28-H60 HydrophobicContact CD1-CB 4.2Å; F28-H60 CarbonylContact O-C 3.58Å; F28-H60 WeakPolarHBondContact O-CA 3Å; H53-H60 WeakPolarHBondContact CB-NE2 3.46Å; H53-H60 PolarHBondContact N-O 2.99Å; H53-H60 PolarHBondContact O-N 2.82Å; H53-H60 PolarHBondContact O-ND1 3.06Å
61	A	93.8	Very high	83.5	Confident	1 Å²	1	76.8 Å²	76.8	1%	0.008	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.3	122	178.2	0	0	0	0	0	110.4	I18 I27 F28 T33 F50 D51 I64	I18-A61 HydrophobicContact CD1-CB 4.05Å; I27-A61 HydrophobicContact CG2-CB 3.59Å; I27-A61 VanDerWaalsContact CG2-N 3.28Å; F28-A61 PolarHBondContact O-N 2.88Å; T33-A61 WeakPolarHBondContact CB-O 3.45Å; T33-A61 PolarHBondContact OG1-O 3.4Å; F50-A61 HydrophobicContact CB-CB 3.85Å; F50-A61 HydrophobicContact CD2-CB 3.74Å; F50-A61 HydrophobicContact CG-CB 3.92Å; D51-A61 CarbonylContact O-C 3.56Å; D51-A61 WeakPolarHBondContact O-CA 3.23Å; A61-I64 HydrophobicContact CB-CD1 3.8Å; A61-I64 HydrophobicContact CB-CG1 3.74Å
62	S	93	Very high	81	Confident	25 Å²	25	78.5 Å²	78.5	18%	0.175	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	156.3	168	-83.7	0	0	0	0	110.4	D51 I64	D51-S62 PolarHBondContact N-O 2.88Å; D51-S62 PolarHBondContact O-N 3.4Å; S62-I64 VanDerWaalsContact C-N 3.34Å; S62-I64 PolarHBondContact O-N 2.71Å
63	V	93.2	Very high	78.4	Confident	53 Å²	53	83.7 Å²	83.7	32%	0.321	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	52.4	50.7	175.7	-162.1	0	0	0	0	111.9	M1 T33 Q35 V65	M1-V63 HydrophobicContact CE-CG1 3.98Å; T33-V63 CarbonylContact O-C 3.52Å; T33-V63 WeakPolarHBondContact O-CA 3.22Å; T33-V63 PolarHBondContact O-N 2.83Å; Q35-V63 HydrophobicContact CG-CG1 3.79Å; V63-V65 PolarHBondContact O-N 3.04Å
64	I	93.5	Very high	75.9	Confident	0 Å²	0	87.4 Å²	87.4	0%	0	52%	0.523	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.4	114.6	-178	-54.4	167.7	0	0	0	108.8	I18 A29 T33 I34 Q35 L42 V48 Q49 F50 A61 S62	I18-I64 HydrophobicContact CD1-CD1 4.09Å; I18-I64 HydrophobicContact CD1-CG1 4.41Å; I18-I64 HydrophobicContact CD1-CG2 4.3Å; A29-I64 HydrophobicContact CB-CD1 3.71Å; T33-I64 PolarHBondContact O-N 2.91Å; T33-I64 WeakPolarHBondContact OG1-CD1 3.43Å; I34-I64 CarbonylContact C-O 3.53Å; I34-I64 WeakPolarHBondContact CA-O 3.42Å; I34-I64 HydrophobicContact CG1-CB 4.18Å; I34-I64 HydrophobicContact CG1-CD1 4.1Å; I34-I64 HydrophobicContact CG1-CG2 4.49Å; Q35-I64 PolarHBondContact N-O 3.15Å; L42-I64 HydrophobicContact CD1-CG2 4.13Å; L42-I64 HydrophobicContact CD2-CG2 4.48Å; V48-I64 HydrophobicContact CB-CG2 4.08Å; V48-I64 HydrophobicContact CG1-CG2 4.36Å; Q49-I64 CarbonylContact O-C 3.58Å; Q49-I64 WeakPolarHBondContact O-CA 3.33Å; F50-I64 HydrophobicContact CB-CB 4.44Å; F50-I64 HydrophobicContact CB-CG1 3.97Å; A61-I64 HydrophobicContact CB-CD1 3.8Å; A61-I64 HydrophobicContact CB-CG1 3.74Å; S62-I64 VanDerWaalsContact C-N 3.34Å; S62-I64 PolarHBondContact O-N 2.71Å
65	V	92.4	Very high	75.3	Confident	50 Å²	50	83.1 Å²	83.1	30%	0.303	51%	0.509	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	115	174.8	-176	0	0	0	0	107.8	Q35 Q49 V63 V67	Q35-V65 HydrophobicContact CB-CG2 3.99Å; Q35-V65 HydrophobicContact CG-CG2 4.38Å; Q49-V65 HydrophobicContact CB-CB 4.45Å; Q49-V65 PolarHBondContact N-O 3.06Å; Q49-V65 PolarHBondContact O-N 2.85Å; V63-V65 PolarHBondContact O-N 3.04Å; V65-V67 PolarHBondContact O-N 3.49Å
66	P	89.9	Confident	74.8	Confident	26 Å²	26	86.2 Å²	86.2	17%	0.169	52%	0.522	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.9	122.6	170.9	19.5	-21.3	0	0	0	109.6	M36 L42 Q46 V48	M36-P66 HydrophobicContact CE-CG 4.15Å; L42-P66 HydrophobicContact CD2-CB 4.34Å; Q46-P66 VanDerWaalsContact NE2-CB 3.33Å; V48-P66 HydrophobicContact CG1-CB 4.47Å
67	V	87.3	Confident	74.3	Confident	36 Å²	36	82.9 Å²	82.9	22%	0.218	50%	0.499	C	S	.	.			trans	-88.2	116.5	170.1	-85	0	0	0	0	106.7	S47 Q49 V65 V69	S47-V67 VanDerWaalsContact O-CG2 3.23Å; S47-V67 WeakPolarHBondContact O-CG2 3.3Å; S47-V67 PolarHBondContact O-N 3.03Å; Q49-V67 HydrophobicContact CB-CG1 4.27Å; V65-V67 PolarHBondContact O-N 3.49Å; V67-V69 PolarHBondContact O-N 3.42Å
68	E	71.9	Confident	74	Confident	192 Å²	192	75.2 Å²	75.2	90%	0.897	47%	0.474	S	S	*	.			trans	-64.5	94.1	163.7	-80.7	177.8	83.8	0	0	106.9	E70	E68-E70 PolarHBondContact O-N 2.78Å; E68-E70 VanDerWaalsContact O-N 3.12Å
69	V	60.2	Low	73.3	Confident	89 Å²	89	77.8 Å²	77.8	54%	0.539	48%	0.481	S	S	.	.			trans	-68.1	110.9	164.2	-159.2	0	0	0	0	103.9	S47 V67 A71	S47-V69 WeakPolarHBondContact OG-CG2 3.39Å; V67-V69 PolarHBondContact O-N 3.42Å; V69-A71 PolarHBondContact O-N 3.05Å
70	E	50.4	Low	72.2	Confident	184 Å²	184	80.9 Å²	80.9	86%	0.86	50%	0.502	S	S	*	.			trans	-46.7	99.8	153.8	-84.8	174.9	74.1	0	0	105.2	E68 A72	E68-E70 PolarHBondContact O-N 2.78Å; E68-E70 VanDerWaalsContact O-N 3.12Å; E70-A72 PolarHBondContact O-N 3.19Å
71	A	48.2	Very low	70.7	Confident	88 Å²	88	82.1 Å²	82.1	73%	0.727	52%	0.517	S	S	*	.			trans	-57.1	102.7	168.1	0	0	0	0	0	103.2	V69 V73	V69-A71 PolarHBondContact O-N 3.05Å; A71-V73 PolarHBondContact O-N 3.29Å
72	A	41.2	Very low	68.9	Low	88 Å²	88	88.4 Å²	88.4	73%	0.727	56%	0.556	S	S	*	*			trans	-47.1	113.6	-172.4	0	0	0	0	0	107.2	E70 A74	E70-A72 PolarHBondContact O-N 3.19Å; A72-A74 VanDerWaalsContact C-N 3.32Å; A72-A74 PolarHBondContact O-N 2.99Å
73	V	36.8	Very low	66.9	Low	154 Å²	154	93.7 Å²	93.7	93%	0.933	59%	0.588	S	S	*	*			trans	-58.7	103.9	165.8	179.5	0	0	0	0	104.6	A71	A71-V73 PolarHBondContact O-N 3.29Å
74	A	37.5	Very low	64.5	Low	164 Å²	164	97.4 Å²	97.4	100%	1.355	61%	0.612	S	S	*	*			trans	-133.5	0	172.9	0	0	0	0	0	108.4	A72	A72-A74 VanDerWaalsContact C-N 3.32Å; A72-A74 PolarHBondContact O-N 2.99Å

Retrieved 74 of 74 residues in 34.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).