GG6LY_HUMAN Loading...

Golgin subfamily A member 6-like protein 25 AlphaSync

AlphaFold DB , UniProt , Accession P0DX01, Species HUMAN (Homo sapiens, Human), Gene GOLGA6L25, Length 826 aa.

						>GG6LY_HUMAN|P0DX01|GOLGA6L25
MWPQPHLPTHPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTNPETTTSGGCHSPEDEQKASHQHQEALRRELEAQVHTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTKERDALSLELYRNTITDEELKEKNAKLQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADHLGKELQSVSAKLQAQVEENELWNRLNQQQEEKMWRQEEKIQEREEKIQEQEEKIREQEEKMRRQEEMMWEKEEKMRRQEEMMWEKEEKIRELEEKMHEQEKIREQEEKRQEEEKIREQEKRQEQEAKMWRQEEKIREQEEKIREQEKKMWRQEEKIHEQEKIREEEKRQEQEEMWRQEEKIREQEEIWRQKEKMHEQEEKIRKQEEKVWRQEEKMHDQEEKIREQEEKVWRQEEKIREQEEKMWRQEEKIREQEEMWREEEKMHEQEKIWEEEKRQEQEDKMWRQEEKIREQEEKVWRQEEKIREQEEKRQEQEEKMWKQEEKIREQEEKIREQEKIREQEEKIREQEEMMQEQEEKMGEQEEKMQEQEKMRRQEEKIREQEEKIREQKEKIREQEEKIWEQEEKIREQEEMMQEQEEKMGEQEEKMWEQEEEMQEQEEKMRRQEEKIREQEKKIREQEEKIREQEEMMQEQEEKMGEQEGKMCEQEAKMQEQEEKMRRQEEKIREQEKKIREQEEKIREQEEMMQEQEEKMWEQEEKMCEQEEKMQEQEEKMRRQEEKMREQEVRLRQQEEKMQEH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.7	Very low	49.8	Very low	235 Å²	235	162.4 Å²	162.4	100%	1.158	85%	0.846	S	S	*	*				0	92.3	0	-70.9	169.1	72.5	0	0	107
2	W	39.8	Very low	49.5	Very low	248 Å²	248	164.3 Å²	164.3	94%	0.939	85%	0.847	S	S	*	*	P	Polyproline II helix	trans	-96.6	130.8	176.3	-72.3	76	0	0	0	107.4	Q4	W2-Q4 PolarHBondContact O-N 3.21Å
3	P	55.2	Low	48.9	Very low	121 Å²	121	164.2 Å²	164.2	79%	0.786	85%	0.848	S	S	*	*	P	Polyproline II helix	trans	-72	129.6	-175.3	8.2	4.3	0	0	0	109.6
4	Q	48.7	Very low	48.9	Very low	176 Å²	176	160.6 Å²	160.6	82%	0.822	84%	0.84	S	S	*	*	P	Polyproline II helix	trans	-64.5	136.9	171.6	-80.7	-178.2	-53.9	0	0	110	W2 H6	W2-Q4 PolarHBondContact O-N 3.21Å; Q4-H6 PolarHBondContact O-N 2.77Å
5	P	58	Low	48.5	Very low	119 Å²	119	159.1 Å²	159.1	77%	0.773	84%	0.84	S	S	*	*	P	Polyproline II helix	trans	-68.7	125.9	177.7	26.7	-30.7	0	0	0	110.1	L7	P5-L7 PolarHBondContact O-N 3.37Å
6	H	54.1	Low	48.1	Very low	187 Å²	187	159.9 Å²	159.9	87%	0.866	84%	0.838	S	S	*	*			trans	-62.5	114.1	171.5	-75	-79.7	0	0	0	109.4	Q4	Q4-H6 PolarHBondContact O-N 2.77Å
7	L	45.7	Very low	48.2	Very low	163 Å²	163	157.4 Å²	157.4	85%	0.853	83%	0.833	S	S	*	*	P	Polyproline II helix	trans	-61.6	131	167.5	-90.3	141.5	0	0	0	109.1	P5 T9	P5-L7 PolarHBondContact O-N 3.37Å; L7-T9 PolarHBondContact O-N 3.23Å
8	P	52.6	Low	48	Very low	110 Å²	110	158.9 Å²	158.9	71%	0.714	83%	0.834	S	S	*	*	P	Polyproline II helix	trans	-67.3	121.6	178.6	-11.2	25.8	0	0	0	109.5	H10	P8-H10 PolarHBondContact O-N 3.22Å; P8-H10 VanDerWaalsContact O-N 3.17Å
9	T	48.6	Very low	47.7	Very low	137 Å²	137	159.2 Å²	159.2	84%	0.84	84%	0.835	S	S	*	*	P	Polyproline II helix	trans	-54.1	117.8	165.2	14.8	0	0	0	0	109.2	L7	L7-T9 PolarHBondContact O-N 3.23Å
10	H	42.8	Very low	47.7	Very low	175 Å²	175	156.6 Å²	156.6	81%	0.81	83%	0.828	S	S	*	*	P	Polyproline II helix	trans	-54.1	127.6	174.6	-84	-84.6	0	0	0	109.9	P8 H12	P8-H10 PolarHBondContact O-N 3.22Å; P8-H10 VanDerWaalsContact O-N 3.17Å; H10-H12 PolarHBondContact O-N 3.5Å
11	P	52.1	Low	47.4	Very low	115 Å²	115	155.7 Å²	155.7	75%	0.747	83%	0.83	S	S	*	*	P	Polyproline II helix	trans	-67.4	126	174.2	24.2	-25.6	0	0	0	108.4	L13	P11-L13 PolarHBondContact O-N 3.46Å; P11-L13 VanDerWaalsContact O-N 3.1Å
12	H	47.2	Very low	47.3	Very low	186 Å²	186	152.6 Å²	152.6	86%	0.861	81%	0.812	S	S	*	*	P	Polyproline II helix	trans	-48.3	116.9	170.5	-80.1	-85.5	0	0	0	109.5	H10	H10-H12 PolarHBondContact O-N 3.5Å
13	L	41.1	Very low	47.6	Very low	162 Å²	162	145.9 Å²	145.9	85%	0.848	80%	0.8	S	S	*	*	P	Polyproline II helix	trans	-56.4	127.3	168.8	-91.4	139.1	0	0	0	108.3	P11 T15	P11-L13 PolarHBondContact O-N 3.46Å; P11-L13 VanDerWaalsContact O-N 3.1Å; L13-T15 PolarHBondContact O-N 3.22Å
14	P	48.4	Very low	47	Very low	115 Å²	115	149.1 Å²	149.1	75%	0.747	80%	0.804	S	S	*	*	P	Polyproline II helix	trans	-66.8	123.9	178	-7.8	21.6	0	0	0	108.9	H16	P14-H16 PolarHBondContact O-N 2.65Å
15	T	44	Very low	46.8	Very low	137 Å²	137	148.2 Å²	148.2	84%	0.84	81%	0.805	S	S	*	*	P	Polyproline II helix	trans	-51.7	123.9	169.5	-30.2	0	0	0	0	108.7	L13	L13-T15 PolarHBondContact O-N 3.22Å
16	H	42.2	Very low	46	Very low	173 Å²	173	147.6 Å²	147.6	80%	0.801	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-51.3	123.9	-179.3	-84.1	-86.9	0	0	0	110.4	P14 H18	P14-H16 PolarHBondContact O-N 2.65Å; H16-H18 PolarHBondContact O-N 3.1Å
17	P	49.7	Very low	45.5	Very low	116 Å²	116	145.3 Å²	145.3	75%	0.753	80%	0.8	S	S	*	*	P	Polyproline II helix	trans	-66.9	120.6	171.8	26	-28.9	0	0	0	107.8	L19	P17-L19 PolarHBondContact O-N 3.23Å; P17-L19 VanDerWaalsContact O-N 3.14Å
18	H	44.6	Very low	45.4	Very low	186 Å²	186	145.4 Å²	145.4	86%	0.861	80%	0.796	S	S	*	*	P	Polyproline II helix	trans	-47.1	120.4	172.3	-76.6	-88.7	0	0	0	109.6	H16	H16-H18 PolarHBondContact O-N 3.1Å
19	L	42.7	Very low	45.3	Very low	163 Å²	163	145.8 Å²	145.8	85%	0.853	80%	0.798	S	S	*	*	P	Polyproline II helix	trans	-55.1	128.2	172.1	-93.1	133.9	0	0	0	108.6	P17 T21	P17-L19 PolarHBondContact O-N 3.23Å; P17-L19 VanDerWaalsContact O-N 3.14Å; L19-T21 PolarHBondContact O-N 3.09Å
20	P	46	Very low	45.4	Very low	107 Å²	107	147.2 Å²	147.2	70%	0.695	80%	0.797	S	S	*	*	P	Polyproline II helix	trans	-62.2	121.5	177	-15.4	28.2	0	0	0	108.7	H22	P20-H22 PolarHBondContact O-N 3.28Å
21	T	43.2	Very low	46.2	Very low	139 Å²	139	142 Å²	142	85%	0.853	77%	0.774	S	S	*	*			trans	-54.4	107.4	166.4	18.8	0	0	0	0	107.9	L19 P23	L19-T21 PolarHBondContact O-N 3.09Å; T21-P23 WeakPolarHBondContact O-CD 3.46Å
22	H	45.7	Very low	46.8	Very low	170 Å²	170	139.8 Å²	139.8	79%	0.787	76%	0.761	S	S	*	*			trans	-61.5	122.6	178.6	-101.3	-77.3	0	0	0	108.5	P20 H24	P20-H22 PolarHBondContact O-N 3.28Å; H22-H24 PolarHBondContact O-N 2.76Å; H22-H24 VanDerWaalsContact O-N 3.16Å
23	P	46.6	Very low	47.8	Very low	107 Å²	107	139.5 Å²	139.5	70%	0.695	76%	0.757	S	S	*	*			trans	-61.3	123.2	176.4	23.6	-30.5	0	0	0	108	T21 L25	T21-P23 WeakPolarHBondContact O-CD 3.46Å; P23-L25 PolarHBondContact O-N 3.48Å
24	H	42.9	Very low	49.3	Very low	188 Å²	188	139.3 Å²	139.3	87%	0.87	75%	0.752	S	S	*	*			trans	-51.1	104.6	173.8	-69.7	-81.1	0	0	0	108.5	H22	H22-H24 PolarHBondContact O-N 2.76Å; H22-H24 VanDerWaalsContact O-N 3.16Å
25	L	44.2	Very low	50.7	Low	158 Å²	158	136.3 Å²	136.3	83%	0.827	73%	0.732	S	S	*	*			trans	-58.3	123	169.1	-89.9	152.3	0	0	0	106	P23 T27	P23-L25 PolarHBondContact O-N 3.48Å; L25-T27 PolarHBondContact O-N 2.75Å
26	P	42.6	Very low	52.3	Low	106 Å²	106	137.4 Å²	137.4	69%	0.688	72%	0.72	S	S	*	*			trans	-54.6	120.4	179.4	17.8	-26.7	0	0	0	107.2	H28	P26-H28 VanDerWaalsContact C-N 3.27Å; P26-H28 PolarHBondContact O-N 3.21Å
27	T	42.4	Very low	53.9	Low	138 Å²	138	135.8 Å²	135.8	85%	0.847	71%	0.713	S	S	*	*			trans	-54.4	97.9	174.7	-5.1	0	0	0	0	106	L25 P29	L25-T27 PolarHBondContact O-N 2.75Å; T27-P29 WeakPolarHBondContact O-CD 3.28Å; T27-P29 VanDerWaalsContact O-N 3.09Å
28	H	44.5	Very low	55.3	Low	166 Å²	166	134 Å²	134	77%	0.769	70%	0.703	S	S	*	*			trans	-54	123.1	168.1	-98.5	-73.1	0	0	0	104.9	P26 M30	P26-H28 VanDerWaalsContact C-N 3.27Å; P26-H28 PolarHBondContact O-N 3.21Å; H28-M30 VanDerWaalsContact C-N 3.32Å; H28-M30 PolarHBondContact O-N 3.37Å
29	P	50.2	Low	57.1	Low	118 Å²	118	130.9 Å²	130.9	77%	0.766	69%	0.687	S	S	*	*			trans	-54.3	104.9	-177.4	18.7	-29.3	0	0	0	106.7	T27 M31	T27-P29 WeakPolarHBondContact O-CD 3.28Å; T27-P29 VanDerWaalsContact O-N 3.09Å; P29-M31 PolarHBondContact O-N 3.42Å
30	M	51.3	Low	59	Low	166 Å²	166	128.1 Å²	128.1	82%	0.818	67%	0.673	S	S	*	*			trans	-70.8	96.7	-177.6	-176.1	171.9	71.9	0	0	103.9	H28 S32	H28-M30 VanDerWaalsContact C-N 3.32Å; H28-M30 PolarHBondContact O-N 3.37Å; M30-S32 PolarHBondContact O-N 3.22Å
31	M	58.3	Low	60.7	Low	66 Å²	66	125.7 Å²	125.7	33%	0.325	66%	0.662	S	S	.	*			trans	-44.5	116.1	176.4	-72.4	-95.7	-65.1	0	0	107.9	P29 T35 R36 K39	P29-M31 PolarHBondContact O-N 3.42Å; M31-T35 HydrophobicContact CE-CG2 3.4Å; M31-T35 HydrophobicContact SD-CG2 3.74Å; M31-R36 HydrophobicContact CB-CG 4Å; M31-K39 HydrophobicContact CE-CD 3.62Å; M31-K39 HydrophobicContact CE-CG 4.13Å
32	S	66.1	Low	62.6	Low	68 Å²	68	123.9 Å²	123.9	48%	0.476	64%	0.644	S	S	.	*			trans	-48.5	144.9	175.5	23.5	0	0	0	0	109.4	M30 E34 T35 R36	M30-S32 PolarHBondContact O-N 3.22Å; S32-E34 PolarHBondContact O-N 3.32Å; S32-T35 WeakPolarHBondContact O-CA 3.32Å; S32-T35 PolarHBondContact O-N 3.47Å; S32-T35 PolarHBondContact OG-OG1 3.17Å; S32-R36 PolarHBondContact O-N 3.31Å; S32-R36 VanDerWaalsContact O-N 3.08Å
33	K	68.3	Low	64	Low	181 Å²	181	118.4 Å²	118.4	79%	0.787	63%	0.628	S	S	*	*	H	α-helix	trans	-47.8	-36.7	179.9	-119	176.9	179.4	178.5	0	111.7	R36 Q37	K33-R36 PolarHBondContact O-N 3.08Å; K33-Q37 PolarHBondContact O-N 3.26Å
34	E	72.4	Confident	65.4	Low	158 Å²	158	119.7 Å²	119.7	74%	0.738	62%	0.622	S	S	*	*	H	α-helix	trans	-64.1	-43.4	177	-143.1	160.7	-166.3	0	0	112.9	S32 Q37 S38	S32-E34 PolarHBondContact O-N 3.32Å; E34-Q37 PolarHBondContact O-N 2.94Å; E34-S38 WeakPolarHBondContact O-CB 3.43Å; E34-S38 PolarHBondContact O-N 3.01Å
35	T	77.8	Confident	67	Low	52 Å²	52	116.7 Å²	116.7	32%	0.319	61%	0.609	S	S	.	*	H	α-helix	trans	-70.3	-34.1	177.5	-35.7	0	0	0	0	112	M31 S32 K39	M31-T35 HydrophobicContact CE-CG2 3.4Å; M31-T35 HydrophobicContact SD-CG2 3.74Å; S32-T35 WeakPolarHBondContact O-CA 3.32Å; S32-T35 PolarHBondContact O-N 3.47Å; S32-T35 PolarHBondContact OG-OG1 3.17Å; T35-K39 PolarHBondContact O-N 3.27Å
36	R	75.9	Confident	68.2	Low	159 Å²	159	114.9 Å²	114.9	60%	0.6	60%	0.596	S	S	*	*	H	α-helix	trans	-65.6	-42.5	172.4	-80.2	-178.2	171.9	160.1	-0.6	111.7	M31 S32 K33 L40	M31-R36 HydrophobicContact CB-CG 4Å; S32-R36 PolarHBondContact O-N 3.31Å; S32-R36 VanDerWaalsContact O-N 3.08Å; K33-R36 PolarHBondContact O-N 3.08Å; R36-L40 WeakPolarHBondContact O-CB 3Å; R36-L40 PolarHBondContact O-N 2.84Å
37	Q	76.5	Confident	69.1	Low	140 Å²	140	116.3 Å²	116.3	65%	0.654	60%	0.597	S	S	*	*	H	α-helix	trans	-65.6	-42	175.6	-77.7	-172.7	-10.4	0	0	111.9	K33 E34 L40 A41	K33-Q37 PolarHBondContact O-N 3.26Å; E34-Q37 PolarHBondContact O-N 2.94Å; Q37-L40 PolarHBondContact O-N 3.27Å; Q37-A41 WeakPolarHBondContact O-CB 3.38Å; Q37-A41 PolarHBondContact O-N 2.78Å
38	S	80.2	Confident	70.2	Confident	77 Å²	77	114.4 Å²	114.4	54%	0.538	59%	0.586	S	S	.	*	H	α-helix	trans	-62.9	-44.6	177.7	-171.8	0	0	0	0	111.9	E34 L40 A41 E42	E34-S38 WeakPolarHBondContact O-CB 3.43Å; E34-S38 PolarHBondContact O-N 3.01Å; S38-L40 PolarHBondContact O-N 3.11Å; S38-A41 WeakPolarHBondContact O-CB 3.22Å; S38-A41 PolarHBondContact O-N 2.67Å; S38-E42 WeakPolarHBondContact O-CB 3.4Å; S38-E42 PolarHBondContact O-N 3.39Å
39	K	82.4	Confident	70.7	Confident	122 Å²	122	112.8 Å²	112.8	53%	0.53	58%	0.583	S	S	.	*	H	α-helix	trans	-67	-33.4	174	-72.2	-158.8	178.1	-177.5	0	113.8	M31 T35 A41 A43	M31-K39 HydrophobicContact CE-CD 3.62Å; M31-K39 HydrophobicContact CE-CG 4.13Å; T35-K39 PolarHBondContact O-N 3.27Å; K39-A41 VanDerWaalsContact C-N 3.34Å; K39-A43 VanDerWaalsContact O-CB 3.28Å; K39-A43 WeakPolarHBondContact O-CB 3.39Å; K39-A43 PolarHBondContact O-N 2.72Å
40	L	80.8	Confident	70.7	Confident	104 Å²	104	114.8 Å²	114.8	55%	0.545	58%	0.581	S	S	.	*	H	α-helix	trans	-67.7	-38.4	173.5	-166	87.9	0	0	0	110.9	R36 Q37 S38 K44	R36-L40 WeakPolarHBondContact O-CB 3Å; R36-L40 PolarHBondContact O-N 2.84Å; Q37-L40 PolarHBondContact O-N 3.27Å; S38-L40 PolarHBondContact O-N 3.11Å; L40-K44 WeakPolarHBondContact O-CB 3.08Å; L40-K44 VanDerWaalsContact O-CG 3.28Å; L40-K44 WeakPolarHBondContact O-CG 3.02Å; L40-K44 PolarHBondContact O-N 3.09Å
41	A	83.1	Confident	70.3	Confident	56 Å²	56	113.3 Å²	113.3	46%	0.463	57%	0.572	S	S	.	*	H	α-helix	trans	-66.2	-44.5	174.7	0	0	0	0	0	111.2	Q37 S38 K39 A43 K44 E45	Q37-A41 WeakPolarHBondContact O-CB 3.38Å; Q37-A41 PolarHBondContact O-N 2.78Å; S38-A41 WeakPolarHBondContact O-CB 3.22Å; S38-A41 PolarHBondContact O-N 2.67Å; K39-A41 VanDerWaalsContact C-N 3.34Å; A41-A43 PolarHBondContact O-N 2.96Å; A41-K44 CarbonylContact O-C 3.58Å; A41-K44 WeakPolarHBondContact O-CB 3.4Å; A41-K44 PolarHBondContact O-N 2.61Å; A41-K44 VanDerWaalsContact O-N 3.16Å; A41-E45 PolarHBondContact O-N 3.4Å
42	E	81.8	Confident	69.7	Low	101 Å²	101	114.1 Å²	114.1	47%	0.472	58%	0.583	S	S	.	*	H	α-helix	trans	-63.3	-41.6	176	-165.8	179.1	-163.9	0	0	111.4	S38 K44 E45 Q46	S38-E42 WeakPolarHBondContact O-CB 3.4Å; S38-E42 PolarHBondContact O-N 3.39Å; E42-K44 VanDerWaalsContact C-N 3.32Å; E42-K44 PolarHBondContact O-N 3.21Å; E42-E45 PolarHBondContact O-N 3.09Å; E42-Q46 VanDerWaalsContact O-CG 3.3Å; E42-Q46 WeakPolarHBondContact O-CG 3.15Å; E42-Q46 PolarHBondContact O-N 3.39Å
43	A	76.4	Confident	68.3	Low	55 Å²	55	120.4 Å²	120.4	46%	0.455	60%	0.604	S	S	.	*	H	α-helix	trans	-64	-36.9	173.8	0	0	0	0	0	112.3	K39 A41 L47	K39-A43 VanDerWaalsContact O-CB 3.28Å; K39-A43 WeakPolarHBondContact O-CB 3.39Å; K39-A43 PolarHBondContact O-N 2.72Å; A41-A43 PolarHBondContact O-N 2.96Å; A43-L47 WeakPolarHBondContact O-CB 3.24Å; A43-L47 PolarHBondContact O-N 3.29Å; A43-L47 VanDerWaalsContact O-N 3.08Å
44	K	75.8	Confident	67	Low	134 Å²	134	116.7 Å²	116.7	58%	0.583	60%	0.597	S	S	*	*	H	α-helix	trans	-66.9	-40.7	173	-76.2	176.4	178.8	-172.3	0	111.3	L40 A41 E42 L47 T48	L40-K44 WeakPolarHBondContact O-CB 3.08Å; L40-K44 VanDerWaalsContact O-CG 3.28Å; L40-K44 WeakPolarHBondContact O-CG 3.02Å; L40-K44 PolarHBondContact O-N 3.09Å; A41-K44 CarbonylContact O-C 3.58Å; A41-K44 WeakPolarHBondContact O-CB 3.4Å; A41-K44 PolarHBondContact O-N 2.61Å; A41-K44 VanDerWaalsContact O-N 3.16Å; E42-K44 VanDerWaalsContact C-N 3.32Å; E42-K44 PolarHBondContact O-N 3.21Å; K44-L47 PolarHBondContact O-N 3.18Å; K44-T48 PolarHBondContact O-N 2.95Å; K44-T48 PolarHBondContact O-OG1 3.34Å
45	E	75.7	Confident	65.3	Low	125 Å²	125	116.1 Å²	116.1	58%	0.584	60%	0.599	S	S	*	*	H	α-helix	trans	-62.5	-47.1	176.3	-170.4	175.9	-176.2	0	0	111	A41 E42 L47 T48 D49	A41-E45 PolarHBondContact O-N 3.4Å; E42-E45 PolarHBondContact O-N 3.09Å; E45-L47 VanDerWaalsContact C-N 3.27Å; E45-L47 PolarHBondContact O-N 3.44Å; E45-T48 WeakPolarHBondContact O-CA 3.47Å; E45-T48 WeakPolarHBondContact O-CB 3.48Å; E45-T48 PolarHBondContact O-N 2.87Å; E45-D49 PolarHBondContact O-N 3.28Å
46	Q	70.5	Confident	63.6	Low	120 Å²	120	118.7 Å²	118.7	56%	0.561	62%	0.616	S	S	*	*	H	α-helix	trans	-63.2	-31.9	176.2	-65.3	-136.6	34.2	0	0	113.2	E42 T48 H50	E42-Q46 VanDerWaalsContact O-CG 3.3Å; E42-Q46 WeakPolarHBondContact O-CG 3.15Å; E42-Q46 PolarHBondContact O-N 3.39Å; Q46-T48 VanDerWaalsContact C-N 3.32Å; Q46-H50 PolarHBondContact O-N 2.95Å
47	L	61.6	Low	61.6	Low	137 Å²	137	116.9 Å²	116.9	72%	0.717	63%	0.628	S	S	*	*	H	α-helix	trans	-73.4	-27.2	173.3	-126.2	137.4	0	0	0	112.3	A43 K44 E45	A43-L47 WeakPolarHBondContact O-CB 3.24Å; A43-L47 PolarHBondContact O-N 3.29Å; A43-L47 VanDerWaalsContact O-N 3.08Å; K44-L47 PolarHBondContact O-N 3.18Å; E45-L47 VanDerWaalsContact C-N 3.27Å; E45-L47 PolarHBondContact O-N 3.44Å
48	T	65.4	Low	59.7	Low	98 Å²	98	116 Å²	116	60%	0.601	63%	0.632	S	S	*	*	H	α-helix	trans	-75.9	-39.6	176.6	-44.7	0	0	0	0	110.7	K44 E45 Q46 H50 H51	K44-T48 PolarHBondContact O-N 2.95Å; K44-T48 PolarHBondContact O-OG1 3.34Å; E45-T48 WeakPolarHBondContact O-CA 3.47Å; E45-T48 WeakPolarHBondContact O-CB 3.48Å; E45-T48 PolarHBondContact O-N 2.87Å; Q46-T48 VanDerWaalsContact C-N 3.32Å; T48-H50 VanDerWaalsContact C-N 3.31Å; T48-H50 PolarHBondContact O-N 3.49Å; T48-H51 WeakPolarHBondContact O-CB 3.23Å; T48-H51 PolarHBondContact O-N 3.06Å; T48-H51 VanDerWaalsContact O-N 3.15Å
49	D	54.7	Low	57.5	Low	132 Å²	132	115.1 Å²	115.1	71%	0.706	64%	0.636	S	S	*	*	H	α-helix	trans	-72	-24.1	176	-81.3	-15.2	0	0	0	113.3	E45 H51	E45-D49 PolarHBondContact O-N 3.28Å; D49-H51 VanDerWaalsContact C-N 3.27Å; D49-H51 PolarHBondContact O-N 2.64Å
50	H	49.3	Very low	55.1	Low	159 Å²	159	116.4 Å²	116.4	74%	0.736	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82	3.4	170.6	-91.3	-49.7	0	0	0	114.5	Q46 T48 P52	Q46-H50 PolarHBondContact O-N 2.95Å; T48-H50 VanDerWaalsContact C-N 3.31Å; T48-H50 PolarHBondContact O-N 3.49Å; H50-P52 WeakPolarHBondContact O-CD 3.5Å
51	H	44.4	Very low	52.7	Low	135 Å²	135	115.9 Å²	115.9	63%	0.625	67%	0.665	S	S	*	*	S	Bend	trans	-77.5	110.1	166.5	-161.3	63.9	0	0	0	109.5	T48 D49 Q53	T48-H51 WeakPolarHBondContact O-CB 3.23Å; T48-H51 PolarHBondContact O-N 3.06Å; T48-H51 VanDerWaalsContact O-N 3.15Å; D49-H51 VanDerWaalsContact C-N 3.27Å; D49-H51 PolarHBondContact O-N 2.64Å; H51-Q53 PolarHBondContact O-N 2.93Å
52	P	44	Very low	50.3	Low	84 Å²	84	117.7 Å²	117.7	55%	0.545	68%	0.679	S	S	.	*			trans	-62.8	117.2	-178.3	-14.8	30.3	0	0	0	108.4	H50 T54	H50-P52 WeakPolarHBondContact O-CD 3.5Å; P52-T54 PolarHBondContact O-N 2.73Å
53	Q	37.6	Very low	48.1	Very low	199 Å²	199	118 Å²	118	93%	0.93	69%	0.693	S	S	*	*			trans	-64.2	74.5	162	-74.2	-174.9	1.7	0	0	109	H51	H51-Q53 PolarHBondContact O-N 2.93Å
54	T	40.9	Very low	46.2	Very low	104 Å²	104	123 Å²	123	64%	0.638	71%	0.712	S	S	*	*			trans	-130.5	56	167.8	42.9	0	0	0	0	108.4	P52	P52-T54 PolarHBondContact O-N 2.73Å
55	N	37	Very low	44.3	Very low	146 Å²	146	122.6 Å²	122.6	78%	0.781	72%	0.721	S	S	*	*			trans	-109	90.2	150.6	-77.4	-38.3	0	0	0	106.5	S57	N55-S57 PolarHBondContact O-N 3.38Å
56	P	40.5	Very low	42.3	Very low	105 Å²	105	126.4 Å²	126.4	68%	0.682	74%	0.735	S	S	*	*			trans	-63.8	108.6	166.2	27.5	-28.3	0	0	0	106.3	V58	P56-V58 HydrophobicContact CB-CG2 4.23Å; P56-V58 PolarHBondContact O-N 3.19Å
57	S	35.5	Very low	40.8	Very low	121 Å²	121	130.1 Å²	130.1	85%	0.846	75%	0.75	S	S	*	*			trans	-58.1	86.7	161	-177.5	0	0	0	0	107.5	N55 G59	N55-S57 PolarHBondContact O-N 3.38Å; S57-G59 PolarHBondContact O-N 3.33Å; S57-G59 VanDerWaalsContact O-N 3.08Å
58	V	36.5	Very low	39.7	Very low	121 Å²	121	132.5 Å²	132.5	73%	0.733	75%	0.754	S	S	*	*			trans	-82.5	85.1	169.4	-179.7	0	0	0	0	106.2	P56 T60	P56-V58 HydrophobicContact CB-CG2 4.23Å; P56-V58 PolarHBondContact O-N 3.19Å; V58-T60 PolarHBondContact O-N 2.79Å
59	G	32.5	Very low	38.2	Very low	60 Å²	60	137.7 Å²	137.7	62%	0.619	77%	0.768	S	S	*	*			trans	-51.9	122	156.5	0	0	0	0	0	109.1	S57 A61	S57-G59 PolarHBondContact O-N 3.33Å; S57-G59 VanDerWaalsContact O-N 3.08Å; G59-A61 PolarHBondContact O-N 2.63Å
60	T	33.7	Very low	37.5	Very low	148 Å²	148	137 Å²	137	91%	0.908	76%	0.763	S	S	*	*			trans	-62.5	107.7	176.1	-31	0	0	0	0	109.2	V58	V58-T60 PolarHBondContact O-N 2.79Å
61	A	30.4	Very low	36.8	Very low	94 Å²	94	135.6 Å²	135.6	78%	0.777	76%	0.761	S	S	*	*			trans	-145.7	104.6	166.5	0	0	0	0	0	111.4	G59	G59-A61 PolarHBondContact O-N 2.63Å
62	A	32.8	Very low	36.3	Very low	93 Å²	93	136.5 Å²	136.5	77%	0.769	77%	0.771	S	S	*	*			trans	-6.1	117.6	162	0	0	0	0	0	118.2	D64	A62-D64 PolarHBondContact O-N 3.4Å
63	S	35.7	Very low	35.7	Very low	108 Å²	108	136 Å²	136	76%	0.755	78%	0.78	S	S	*	*			trans	-76	100.5	157.4	48.3	0	0	0	0	110.6	T65	S63-T65 PolarHBondContact O-N 3.05Å
64	D	35.7	Very low	35.6	Very low	161 Å²	161	133.4 Å²	133.4	86%	0.861	78%	0.779	S	S	*	*			trans	-76	94.1	163	-91	-32.4	0	0	0	109.8	A62 K66	A62-D64 PolarHBondContact O-N 3.4Å; D64-K66 PolarHBondContact O-N 3.4Å; D64-K66 VanDerWaalsContact O-N 3.11Å
65	T	36.6	Very low	35.2	Very low	124 Å²	124	135.6 Å²	135.6	76%	0.761	79%	0.786	S	S	*	*			trans	-75.5	88.4	169.2	25.8	0	0	0	0	110.5	S63 K67	S63-T65 PolarHBondContact O-N 3.05Å; T65-K67 PolarHBondContact O-N 2.94Å
66	K	34	Very low	35.6	Very low	205 Å²	205	133.4 Å²	133.4	89%	0.891	78%	0.78	S	S	*	*			trans	-91.9	73.5	165.7	-148.5	170.7	-169.2	169.7	0	110.2	D64 K68	D64-K66 PolarHBondContact O-N 3.4Å; D64-K66 VanDerWaalsContact O-N 3.11Å; K66-K68 PolarHBondContact O-N 3.26Å
67	K	38.9	Very low	35.1	Very low	199 Å²	199	137.4 Å²	137.4	87%	0.865	79%	0.79	S	S	*	*			trans	-82.4	108.8	167.2	-86.1	-174.9	176.8	176.7	0	109.7	T65 K69	T65-K67 PolarHBondContact O-N 2.94Å; K67-K69 PolarHBondContact O-N 3.41Å
68	K	38	Very low	35.2	Very low	186 Å²	186	137.5 Å²	137.5	81%	0.809	79%	0.786	S	S	*	*			trans	-71.2	119.8	174.2	-159.8	175	-176.6	-179.2	0	109.2	K66 I70	K66-K68 PolarHBondContact O-N 3.26Å; K68-I70 HydrophobicContact CD-CD1 4.4Å; K68-I70 HydrophobicContact CG-CG1 4.32Å
69	K	32.9	Very low	35	Very low	207 Å²	207	138.5 Å²	138.5	90%	0.9	79%	0.792	S	S	*	*			trans	-73.6	118.8	172	-128.6	162.9	176.9	174.9	0	108.7	K67	K67-K69 PolarHBondContact O-N 3.41Å
70	I	41.1	Very low	35.2	Very low	117 Å²	117	141.4 Å²	141.4	60%	0.6	80%	0.798	S	S	*	*			trans	-142.3	91.1	171.2	-45.3	173.8	0	0	0	103.9	K68	K68-I70 HydrophobicContact CD-CD1 4.4Å; K68-I70 HydrophobicContact CG-CG1 4.32Å
71	N	33.8	Very low	35.5	Very low	130 Å²	130	139.2 Å²	139.2	70%	0.695	79%	0.789	S	S	*	*				88.6	126.9	92.8	88.5	-4.7	0	0	0	113.9
72	N	34.5	Very low	35.9	Very low	155 Å²	155	138 Å²	138	83%	0.829	79%	0.785	S	S	*	*			trans	47.3	103.8	150.1	-63.7	2.3	0	0	0	120.8
73	G	32	Very low	36.3	Very low	72 Å²	72	136.7 Å²	136.7	74%	0.742	78%	0.781	S	S	*	*				75.8	123.3	106.7	0	0	0	0	0	117.6
74	T	34.9	Very low	36.6	Very low	146 Å²	146	137 Å²	137	90%	0.896	78%	0.782	S	S	*	*				175.7	130	121.9	-70.5	0	0	0	0	109.4
75	N	32.3	Very low	37.2	Very low	149 Å²	149	137.8 Å²	137.8	80%	0.797	78%	0.78	S	S	*	*			trans	-49.3	-176.2	168.6	-72.9	-35.6	0	0	0	114.8
76	P	46.1	Very low	37.9	Very low	101 Å²	101	133.9 Å²	133.9	66%	0.656	76%	0.758	S	S	*	*			cis	-131.2	171.5	-13	23	1.4	0	0	0	114.3
77	E	29.7	Very low	38.9	Very low	189 Å²	189	128.1 Å²	128.1	88%	0.883	74%	0.742	S	S	*	*			trans	24.2	104.9	140.3	-56.9	176.8	172.7	0	0	118.9
78	T	36.3	Very low	39.9	Very low	123 Å²	123	124.2 Å²	124.2	76%	0.755	73%	0.726	S	S	*	*			trans	-145.5	111.5	140.6	-46.1	0	0	0	0	109.1	T80	T78-T80 PolarHBondContact O-N 3.2Å
79	T	32.8	Very low	41.1	Very low	141 Å²	141	120 Å²	120	87%	0.865	71%	0.713	S	S	*	*			trans	-47.7	112.9	163.6	31.3	0	0	0	0	111
80	T	37.7	Very low	42.6	Very low	121 Å²	121	117.4 Å²	117.4	74%	0.742	70%	0.704	S	S	*	*			trans	-149.1	103.7	159.3	-50.6	0	0	0	0	110.5	T78	T78-T80 PolarHBondContact O-N 3.2Å
81	S	39	Very low	44.2	Very low	102 Å²	102	117.5 Å²	117.5	71%	0.713	70%	0.701	S	S	*	*			trans	53.2	108.6	138.5	-166.8	0	0	0	0	117.1	G83	S81-G83 PolarHBondContact O-N 2.91Å
82	G	38.8	Very low	46.3	Very low	69 Å²	69	117 Å²	117	71%	0.711	69%	0.693	S	S	*	*			trans	-42.8	108.7	161.9	0	0	0	0	0	109.9	C84	G82-C84 PolarHBondContact O-N 2.91Å
83	G	41.8	Very low	48.3	Very low	66 Å²	66	112.3 Å²	112.3	68%	0.68	68%	0.676	S	S	*	*			trans	-62.1	98.6	166.5	0	0	0	0	0	105.4	S81 H85	S81-G83 PolarHBondContact O-N 2.91Å; G83-H85 PolarHBondContact O-N 3.1Å
84	C	41.9	Very low	50.4	Low	114 Å²	114	111.8 Å²	111.8	77%	0.77	66%	0.661	S	S	*	*			trans	-43	114.8	158.9	-64.7	0	0	0	0	105.8	G82 S86	G82-C84 PolarHBondContact O-N 2.91Å; C84-S86 VanDerWaalsContact C-N 3.33Å; C84-S86 PolarHBondContact O-N 3.12Å
85	H	48	Very low	52.6	Low	178 Å²	178	109.8 Å²	109.8	82%	0.824	64%	0.641	S	S	*	*			trans	-49.3	111.3	160.3	-70.7	-70.2	0	0	0	104.8	G83 P87	G83-H85 PolarHBondContact O-N 3.1Å; H85-P87 VanDerWaalsContact O-CD 3.31Å; H85-P87 WeakPolarHBondContact O-CD 3.01Å; H85-P87 VanDerWaalsContact O-N 3.09Å
86	S	51.7	Low	55.1	Low	41 Å²	41	109 Å²	109	29%	0.287	63%	0.633	S	S	.	*			trans	-60.2	123.7	-173.2	-165.5	0	0	0	0	105.2	C84 E88 D89	C84-S86 VanDerWaalsContact C-N 3.33Å; C84-S86 PolarHBondContact O-N 3.12Å; S86-E88 PolarHBondContact O-N 3.46Å; S86-E88 WeakPolarHBondContact OG-CG 3.16Å; S86-E88 PolarHBondContact OG-OE2 3.09Å; S86-D89 PolarHBondContact O-N 2.66Å
87	P	55.5	Low	56.9	Low	85 Å²	85	110.1 Å²	110.1	55%	0.552	63%	0.629	S	S	*	*	H	α-helix	trans	-52.8	-16.8	174.1	17.6	-28.6	0	0	0	111.8	H85 Q91	H85-P87 VanDerWaalsContact O-CD 3.31Å; H85-P87 WeakPolarHBondContact O-CD 3.01Å; H85-P87 VanDerWaalsContact O-N 3.09Å; P87-Q91 VanDerWaalsContact O-CB 3.22Å; P87-Q91 WeakPolarHBondContact O-CB 3.35Å; P87-Q91 WeakPolarHBondContact O-CG 3.13Å; P87-Q91 PolarHBondContact O-N 3.27Å
88	E	59.2	Low	59.7	Low	117 Å²	117	105.8 Å²	105.8	55%	0.547	61%	0.609	S	S	.	*	H	α-helix	trans	-59.1	-38.4	170.1	-62.9	175	147.5	0	0	114.7	S86 Q91 K92	S86-E88 PolarHBondContact O-N 3.46Å; S86-E88 WeakPolarHBondContact OG-CG 3.16Å; S86-E88 PolarHBondContact OG-OE2 3.09Å; E88-Q91 PolarHBondContact O-N 3.08Å; E88-K92 WeakPolarHBondContact O-CB 3.29Å; E88-K92 VanDerWaalsContact O-CG 3.27Å; E88-K92 WeakPolarHBondContact O-CG 3.24Å; E88-K92 PolarHBondContact O-N 2.93Å
89	D	62.9	Low	62.1	Low	98 Å²	98	104.3 Å²	104.3	52%	0.524	59%	0.593	S	S	.	*	H	α-helix	trans	-78.8	-37.2	-176.6	-73.3	-25	0	0	0	111.8	S86 Q91 K92 A93	S86-D89 PolarHBondContact O-N 2.66Å; D89-Q91 VanDerWaalsContact C-N 3.34Å; D89-K92 PolarHBondContact O-N 3.47Å; D89-K92 IonicContact OD1-NZ 3.28Å; D89-K92 PolarHBondContact OD1-NZ 3.4Å; D89-A93 PolarHBondContact O-N 3.29Å
90	E	65.1	Low	64.9	Low	152 Å²	152	99.9 Å²	99.9	71%	0.71	57%	0.571	S	S	*	*	H	α-helix	trans	-65	-39.1	167.8	-75.2	-171.1	164.2	0	0	111.4	A93 S94	E90-A93 PolarHBondContact O-N 3.36Å; E90-S94 WeakPolarHBondContact O-CB 3.47Å; E90-S94 PolarHBondContact O-N 3.4Å
91	Q	74.6	Confident	67.5	Low	118 Å²	118	98.4 Å²	98.4	55%	0.551	56%	0.558	S	S	*	*	H	α-helix	trans	-61.9	-44.3	172.4	-82.7	-174	2.5	0	0	111.5	P87 E88 D89 A93 S94 H95	P87-Q91 VanDerWaalsContact O-CB 3.22Å; P87-Q91 WeakPolarHBondContact O-CB 3.35Å; P87-Q91 WeakPolarHBondContact O-CG 3.13Å; P87-Q91 PolarHBondContact O-N 3.27Å; E88-Q91 PolarHBondContact O-N 3.08Å; D89-Q91 VanDerWaalsContact C-N 3.34Å; Q91-A93 PolarHBondContact O-N 3.04Å; Q91-S94 PolarHBondContact O-N 3.31Å; Q91-H95 WeakPolarHBondContact O-CB 3.06Å; Q91-H95 PolarHBondContact O-N 3.46Å; Q91-H95 PolarHBondContact O-ND1 3.42Å
92	K	76.5	Confident	70	Confident	120 Å²	120	101.4 Å²	101.4	52%	0.522	55%	0.554	S	S	.	*	H	α-helix	trans	-60.6	-45.3	177.2	-79.9	170.7	-169.1	161.1	0	112	E88 D89 S94 H95 Q96	E88-K92 WeakPolarHBondContact O-CB 3.29Å; E88-K92 VanDerWaalsContact O-CG 3.27Å; E88-K92 WeakPolarHBondContact O-CG 3.24Å; E88-K92 PolarHBondContact O-N 2.93Å; D89-K92 PolarHBondContact O-N 3.47Å; D89-K92 IonicContact OD1-NZ 3.28Å; D89-K92 PolarHBondContact OD1-NZ 3.4Å; K92-S94 VanDerWaalsContact C-N 3.34Å; K92-S94 PolarHBondContact O-N 3.4Å; K92-H95 PolarHBondContact O-N 3.32Å; K92-Q96 WeakPolarHBondContact O-CB 3.31Å; K92-Q96 WeakPolarHBondContact O-CG 2.96Å; K92-Q96 PolarHBondContact O-N 2.68Å
93	A	77.9	Confident	72.5	Confident	57 Å²	57	104.8 Å²	104.8	47%	0.471	55%	0.545	S	S	.	.	H	α-helix	trans	-62.6	-41.6	177.1	0	0	0	0	0	111.8	D89 E90 Q91 Q96 H97	D89-A93 PolarHBondContact O-N 3.29Å; E90-A93 PolarHBondContact O-N 3.36Å; Q91-A93 PolarHBondContact O-N 3.04Å; A93-Q96 PolarHBondContact O-N 3Å; A93-H97 WeakPolarHBondContact O-CB 3.31Å; A93-H97 PolarHBondContact O-N 3.34Å
94	S	76.7	Confident	74.9	Confident	60 Å²	60	107.1 Å²	107.1	42%	0.42	54%	0.538	S	S	.	.	H	α-helix	trans	-64.4	-41.9	175.1	-174.4	0	0	0	0	112.5	E90 Q91 K92 H97 Q98	E90-S94 WeakPolarHBondContact O-CB 3.47Å; E90-S94 PolarHBondContact O-N 3.4Å; Q91-S94 PolarHBondContact O-N 3.31Å; K92-S94 VanDerWaalsContact C-N 3.34Å; K92-S94 PolarHBondContact O-N 3.4Å; S94-H97 PolarHBondContact O-N 3.2Å; S94-Q98 WeakPolarHBondContact O-CG 3.33Å; S94-Q98 PolarHBondContact O-N 2.98Å
95	H	80.3	Confident	77.4	Confident	105 Å²	105	106.8 Å²	106.8	49%	0.486	53%	0.528	S	S	.	.	H	α-helix	trans	-64.9	-44.2	174.9	-78.1	74.8	0	0	0	111.4	Q91 K92 H97 Q98 E99	Q91-H95 WeakPolarHBondContact O-CB 3.06Å; Q91-H95 PolarHBondContact O-N 3.46Å; Q91-H95 PolarHBondContact O-ND1 3.42Å; K92-H95 PolarHBondContact O-N 3.32Å; H95-H97 VanDerWaalsContact C-N 3.31Å; H95-H97 PolarHBondContact O-N 3.23Å; H95-Q98 PolarHBondContact O-N 3.34Å; H95-E99 WeakPolarHBondContact O-CG 3.15Å; H95-E99 PolarHBondContact O-N 2.77Å
96	Q	83.9	Confident	79.5	Confident	133 Å²	133	104.2 Å²	104.2	62%	0.621	52%	0.517	S	S	*	.	H	α-helix	trans	-60.4	-41.1	175.6	-76.2	178.8	-2.1	0	0	111.8	K92 A93 E99 A100	K92-Q96 WeakPolarHBondContact O-CB 3.31Å; K92-Q96 WeakPolarHBondContact O-CG 2.96Å; K92-Q96 PolarHBondContact O-N 2.68Å; A93-Q96 PolarHBondContact O-N 3Å; Q96-E99 PolarHBondContact O-N 3.27Å; Q96-A100 WeakPolarHBondContact O-CB 3.14Å; Q96-A100 PolarHBondContact O-N 2.96Å
97	H	85.5	Confident	81.5	Confident	124 Å²	124	104.9 Å²	104.9	57%	0.574	53%	0.525	S	S	*	.	H	α-helix	trans	-65.2	-42.9	175	-175.4	57.1	0	0	0	112.1	A93 S94 H95 E99 A100 L101	A93-H97 WeakPolarHBondContact O-CB 3.31Å; A93-H97 PolarHBondContact O-N 3.34Å; S94-H97 PolarHBondContact O-N 3.2Å; H95-H97 VanDerWaalsContact C-N 3.31Å; H95-H97 PolarHBondContact O-N 3.23Å; H97-E99 VanDerWaalsContact C-N 3.34Å; H97-E99 PolarHBondContact O-N 2.68Å; H97-A100 PolarHBondContact O-N 3.46Å; H97-L101 WeakPolarHBondContact NE2-CD1 3.46Å; H97-L101 PolarHBondContact O-N 2.85Å
98	Q	87.2	Confident	83.4	Confident	98 Å²	98	105.8 Å²	105.8	46%	0.458	52%	0.521	S	S	.	.	H	α-helix	trans	-62.1	-40.1	173.8	-76.8	-176.3	9.5	0	0	112.3	S94 H95 L101 R102	S94-Q98 WeakPolarHBondContact O-CG 3.33Å; S94-Q98 PolarHBondContact O-N 2.98Å; H95-Q98 PolarHBondContact O-N 3.34Å; Q98-L101 PolarHBondContact O-N 3.26Å; Q98-R102 WeakPolarHBondContact O-CG 2.92Å; Q98-R102 PolarHBondContact O-N 3.24Å
99	E	88.2	Confident	85.1	Confident	91 Å²	91	104.5 Å²	104.5	43%	0.425	52%	0.521	S	S	.	.	H	α-helix	trans	-67.8	-38.7	175.4	-73.8	-174.3	-174.8	0	0	112.3	H95 Q96 H97 R102 R103	H95-E99 WeakPolarHBondContact O-CG 3.15Å; H95-E99 PolarHBondContact O-N 2.77Å; Q96-E99 PolarHBondContact O-N 3.27Å; H97-E99 VanDerWaalsContact C-N 3.34Å; H97-E99 PolarHBondContact O-N 2.68Å; E99-R102 PolarHBondContact O-N 3.31Å; E99-R103 WeakPolarHBondContact O-CG 3.31Å; E99-R103 PolarHBondContact O-N 3.26Å; E99-R103 IonicContact OE2-CZ 3.89Å; E99-R103 IonicContact OE2-NH1 2.73Å; E99-R103 IonicContact OE2-NH2 2.84Å; E99-R103 PolarHBondContact OE2-NH2 2.78Å
100	A	90.3	Very high	86.6	Confident	48 Å²	48	105.3 Å²	105.3	40%	0.397	52%	0.522	S	S	.	.	H	α-helix	trans	-60.5	-46.8	174.1	0	0	0	0	0	111	Q96 H97 R102 R103 E104	Q96-A100 WeakPolarHBondContact O-CB 3.14Å; Q96-A100 PolarHBondContact O-N 2.96Å; H97-A100 PolarHBondContact O-N 3.46Å; A100-R102 VanDerWaalsContact C-N 3.33Å; A100-R102 PolarHBondContact O-N 3.46Å; A100-R103 PolarHBondContact O-N 2.96Å; A100-E104 WeakPolarHBondContact O-CB 3.37Å; A100-E104 PolarHBondContact O-N 2.63Å
101	L	91.9	Very high	88	Confident	91 Å²	91	101.7 Å²	101.7	48%	0.476	51%	0.51	S	S	.	.	H	α-helix	trans	-58.9	-40.2	173.1	-96.8	148.8	0	0	0	112.7	H97 Q98 E104 L105	H97-L101 WeakPolarHBondContact NE2-CD1 3.46Å; H97-L101 PolarHBondContact O-N 2.85Å; Q98-L101 PolarHBondContact O-N 3.26Å; L101-E104 PolarHBondContact O-N 3.46Å; L101-L105 WeakPolarHBondContact O-CB 3.41Å; L101-L105 PolarHBondContact O-N 2.75Å
102	R	92.5	Very high	89	Confident	164 Å²	164	101 Å²	101	62%	0.619	51%	0.509	S	S	*	.	H	α-helix	trans	-65.1	-45.9	175.5	-76.5	179.4	-175	-147.2	4.5	112.1	Q98 E99 A100 E104 L105 E106	Q98-R102 WeakPolarHBondContact O-CG 2.92Å; Q98-R102 PolarHBondContact O-N 3.24Å; E99-R102 PolarHBondContact O-N 3.31Å; A100-R102 VanDerWaalsContact C-N 3.33Å; A100-R102 PolarHBondContact O-N 3.46Å; R102-E104 VanDerWaalsContact C-N 3.28Å; R102-E104 PolarHBondContact O-N 3.27Å; R102-L105 PolarHBondContact O-N 2.9Å; R102-E106 WeakPolarHBondContact O-CB 3.45Å; R102-E106 WeakPolarHBondContact O-CG 3.41Å; R102-E106 PolarHBondContact O-N 2.89Å
103	R	90.6	Very high	89.9	Confident	141 Å²	141	103.3 Å²	103.3	53%	0.532	51%	0.514	S	S	.	.	H	α-helix	trans	-61.4	-39.1	176.7	-70.6	-177.3	-165.4	93.6	5.9	111.4	E99 A100 E106 A107	E99-R103 WeakPolarHBondContact O-CG 3.31Å; E99-R103 PolarHBondContact O-N 3.26Å; E99-R103 IonicContact OE2-CZ 3.89Å; E99-R103 IonicContact OE2-NH1 2.73Å; E99-R103 IonicContact OE2-NH2 2.84Å; E99-R103 PolarHBondContact OE2-NH2 2.78Å; A100-R103 PolarHBondContact O-N 2.96Å; R103-E106 PolarHBondContact O-N 3.47Å; R103-A107 WeakPolarHBondContact O-CB 3.49Å; R103-A107 PolarHBondContact O-N 2.9Å
104	E	92.7	Very high	90.7	Very high	114 Å²	114	104.9 Å²	104.9	53%	0.533	51%	0.514	S	S	.	.	H	α-helix	trans	-65.4	-43.6	176	-167.4	173.7	-172.3	0	0	111.6	A100 L101 R102 A107 Q108	A100-E104 WeakPolarHBondContact O-CB 3.37Å; A100-E104 PolarHBondContact O-N 2.63Å; L101-E104 PolarHBondContact O-N 3.46Å; R102-E104 VanDerWaalsContact C-N 3.28Å; R102-E104 PolarHBondContact O-N 3.27Å; E104-A107 PolarHBondContact O-N 2.72Å; E104-Q108 WeakPolarHBondContact O-CG 3.37Å; E104-Q108 PolarHBondContact O-N 2.76Å
105	L	93.7	Very high	91.6	Very high	108 Å²	108	106.7 Å²	106.7	57%	0.565	52%	0.518	S	S	*	.	H	α-helix	trans	-62.5	-42.9	174.6	-171.9	68.6	0	0	0	112	L101 R102 Q108 V109	L101-L105 WeakPolarHBondContact O-CB 3.41Å; L101-L105 PolarHBondContact O-N 2.75Å; R102-L105 PolarHBondContact O-N 2.9Å; L105-Q108 PolarHBondContact O-N 3.16Å; L105-V109 WeakPolarHBondContact O-CG2 3.49Å; L105-V109 PolarHBondContact O-N 2.93Å
106	E	93.6	Very high	92.3	Very high	124 Å²	124	105.3 Å²	105.3	58%	0.579	52%	0.518	S	S	*	.	H	α-helix	trans	-62.4	-43	176.3	-75.1	170.6	-170	0	0	111.9	R102 R103 Q108 V109 H110	R102-E106 WeakPolarHBondContact O-CB 3.45Å; R102-E106 WeakPolarHBondContact O-CG 3.41Å; R102-E106 PolarHBondContact O-N 2.89Å; R103-E106 PolarHBondContact O-N 3.47Å; E106-Q108 PolarHBondContact O-N 3.18Å; E106-V109 PolarHBondContact O-N 3.03Å; E106-H110 PolarHBondContact O-N 3.46Å
107	A	93.6	Very high	92.8	Very high	55 Å²	55	101.9 Å²	101.9	46%	0.455	51%	0.508	S	S	.	.	H	α-helix	trans	-63	-40.6	175.4	0	0	0	0	0	112.1	R103 E104 H110 T111	R103-A107 WeakPolarHBondContact O-CB 3.49Å; R103-A107 PolarHBondContact O-N 2.9Å; E104-A107 PolarHBondContact O-N 2.72Å; A107-H110 PolarHBondContact O-N 3.39Å; A107-T111 WeakPolarHBondContact O-CB 3.33Å; A107-T111 PolarHBondContact O-N 3.39Å; A107-T111 PolarHBondContact O-OG1 3.04Å
108	Q	95.5	Very high	93.2	Very high	103 Å²	103	100.4 Å²	100.4	48%	0.481	50%	0.501	S	S	.	.	H	α-helix	trans	-63.8	-44.2	174.6	-72.5	179.1	19.5	0	0	111.8	E104 L105 E106 H110 T111 I112	E104-Q108 WeakPolarHBondContact O-CG 3.37Å; E104-Q108 PolarHBondContact O-N 2.76Å; L105-Q108 PolarHBondContact O-N 3.16Å; E106-Q108 PolarHBondContact O-N 3.18Å; Q108-H110 VanDerWaalsContact C-N 3.35Å; Q108-H110 PolarHBondContact O-N 3.41Å; Q108-T111 PolarHBondContact O-N 2.87Å; Q108-I112 VanDerWaalsContact O-CG1 3.3Å; Q108-I112 WeakPolarHBondContact O-CG1 3.49Å; Q108-I112 PolarHBondContact O-N 2.73Å
109	V	94.7	Very high	93.6	Very high	90 Å²	90	101.8 Å²	101.8	55%	0.545	51%	0.505	S	S	.	.	H	α-helix	trans	-61.2	-43.2	175.8	170.4	0	0	0	0	111.3	L105 E106 T111 I112 R113	L105-V109 WeakPolarHBondContact O-CG2 3.49Å; L105-V109 PolarHBondContact O-N 2.93Å; E106-V109 PolarHBondContact O-N 3.03Å; V109-T111 VanDerWaalsContact C-N 3.34Å; V109-T111 PolarHBondContact O-N 3.44Å; V109-I112 PolarHBondContact O-N 3.43Å; V109-R113 PolarHBondContact O-N 2.71Å
110	H	94.3	Very high	93.9	Very high	115 Å²	115	101 Å²	101	53%	0.532	51%	0.507	S	S	.	.	H	α-helix	trans	-60.9	-43.6	175.8	-110.8	-64.6	0	0	0	112.1	E106 A107 Q108 R113 I114	E106-H110 PolarHBondContact O-N 3.46Å; A107-H110 PolarHBondContact O-N 3.39Å; Q108-H110 VanDerWaalsContact C-N 3.35Å; Q108-H110 PolarHBondContact O-N 3.41Å; H110-R113 WeakPolarHBondContact O-CB 3.36Å; H110-R113 PolarHBondContact O-N 2.91Å; H110-I114 WeakPolarHBondContact O-CG1 3.19Å; H110-I114 PolarHBondContact O-N 3.46Å
111	T	94.3	Very high	94.1	Very high	76 Å²	76	104.4 Å²	104.4	47%	0.466	52%	0.515	S	S	.	.	H	α-helix	trans	-62.3	-45.8	177.2	-56.3	0	0	0	0	111.2	A107 Q108 V109 R113 I114 L115	A107-T111 WeakPolarHBondContact O-CB 3.33Å; A107-T111 PolarHBondContact O-N 3.39Å; A107-T111 PolarHBondContact O-OG1 3.04Å; Q108-T111 PolarHBondContact O-N 2.87Å; V109-T111 VanDerWaalsContact C-N 3.34Å; V109-T111 PolarHBondContact O-N 3.44Å; T111-R113 VanDerWaalsContact C-N 3.28Å; T111-R113 PolarHBondContact O-N 3.17Å; T111-I114 PolarHBondContact O-N 3.26Å; T111-L115 HydrophobicContact CG2-CD1 4.04Å; T111-L115 HydrophobicContact CG2-CG 4.43Å; T111-L115 WeakPolarHBondContact O-CG 3.23Å; T111-L115 PolarHBondContact O-N 3.23Å
112	I	95.5	Very high	94.3	Very high	104 Å²	104	106 Å²	106	53%	0.533	52%	0.523	S	S	.	.	H	α-helix	trans	-58.6	-41.3	175.6	-69.8	165.1	0	0	0	111	Q108 V109 L115 T116	Q108-I112 VanDerWaalsContact O-CG1 3.3Å; Q108-I112 WeakPolarHBondContact O-CG1 3.49Å; Q108-I112 PolarHBondContact O-N 2.73Å; V109-I112 PolarHBondContact O-N 3.43Å; I112-L115 PolarHBondContact O-N 2.81Å; I112-T116 WeakPolarHBondContact O-CB 3.43Å; I112-T116 PolarHBondContact O-N 3.12Å; I112-T116 PolarHBondContact O-OG1 3.44Å
113	R	94.9	Very high	94.5	Very high	168 Å²	168	103.4 Å²	103.4	63%	0.634	52%	0.518	S	S	*	.	H	α-helix	trans	-62.9	-46.8	178.1	-165.6	178.8	102.9	157.1	4.2	111.7	V109 H110 T111 T116 C117	V109-R113 PolarHBondContact O-N 2.71Å; H110-R113 WeakPolarHBondContact O-CB 3.36Å; H110-R113 PolarHBondContact O-N 2.91Å; T111-R113 VanDerWaalsContact C-N 3.28Å; T111-R113 PolarHBondContact O-N 3.17Å; R113-T116 PolarHBondContact O-N 3.3Å; R113-C117 PolarHBondContact O-N 2.7Å; R113-C117 PolarHBondContact O-SG 3.4Å
114	I	95.5	Very high	94.7	Very high	90 Å²	90	101.8 Å²	101.8	46%	0.462	52%	0.518	S	S	.	.	H	α-helix	trans	-59.9	-49.7	177.6	-67.1	165.9	0	0	0	110.2	H110 T111 T116 C117 Q118	H110-I114 WeakPolarHBondContact O-CG1 3.19Å; H110-I114 PolarHBondContact O-N 3.46Å; T111-I114 PolarHBondContact O-N 3.26Å; I114-T116 VanDerWaalsContact C-N 3.25Å; I114-T116 PolarHBondContact O-N 2.81Å; I114-C117 PolarHBondContact O-N 2.78Å; I114-Q118 HydrophobicContact CG2-CG 4.41Å; I114-Q118 WeakPolarHBondContact O-CG 3.47Å; I114-Q118 PolarHBondContact O-N 3.31Å
115	L	95.3	Very high	94.9	Very high	98 Å²	98	99 Å²	99	51%	0.513	52%	0.515	S	S	.	.	H	α-helix	trans	-60.9	-35.2	178.5	-69.2	174.1	0	0	0	112.2	T111 I112 K119	T111-L115 HydrophobicContact CG2-CD1 4.04Å; T111-L115 HydrophobicContact CG2-CG 4.43Å; T111-L115 WeakPolarHBondContact O-CG 3.23Å; T111-L115 PolarHBondContact O-N 3.23Å; I112-L115 PolarHBondContact O-N 2.81Å; L115-K119 VanDerWaalsContact O-CB 3.27Å; L115-K119 WeakPolarHBondContact O-CB 3.5Å; L115-K119 PolarHBondContact O-N 3.24Å
116	T	95	Very high	95	Very high	76 Å²	76	98.5 Å²	98.5	47%	0.466	51%	0.512	S	S	.	.	H	α-helix	trans	-67.5	-44.3	176.6	-57.1	0	0	0	0	111.5	I112 R113 I114 K119 T120	I112-T116 WeakPolarHBondContact O-CB 3.43Å; I112-T116 PolarHBondContact O-N 3.12Å; I112-T116 PolarHBondContact O-OG1 3.44Å; R113-T116 PolarHBondContact O-N 3.3Å; I114-T116 VanDerWaalsContact C-N 3.25Å; I114-T116 PolarHBondContact O-N 2.81Å; T116-K119 PolarHBondContact O-N 2.86Å; T116-T120 PolarHBondContact O-N 3.48Å; T116-T120 VanDerWaalsContact O-N 3.1Å; T116-T120 PolarHBondContact O-OG1 3.5Å
117	C	93.8	Very high	95.1	Very high	61 Å²	61	99.5 Å²	99.5	41%	0.412	51%	0.511	S	S	.	.	H	α-helix	trans	-60.9	-48.6	174.2	-68.6	0	0	0	0	111.3	R113 I114 K119 T120 E121	R113-C117 PolarHBondContact O-N 2.7Å; R113-C117 PolarHBondContact O-SG 3.4Å; I114-C117 PolarHBondContact O-N 2.78Å; C117-K119 VanDerWaalsContact C-N 3.32Å; C117-K119 PolarHBondContact O-N 2.82Å; C117-T120 PolarHBondContact O-N 3.33Å; C117-T120 VanDerWaalsContact O-N 3.1Å; C117-T120 PolarHBondContact O-OG1 3.31Å; C117-E121 WeakPolarHBondContact O-CG 3.41Å; C117-E121 PolarHBondContact O-N 2.73Å
118	Q	94.3	Very high	95.3	Very high	93 Å²	93	104.1 Å²	104.1	44%	0.435	52%	0.518	S	S	.	.	H	α-helix	trans	-59.9	-41.2	177.1	-72.2	177.7	-21.9	0	0	112	I114 T120 E121 L122	I114-Q118 HydrophobicContact CG2-CG 4.41Å; I114-Q118 WeakPolarHBondContact O-CG 3.47Å; I114-Q118 PolarHBondContact O-N 3.31Å; Q118-T120 VanDerWaalsContact C-N 3.33Å; Q118-T120 PolarHBondContact O-N 2.81Å; Q118-E121 PolarHBondContact O-N 3.04Å; Q118-L122 WeakPolarHBondContact O-CB 3.34Å; Q118-L122 WeakPolarHBondContact O-CG 3.12Å; Q118-L122 PolarHBondContact O-N 3.45Å
119	K	95.5	Very high	95.3	Very high	127 Å²	127	102.2 Å²	102.2	55%	0.552	52%	0.516	S	S	*	.	H	α-helix	trans	-58.5	-43.8	174.6	177.3	-177.4	174.6	-179.1	0	111.7	L115 T116 C117 Q123	L115-K119 VanDerWaalsContact O-CB 3.27Å; L115-K119 WeakPolarHBondContact O-CB 3.5Å; L115-K119 PolarHBondContact O-N 3.24Å; T116-K119 PolarHBondContact O-N 2.86Å; C117-K119 VanDerWaalsContact C-N 3.32Å; C117-K119 PolarHBondContact O-N 2.82Å; K119-Q123 WeakPolarHBondContact O-CB 3.44Å; K119-Q123 VanDerWaalsContact O-CG 3.3Å; K119-Q123 WeakPolarHBondContact O-CG 3.45Å; K119-Q123 PolarHBondContact O-N 3.44Å
120	T	94.4	Very high	95.3	Very high	75 Å²	75	102.7 Å²	102.7	46%	0.46	51%	0.513	S	S	.	.	H	α-helix	trans	-68	-38.8	179.2	50.9	0	0	0	0	112.6	T116 C117 Q118 Q123 M124	T116-T120 PolarHBondContact O-N 3.48Å; T116-T120 VanDerWaalsContact O-N 3.1Å; T116-T120 PolarHBondContact O-OG1 3.5Å; C117-T120 PolarHBondContact O-N 3.33Å; C117-T120 VanDerWaalsContact O-N 3.1Å; C117-T120 PolarHBondContact O-OG1 3.31Å; Q118-T120 VanDerWaalsContact C-N 3.33Å; Q118-T120 PolarHBondContact O-N 2.81Å; T120-Q123 PolarHBondContact O-N 2.87Å; T120-M124 WeakPolarHBondContact O-CB 3.41Å; T120-M124 PolarHBondContact O-N 3.47Å
121	E	94.9	Very high	95.3	Very high	119 Å²	119	102.3 Å²	102.3	56%	0.556	51%	0.511	S	S	*	.	H	α-helix	trans	-63.6	-45.2	175.4	-71.1	170.3	-170	0	0	111.3	C117 Q118 M124 A125	C117-E121 WeakPolarHBondContact O-CG 3.41Å; C117-E121 PolarHBondContact O-N 2.73Å; Q118-E121 PolarHBondContact O-N 3.04Å; E121-M124 PolarHBondContact O-N 3.14Å; E121-A125 WeakPolarHBondContact O-CB 3.11Å; E121-A125 PolarHBondContact O-N 2.96Å
122	L	96.7	Very high	95.4	Very high	124 Å²	124	100.9 Å²	100.9	65%	0.649	51%	0.507	S	S	*	.	H	α-helix	trans	-64.9	-39.9	176.3	-72	174.8	0	0	0	112.4	Q118 M124 A125 L126	Q118-L122 WeakPolarHBondContact O-CB 3.34Å; Q118-L122 WeakPolarHBondContact O-CG 3.12Å; Q118-L122 PolarHBondContact O-N 3.45Å; L122-M124 VanDerWaalsContact C-N 3.33Å; L122-M124 PolarHBondContact O-N 3.03Å; L122-A125 PolarHBondContact O-N 3.27Å; L122-L126 VanDerWaalsContact O-CB 3.22Å; L122-L126 WeakPolarHBondContact O-CB 3.46Å; L122-L126 PolarHBondContact O-N 2.91Å
123	Q	96.4	Very high	95.4	Very high	111 Å²	111	99.6 Å²	99.6	52%	0.519	50%	0.503	S	S	.	.	H	α-helix	trans	-62.4	-41.5	174.9	-80.1	-178.3	-20.8	0	0	111.9	K119 T120 L126 Y127	K119-Q123 WeakPolarHBondContact O-CB 3.44Å; K119-Q123 VanDerWaalsContact O-CG 3.3Å; K119-Q123 WeakPolarHBondContact O-CG 3.45Å; K119-Q123 PolarHBondContact O-N 3.44Å; T120-Q123 PolarHBondContact O-N 2.87Å; Q123-L126 PolarHBondContact O-N 2.8Å; Q123-Y127 WeakPolarHBondContact O-CB 3.2Å; Q123-Y127 PolarHBondContact O-N 3.23Å
124	M	95.4	Very high	95.4	Very high	107 Å²	107	98.4 Å²	98.4	53%	0.527	50%	0.503	S	S	.	.	H	α-helix	trans	-67.6	-44.3	176.9	-175.3	169.8	63.6	0	0	111.4	T120 E121 L122 L126 Y127 Y128	T120-M124 WeakPolarHBondContact O-CB 3.41Å; T120-M124 PolarHBondContact O-N 3.47Å; E121-M124 PolarHBondContact O-N 3.14Å; L122-M124 VanDerWaalsContact C-N 3.33Å; L122-M124 PolarHBondContact O-N 3.03Å; M124-L126 VanDerWaalsContact C-N 3.32Å; M124-L126 PolarHBondContact O-N 3.21Å; M124-Y127 WeakPolarHBondContact O-CB 3.07Å; M124-Y127 PolarHBondContact O-N 3.35Å; M124-Y128 HydrophobicContact CG-CD2 3.79Å; M124-Y128 HydrophobicContact CG-CE2 3.43Å; M124-Y128 VanDerWaalsContact CG-CE2 3.43Å; M124-Y128 WeakPolarHBondContact O-CD2 3.12Å; M124-Y128 PolarHBondContact O-N 2.88Å; M124-Y128 HydrophobicContact SD-CE2 4.09Å
125	A	96	Very high	95.4	Very high	56 Å²	56	99.2 Å²	99.2	46%	0.463	51%	0.505	S	S	.	.	H	α-helix	trans	-59.4	-42.9	174.6	0	0	0	0	0	111.7	E121 L122 Y128 S129	E121-A125 WeakPolarHBondContact O-CB 3.11Å; E121-A125 PolarHBondContact O-N 2.96Å; L122-A125 PolarHBondContact O-N 3.27Å; A125-Y128 PolarHBondContact O-N 2.94Å; A125-S129 WeakPolarHBondContact O-CB 3.36Å; A125-S129 PolarHBondContact O-N 3.43Å; A125-S129 PolarHBondContact O-OG 2.95Å
126	L	95.3	Very high	95.4	Very high	97 Å²	97	99.8 Å²	99.8	51%	0.508	51%	0.508	S	S	.	.	H	α-helix	trans	-64.7	-38.5	176.5	-177.8	132.7	0	0	0	112.2	L122 Q123 M124 S129 Q130	L122-L126 VanDerWaalsContact O-CB 3.22Å; L122-L126 WeakPolarHBondContact O-CB 3.46Å; L122-L126 PolarHBondContact O-N 2.91Å; Q123-L126 PolarHBondContact O-N 2.8Å; M124-L126 VanDerWaalsContact C-N 3.32Å; M124-L126 PolarHBondContact O-N 3.21Å; L126-S129 WeakPolarHBondContact CA-OG 3.15Å; L126-S129 PolarHBondContact O-OG 3.47Å; L126-Q130 VanDerWaalsContact CD2-NE2 3.3Å; L126-Q130 WeakPolarHBondContact O-CB 3.33Å; L126-Q130 WeakPolarHBondContact O-CG 3.36Å; L126-Q130 PolarHBondContact O-N 3.45Å
127	Y	96.7	Very high	95.4	Very high	144 Å²	144	100.5 Å²	100.5	57%	0.565	51%	0.506	S	S	*	.	H	α-helix	trans	-62.2	-48.7	173.8	173.5	-97	0	0	0	111.7	Q123 M124 Q130 H131	Q123-Y127 WeakPolarHBondContact O-CB 3.2Å; Q123-Y127 PolarHBondContact O-N 3.23Å; M124-Y127 WeakPolarHBondContact O-CB 3.07Å; M124-Y127 PolarHBondContact O-N 3.35Å; Y127-Q130 PolarHBondContact O-N 2.83Å; Y127-H131 PolarHBondContact O-N 2.86Å
128	Y	96.9	Very high	95.4	Very high	152 Å²	152	99.4 Å²	99.4	60%	0.596	50%	0.504	S	S	*	.	H	α-helix	trans	-64.8	-40.9	178.2	-75.1	-62.3	0	0	0	112.4	M124 A125 Q130 H131 A132	M124-Y128 HydrophobicContact CG-CD2 3.79Å; M124-Y128 HydrophobicContact CG-CE2 3.43Å; M124-Y128 VanDerWaalsContact CG-CE2 3.43Å; M124-Y128 WeakPolarHBondContact O-CD2 3.12Å; M124-Y128 PolarHBondContact O-N 2.88Å; M124-Y128 HydrophobicContact SD-CE2 4.09Å; A125-Y128 PolarHBondContact O-N 2.94Å; Y128-Q130 PolarHBondContact O-N 3.5Å; Y128-H131 PolarHBondContact O-N 3.21Å; Y128-A132 WeakPolarHBondContact O-CB 3.33Å; Y128-A132 PolarHBondContact O-N 2.78Å
129	S	94.9	Very high	95.4	Very high	64 Å²	64	99.8 Å²	99.8	45%	0.448	51%	0.506	S	S	.	.	H	α-helix	trans	-64.6	-40.8	176.7	68.9	0	0	0	0	111.4	A125 L126 H131 A132 V133	A125-S129 WeakPolarHBondContact O-CB 3.36Å; A125-S129 PolarHBondContact O-N 3.43Å; A125-S129 PolarHBondContact O-OG 2.95Å; L126-S129 WeakPolarHBondContact CA-OG 3.15Å; L126-S129 PolarHBondContact O-OG 3.47Å; S129-H131 VanDerWaalsContact C-N 3.34Å; S129-H131 PolarHBondContact O-N 3.37Å; S129-A132 PolarHBondContact O-N 2.78Å; S129-V133 VanDerWaalsContact O-CG2 3.27Å; S129-V133 WeakPolarHBondContact O-CG2 3.42Å; S129-V133 PolarHBondContact O-N 3.23Å
130	Q	95.4	Very high	95.4	Very high	100 Å²	100	96 Å²	96	47%	0.467	50%	0.499	S	S	.	.	H	α-helix	trans	-62.9	-39.6	174.6	-77.4	177.5	1.5	0	0	112.4	L126 Y127 Y128 K134	L126-Q130 VanDerWaalsContact CD2-NE2 3.3Å; L126-Q130 WeakPolarHBondContact O-CB 3.33Å; L126-Q130 WeakPolarHBondContact O-CG 3.36Å; L126-Q130 PolarHBondContact O-N 3.45Å; Y127-Q130 PolarHBondContact O-N 2.83Å; Y128-Q130 PolarHBondContact O-N 3.5Å; Q130-K134 WeakPolarHBondContact O-CG 3.42Å; Q130-K134 PolarHBondContact O-N 2.87Å; Q130-K134 VanDerWaalsContact O-N 3.11Å
131	H	95.1	Very high	95.5	Very high	106 Å²	106	100.1 Å²	100.1	49%	0.491	51%	0.506	S	S	.	.	H	α-helix	trans	-66.8	-43.3	176.2	-168.2	-79.7	0	0	0	111.7	Y127 Y128 S129 V133 K134 Q135	Y127-H131 PolarHBondContact O-N 2.86Å; Y128-H131 PolarHBondContact O-N 3.21Å; S129-H131 VanDerWaalsContact C-N 3.34Å; S129-H131 PolarHBondContact O-N 3.37Å; H131-V133 VanDerWaalsContact C-N 3.35Å; H131-V133 PolarHBondContact O-N 3Å; H131-K134 PolarHBondContact O-N 2.94Å; H131-Q135 PolarHBondContact O-N 3.46Å
132	A	95.7	Very high	95.5	Very high	47 Å²	47	98.1 Å²	98.1	39%	0.388	50%	0.499	S	S	.	.	H	α-helix	trans	-60.9	-42.4	176	0	0	0	0	0	112	Y128 S129 K134 Q135 L136	Y128-A132 WeakPolarHBondContact O-CB 3.33Å; Y128-A132 PolarHBondContact O-N 2.78Å; S129-A132 PolarHBondContact O-N 2.78Å; A132-K134 PolarHBondContact O-N 3.34Å; A132-Q135 PolarHBondContact O-N 2.74Å; A132-L136 WeakPolarHBondContact O-CG 3.48Å; A132-L136 PolarHBondContact O-N 3.29Å
133	V	94.8	Very high	95.5	Very high	76 Å²	76	97.1 Å²	97.1	46%	0.461	49%	0.494	S	S	.	.	H	α-helix	trans	-60.7	-45	175.1	170.3	0	0	0	0	111.2	S129 H131 Q135 L136 E137	S129-V133 VanDerWaalsContact O-CG2 3.27Å; S129-V133 WeakPolarHBondContact O-CG2 3.42Å; S129-V133 PolarHBondContact O-N 3.23Å; H131-V133 VanDerWaalsContact C-N 3.35Å; H131-V133 PolarHBondContact O-N 3Å; V133-Q135 VanDerWaalsContact C-N 3.3Å; V133-Q135 PolarHBondContact O-N 3.5Å; V133-L136 PolarHBondContact O-N 3.06Å; V133-E137 HydrophobicContact CG1-CG 4.42Å; V133-E137 WeakPolarHBondContact O-CG 3.49Å; V133-E137 PolarHBondContact O-N 2.86Å
134	K	95.3	Very high	95.5	Very high	143 Å²	143	97.2 Å²	97.2	62%	0.622	50%	0.497	S	S	*	.	H	α-helix	trans	-61.8	-36.9	177.1	-74.4	175.7	-178.6	176.9	0	113.1	Q130 H131 A132 G138	Q130-K134 WeakPolarHBondContact O-CG 3.42Å; Q130-K134 PolarHBondContact O-N 2.87Å; Q130-K134 VanDerWaalsContact O-N 3.11Å; H131-K134 PolarHBondContact O-N 2.94Å; A132-K134 PolarHBondContact O-N 3.34Å; K134-G138 PolarHBondContact O-N 2.83Å; K134-G138 VanDerWaalsContact O-N 3.09Å
135	Q	95.5	Very high	95.5	Very high	108 Å²	108	95 Å²	95	51%	0.505	49%	0.492	S	S	.	.	H	α-helix	trans	-66	-48.4	175.8	-178	177.2	-7	0	0	111	H131 A132 V133 E137 G138 E139	H131-Q135 PolarHBondContact O-N 3.46Å; A132-Q135 PolarHBondContact O-N 2.74Å; V133-Q135 VanDerWaalsContact C-N 3.3Å; V133-Q135 PolarHBondContact O-N 3.5Å; Q135-E137 VanDerWaalsContact C-N 3.28Å; Q135-E137 PolarHBondContact O-N 3.28Å; Q135-G138 WeakPolarHBondContact O-CA 3.24Å; Q135-G138 PolarHBondContact O-N 3.44Å; Q135-E139 WeakPolarHBondContact CG-OE1 3.31Å; Q135-E139 PolarHBondContact NE2-OE1 3.16Å; Q135-E139 PolarHBondContact O-N 2.97Å
136	L	95.5	Very high	95.6	Very high	109 Å²	109	100.1 Å²	100.1	57%	0.571	50%	0.499	S	S	*	.	H	α-helix	trans	-60.8	-37	176.2	-70.2	173.1	0	0	0	112.2	A132 V133 G138 E139 A140	A132-L136 WeakPolarHBondContact O-CG 3.48Å; A132-L136 PolarHBondContact O-N 3.29Å; V133-L136 PolarHBondContact O-N 3.06Å; L136-G138 VanDerWaalsContact C-N 3.31Å; L136-G138 PolarHBondContact O-N 3.32Å; L136-E139 PolarHBondContact O-N 3.39Å; L136-A140 VanDerWaalsContact O-CB 3.25Å; L136-A140 WeakPolarHBondContact O-CB 3.34Å; L136-A140 PolarHBondContact O-N 3.04Å
137	E	94.6	Very high	95.7	Very high	92 Å²	92	100.5 Å²	100.5	43%	0.43	50%	0.501	S	S	.	.	H	α-helix	trans	-62.4	-38	172.2	-76.3	179	-167.5	0	0	112.3	V133 Q135 R141	V133-E137 HydrophobicContact CG1-CG 4.42Å; V133-E137 WeakPolarHBondContact O-CG 3.49Å; V133-E137 PolarHBondContact O-N 2.86Å; Q135-E137 VanDerWaalsContact C-N 3.28Å; Q135-E137 PolarHBondContact O-N 3.28Å; E137-R141 VanDerWaalsContact O-CG 3.25Å; E137-R141 WeakPolarHBondContact O-CG 3.49Å; E137-R141 PolarHBondContact O-N 2.91Å; E137-R141 VanDerWaalsContact O-N 3.12Å; E137-R141 IonicContact OE2-NH2 2.69Å; E137-R141 PolarHBondContact OE2-NH2 3.3Å
138	G	93.7	Very high	95.7	Very high	37 Å²	37	98 Å²	98	38%	0.381	49%	0.494	S	S	.	.	H	α-helix	trans	-65.6	-48.5	175.1	0	0	0	0	0	112.2	K134 Q135 L136 A140 R141 D142	K134-G138 PolarHBondContact O-N 2.83Å; K134-G138 VanDerWaalsContact O-N 3.09Å; Q135-G138 WeakPolarHBondContact O-CA 3.24Å; Q135-G138 PolarHBondContact O-N 3.44Å; L136-G138 VanDerWaalsContact C-N 3.31Å; L136-G138 PolarHBondContact O-N 3.32Å; G138-A140 PolarHBondContact O-N 3.47Å; G138-R141 PolarHBondContact O-N 2.82Å; G138-D142 PolarHBondContact O-N 2.99Å
139	E	95.3	Very high	95.7	Very high	101 Å²	101	95.2 Å²	95.2	47%	0.472	49%	0.49	S	S	.	.	H	α-helix	trans	-62.1	-41.3	177.6	-69.2	170.7	-166	0	0	111.7	Q135 L136 R141 D142 L143	Q135-E139 WeakPolarHBondContact CG-OE1 3.31Å; Q135-E139 PolarHBondContact NE2-OE1 3.16Å; Q135-E139 PolarHBondContact O-N 2.97Å; L136-E139 PolarHBondContact O-N 3.39Å; E139-R141 PolarHBondContact O-N 2.97Å; E139-D142 PolarHBondContact O-N 3.35Å; E139-L143 WeakPolarHBondContact O-CB 3.38Å; E139-L143 PolarHBondContact O-N 2.82Å
140	A	95.2	Very high	95.7	Very high	48 Å²	48	95.3 Å²	95.3	40%	0.397	49%	0.49	S	S	.	.	H	α-helix	trans	-63.7	-39.3	175.7	0	0	0	0	0	112.4	L136 G138 L143 I144	L136-A140 VanDerWaalsContact O-CB 3.25Å; L136-A140 WeakPolarHBondContact O-CB 3.34Å; L136-A140 PolarHBondContact O-N 3.04Å; G138-A140 PolarHBondContact O-N 3.47Å; A140-L143 PolarHBondContact O-N 3.47Å; A140-I144 WeakPolarHBondContact O-CB 3.45Å; A140-I144 WeakPolarHBondContact O-CD1 3.19Å; A140-I144 WeakPolarHBondContact O-CG1 3.2Å; A140-I144 PolarHBondContact O-N 3.27Å
141	R	95.6	Very high	95.7	Very high	161 Å²	161	99.6 Å²	99.6	61%	0.608	50%	0.502	S	S	*	.	H	α-helix	trans	-66	-40.8	175.4	-73.7	174.4	-159	166.5	11.7	111.9	E137 G138 E139 I144 S145	E137-R141 VanDerWaalsContact O-CG 3.25Å; E137-R141 WeakPolarHBondContact O-CG 3.49Å; E137-R141 PolarHBondContact O-N 2.91Å; E137-R141 VanDerWaalsContact O-N 3.12Å; E137-R141 IonicContact OE2-NH2 2.69Å; E137-R141 PolarHBondContact OE2-NH2 3.3Å; G138-R141 PolarHBondContact O-N 2.82Å; E139-R141 PolarHBondContact O-N 2.97Å; R141-I144 PolarHBondContact O-N 3.43Å; R141-S145 PolarHBondContact O-N 3.14Å; R141-S145 PolarHBondContact O-OG 2.81Å
142	D	95	Very high	95.7	Very high	77 Å²	77	99.1 Å²	99.1	41%	0.412	50%	0.499	S	S	.	.	H	α-helix	trans	-62.9	-45.7	175.7	-168.8	56.3	0	0	0	110.7	G138 E139 I144 S145 R146	G138-D142 PolarHBondContact O-N 2.99Å; E139-D142 PolarHBondContact O-N 3.35Å; D142-I144 PolarHBondContact O-N 2.82Å; D142-S145 WeakPolarHBondContact O-CB 3.49Å; D142-S145 PolarHBondContact O-N 3.17Å; D142-S145 VanDerWaalsContact O-N 3.11Å; D142-R146 WeakPolarHBondContact O-CG 3.26Å; D142-R146 PolarHBondContact O-N 3.31Å; D142-R146 IonicContact OD2-CZ 3.55Å; D142-R146 IonicContact OD2-NE 4Å; D142-R146 PolarHBondContact OD2-NE 3.27Å; D142-R146 IonicContact OD2-NH2 2.72Å; D142-R146 PolarHBondContact OD2-NH2 3.28Å
143	L	97.3	Very high	95.8	Very high	104 Å²	104	103.3 Å²	103.3	55%	0.545	51%	0.509	S	S	.	.	H	α-helix	trans	-60.3	-43.6	176.6	-172.5	68.2	0	0	0	112.4	E139 A140 S145 R146 L147	E139-L143 WeakPolarHBondContact O-CB 3.38Å; E139-L143 PolarHBondContact O-N 2.82Å; A140-L143 PolarHBondContact O-N 3.47Å; L143-S145 VanDerWaalsContact C-N 3.27Å; L143-S145 PolarHBondContact O-N 2.84Å; L143-R146 PolarHBondContact O-N 3.47Å; L143-L147 HydrophobicContact CG-CD1 4.27Å; L143-L147 WeakPolarHBondContact O-CB 3.46Å; L143-L147 WeakPolarHBondContact O-CG 3.12Å; L143-L147 PolarHBondContact O-N 2.81Å
144	I	96.8	Very high	95.8	Very high	112 Å²	112	101.6 Å²	101.6	57%	0.574	50%	0.502	S	S	*	.	H	α-helix	trans	-61.1	-39.7	175.6	-71.2	163.9	0	0	0	110.9	A140 R141 D142 L147 H148	A140-I144 WeakPolarHBondContact O-CB 3.45Å; A140-I144 WeakPolarHBondContact O-CD1 3.19Å; A140-I144 WeakPolarHBondContact O-CG1 3.2Å; A140-I144 PolarHBondContact O-N 3.27Å; R141-I144 PolarHBondContact O-N 3.43Å; D142-I144 PolarHBondContact O-N 2.82Å; I144-L147 PolarHBondContact O-N 2.87Å; I144-H148 WeakPolarHBondContact O-CB 3.28Å; I144-H148 PolarHBondContact O-N 2.91Å
145	S	95.1	Very high	95.7	Very high	62 Å²	62	96.4 Å²	96.4	43%	0.434	49%	0.49	S	S	.	.	H	α-helix	trans	-65.6	-46.1	178.9	-54.6	0	0	0	0	110.7	R141 D142 L143 L147 H148 D149	R141-S145 PolarHBondContact O-N 3.14Å; R141-S145 PolarHBondContact O-OG 2.81Å; D142-S145 WeakPolarHBondContact O-CB 3.49Å; D142-S145 PolarHBondContact O-N 3.17Å; D142-S145 VanDerWaalsContact O-N 3.11Å; L143-S145 VanDerWaalsContact C-N 3.27Å; L143-S145 PolarHBondContact O-N 2.84Å; S145-L147 PolarHBondContact O-N 3.46Å; S145-H148 WeakPolarHBondContact O-CB 3.23Å; S145-H148 PolarHBondContact O-N 3.37Å; S145-D149 PolarHBondContact O-N 3.13Å
146	R	97.4	Very high	95.7	Very high	163 Å²	163	97 Å²	97	62%	0.615	49%	0.493	S	S	*	.	H	α-helix	trans	-61.3	-42.8	174.8	-66.5	179.2	-168.5	-157.1	4.5	112.7	D142 L143 H148 D149 S150	D142-R146 WeakPolarHBondContact O-CG 3.26Å; D142-R146 PolarHBondContact O-N 3.31Å; D142-R146 IonicContact OD2-CZ 3.55Å; D142-R146 IonicContact OD2-NE 4Å; D142-R146 PolarHBondContact OD2-NE 3.27Å; D142-R146 IonicContact OD2-NH2 2.72Å; D142-R146 PolarHBondContact OD2-NH2 3.28Å; L143-R146 PolarHBondContact O-N 3.47Å; R146-H148 VanDerWaalsContact C-N 3.32Å; R146-H148 PolarHBondContact O-N 2.85Å; R146-D149 PolarHBondContact O-N 3.4Å; R146-S150 WeakPolarHBondContact O-CB 3.43Å; R146-S150 PolarHBondContact O-N 2.64Å
147	L	97	Very high	95.8	Very high	104 Å²	104	96.1 Å²	96.1	55%	0.545	49%	0.488	S	S	.	.	H	α-helix	trans	-62.4	-41.6	175.7	-76.9	171.5	0	0	0	111.2	L143 I144 S145 D149 S150 W151	L143-L147 HydrophobicContact CG-CD1 4.27Å; L143-L147 WeakPolarHBondContact O-CB 3.46Å; L143-L147 WeakPolarHBondContact O-CG 3.12Å; L143-L147 PolarHBondContact O-N 2.81Å; I144-L147 PolarHBondContact O-N 2.87Å; S145-L147 PolarHBondContact O-N 3.46Å; L147-D149 PolarHBondContact O-N 3.43Å; L147-S150 WeakPolarHBondContact CA-OG 3.33Å; L147-S150 PolarHBondContact O-N 3.47Å; L147-S150 PolarHBondContact O-OG 2.9Å; L147-W151 WeakPolarHBondContact O-CB 3.46Å; L147-W151 PolarHBondContact O-N 3.18Å
148	H	97.3	Very high	95.8	Very high	91 Å²	91	98.1 Å²	98.1	42%	0.421	50%	0.497	S	S	.	.	H	α-helix	trans	-63.7	-40.1	177.1	-172.9	64.3	0	0	0	112.4	I144 S145 R146 W151 K152	I144-H148 WeakPolarHBondContact O-CB 3.28Å; I144-H148 PolarHBondContact O-N 2.91Å; S145-H148 WeakPolarHBondContact O-CB 3.23Å; S145-H148 PolarHBondContact O-N 3.37Å; R146-H148 VanDerWaalsContact C-N 3.32Å; R146-H148 PolarHBondContact O-N 2.85Å; H148-W151 PolarHBondContact O-N 2.86Å; H148-K152 VanDerWaalsContact CD2-CE 3.49Å; H148-K152 WeakPolarHBondContact CD2-CE 3.49Å; H148-K152 PolarHBondContact CD2-NZ 3.38Å; H148-K152 WeakPolarHBondContact NE2-CE 3.43Å; H148-K152 PolarHBondContact NE2-NZ 3.41Å; H148-K152 VanDerWaalsContact NE2-NZ 3.1Å; H148-K152 WeakPolarHBondContact O-CG 3.34Å; H148-K152 PolarHBondContact O-N 3.47Å
149	D	96.7	Very high	95.9	Very high	95 Å²	95	103.3 Å²	103.3	51%	0.508	51%	0.511	S	S	.	.	H	α-helix	trans	-68.8	-39.2	175.4	-67.7	-23.1	0	0	0	111.9	S145 R146 L147 W151 K152 F153	S145-D149 PolarHBondContact O-N 3.13Å; R146-D149 PolarHBondContact O-N 3.4Å; L147-D149 PolarHBondContact O-N 3.43Å; D149-W151 VanDerWaalsContact C-N 3.3Å; D149-W151 PolarHBondContact O-N 3.35Å; D149-K152 PolarHBondContact O-N 2.96Å; D149-K152 IonicContact OD1-NZ 3.01Å; D149-F153 WeakPolarHBondContact O-CB 3.48Å; D149-F153 PolarHBondContact O-N 3.02Å
150	S	95.3	Very high	96	Very high	65 Å²	65	100.9 Å²	100.9	46%	0.455	51%	0.509	S	S	.	.	H	α-helix	trans	-61.9	-38.1	173.6	77	0	0	0	0	112.3	R146 L147 F153 A154	R146-S150 WeakPolarHBondContact O-CB 3.43Å; R146-S150 PolarHBondContact O-N 2.64Å; L147-S150 WeakPolarHBondContact CA-OG 3.33Å; L147-S150 PolarHBondContact O-N 3.47Å; L147-S150 PolarHBondContact O-OG 2.9Å; S150-F153 PolarHBondContact O-N 3.14Å; S150-A154 WeakPolarHBondContact O-CB 3.3Å; S150-A154 PolarHBondContact O-N 2.9Å
151	W	94.9	Very high	96.1	Very high	190 Å²	190	103.8 Å²	103.8	72%	0.72	52%	0.517	S	S	*	.	H	α-helix	trans	-69.2	-39.1	177.9	-173.3	72.5	0	0	0	112	L147 H148 D149 A154 G155	L147-W151 WeakPolarHBondContact O-CB 3.46Å; L147-W151 PolarHBondContact O-N 3.18Å; H148-W151 PolarHBondContact O-N 2.86Å; D149-W151 VanDerWaalsContact C-N 3.3Å; D149-W151 PolarHBondContact O-N 3.35Å; W151-A154 PolarHBondContact O-N 3.2Å; W151-G155 PolarHBondContact O-N 3.18Å
152	K	96.1	Very high	96	Very high	96 Å²	96	99.8 Å²	99.8	42%	0.417	51%	0.514	S	S	.	.	H	α-helix	trans	-61.9	-47.6	171.3	-74.7	172.2	-179.9	159.2	0	111.8	H148 D149 A154 G155 E156	H148-K152 VanDerWaalsContact CD2-CE 3.49Å; H148-K152 WeakPolarHBondContact CD2-CE 3.49Å; H148-K152 PolarHBondContact CD2-NZ 3.38Å; H148-K152 WeakPolarHBondContact NE2-CE 3.43Å; H148-K152 PolarHBondContact NE2-NZ 3.41Å; H148-K152 VanDerWaalsContact NE2-NZ 3.1Å; H148-K152 WeakPolarHBondContact O-CG 3.34Å; H148-K152 PolarHBondContact O-N 3.47Å; D149-K152 PolarHBondContact O-N 2.96Å; D149-K152 IonicContact OD1-NZ 3.01Å; K152-A154 VanDerWaalsContact C-N 3.32Å; K152-A154 PolarHBondContact O-N 3.02Å; K152-G155 PolarHBondContact O-N 3.46Å; K152-G155 VanDerWaalsContact O-N 3.11Å; K152-E156 PolarHBondContact O-N 2.99Å
153	F	97.2	Very high	96.1	Very high	135 Å²	135	98.7 Å²	98.7	59%	0.592	52%	0.516	S	S	*	.	H	α-helix	trans	-60.9	-41.6	178.7	-179.4	-104.3	0	0	0	111.9	D149 S150 G155 E156 L157	D149-F153 WeakPolarHBondContact O-CB 3.48Å; D149-F153 PolarHBondContact O-N 3.02Å; S150-F153 PolarHBondContact O-N 3.14Å; F153-G155 VanDerWaalsContact C-N 3.33Å; F153-G155 PolarHBondContact O-N 2.85Å; F153-E156 PolarHBondContact O-N 3.39Å; F153-L157 WeakPolarHBondContact O-CB 3.4Å; F153-L157 PolarHBondContact O-N 3.37Å
154	A	95	Very high	96	Very high	40 Å²	40	98 Å²	98	33%	0.331	52%	0.515	S	S	.	.	H	α-helix	trans	-59.3	-43.3	173.1	0	0	0	0	0	111.8	S150 W151 K152 E156 L157 E158	S150-A154 WeakPolarHBondContact O-CB 3.3Å; S150-A154 PolarHBondContact O-N 2.9Å; W151-A154 PolarHBondContact O-N 3.2Å; K152-A154 VanDerWaalsContact C-N 3.32Å; K152-A154 PolarHBondContact O-N 3.02Å; A154-E156 PolarHBondContact O-N 2.8Å; A154-L157 WeakPolarHBondContact O-CB 3.46Å; A154-L157 PolarHBondContact O-N 2.92Å; A154-E158 WeakPolarHBondContact O-CG 3.27Å; A154-E158 PolarHBondContact O-N 2.83Å
155	G	93.4	Very high	95.9	Very high	34 Å²	34	94.9 Å²	94.9	35%	0.351	51%	0.507	S	S	.	.	H	α-helix	trans	-63.2	-39.1	174.9	0	0	0	0	0	113.8	W151 K152 F153 E158 Q159	W151-G155 PolarHBondContact O-N 3.18Å; K152-G155 PolarHBondContact O-N 3.46Å; K152-G155 VanDerWaalsContact O-N 3.11Å; F153-G155 VanDerWaalsContact C-N 3.33Å; F153-G155 PolarHBondContact O-N 2.85Å; G155-E158 PolarHBondContact O-N 3.49Å; G155-Q159 PolarHBondContact O-N 2.84Å
156	E	96	Very high	95.8	Very high	122 Å²	122	95.8 Å²	95.8	57%	0.57	51%	0.509	S	S	*	.	H	α-helix	trans	-64.3	-40.6	173.6	-70.7	175.8	-175.8	0	0	111.6	K152 F153 A154 Q159 A160	K152-E156 PolarHBondContact O-N 2.99Å; F153-E156 PolarHBondContact O-N 3.39Å; A154-E156 PolarHBondContact O-N 2.8Å; E156-Q159 PolarHBondContact O-N 3.01Å; E156-A160 PolarHBondContact O-N 3.47Å
157	L	96.5	Very high	95.6	Very high	90 Å²	90	94.4 Å²	94.4	47%	0.471	51%	0.51	S	S	.	.	H	α-helix	trans	-64.4	-44	176.3	-174.7	64.3	0	0	0	111.7	F153 A154 Q159 A160 L161	F153-L157 WeakPolarHBondContact O-CB 3.4Å; F153-L157 PolarHBondContact O-N 3.37Å; A154-L157 WeakPolarHBondContact O-CB 3.46Å; A154-L157 PolarHBondContact O-N 2.92Å; L157-Q159 VanDerWaalsContact C-N 3.29Å; L157-Q159 PolarHBondContact O-N 2.97Å; L157-A160 PolarHBondContact O-N 3.27Å; L157-L161 HydrophobicContact CG-CD1 4.39Å; L157-L161 WeakPolarHBondContact O-CG 3.28Å; L157-L161 PolarHBondContact O-N 2.88Å
158	E	95.3	Very high	95.6	Very high	133 Å²	133	96 Å²	96	62%	0.621	51%	0.513	S	S	*	.	H	α-helix	trans	-59.8	-39.3	174.5	-74.8	177.4	-176.1	0	0	112	A154 G155 S162	A154-E158 WeakPolarHBondContact O-CG 3.27Å; A154-E158 PolarHBondContact O-N 2.83Å; G155-E158 PolarHBondContact O-N 3.49Å; E158-S162 WeakPolarHBondContact O-CB 3.16Å; E158-S162 PolarHBondContact O-N 3.35Å; E158-S162 PolarHBondContact O-OG 3.33Å
159	Q	95.5	Very high	95.5	Very high	146 Å²	146	98.7 Å²	98.7	68%	0.682	52%	0.523	S	S	*	.	H	α-helix	trans	-66.9	-41.7	175.8	-169.7	176.5	12.3	0	0	111.8	G155 E156 L157 S162 A163	G155-Q159 PolarHBondContact O-N 2.84Å; E156-Q159 PolarHBondContact O-N 3.01Å; L157-Q159 VanDerWaalsContact C-N 3.29Å; L157-Q159 PolarHBondContact O-N 2.97Å; Q159-S162 PolarHBondContact O-N 3.01Å; Q159-A163 PolarHBondContact O-N 2.99Å
160	A	97.2	Very high	95.4	Very high	51 Å²	51	100.3 Å²	100.3	42%	0.421	53%	0.525	S	S	.	.	H	α-helix	trans	-63.8	-45.5	175.9	0	0	0	0	0	111.9	E156 L157 S162 A163 V164	E156-A160 PolarHBondContact O-N 3.47Å; L157-A160 PolarHBondContact O-N 3.27Å; A160-S162 VanDerWaalsContact C-N 3.32Å; A160-S162 PolarHBondContact O-N 3.42Å; A160-A163 WeakPolarHBondContact O-CB 3.4Å; A160-A163 PolarHBondContact O-N 2.93Å; A160-A163 VanDerWaalsContact O-N 3.14Å; A160-V164 WeakPolarHBondContact O-CG2 3.3Å; A160-V164 PolarHBondContact O-N 3.23Å
161	L	97	Very high	95.3	Very high	109 Å²	109	99.4 Å²	99.4	57%	0.571	52%	0.522	S	S	*	.	H	α-helix	trans	-61.4	-40.7	175.7	-72.4	174.4	0	0	0	111.8	L157 A163 V164 A165	L157-L161 HydrophobicContact CG-CD1 4.39Å; L157-L161 WeakPolarHBondContact O-CG 3.28Å; L157-L161 PolarHBondContact O-N 2.88Å; L161-A163 VanDerWaalsContact C-N 3.34Å; L161-A163 PolarHBondContact O-N 3.28Å; L161-V164 PolarHBondContact O-N 2.79Å; L161-A165 WeakPolarHBondContact O-CB 3.38Å; L161-A165 PolarHBondContact O-N 3.48Å
162	S	94.5	Very high	95.3	Very high	77 Å²	77	94 Å²	94	54%	0.538	51%	0.507	S	S	.	.	H	α-helix	trans	-61.2	-42.8	173.9	-63.5	0	0	0	0	111.6	E158 Q159 A160 A165 T166	E158-S162 WeakPolarHBondContact O-CB 3.16Å; E158-S162 PolarHBondContact O-N 3.35Å; E158-S162 PolarHBondContact O-OG 3.33Å; Q159-S162 PolarHBondContact O-N 3.01Å; A160-S162 VanDerWaalsContact C-N 3.32Å; A160-S162 PolarHBondContact O-N 3.42Å; S162-A165 PolarHBondContact O-N 3.03Å; S162-T166 WeakPolarHBondContact O-CG2 3.2Å; S162-T166 PolarHBondContact O-N 2.97Å
163	A	96	Very high	95.3	Very high	54 Å²	54	96.4 Å²	96.4	45%	0.446	51%	0.514	S	S	.	.	H	α-helix	trans	-62.6	-46.5	176	0	0	0	0	0	111.8	Q159 A160 L161 A165 T166 Q167	Q159-A163 PolarHBondContact O-N 2.99Å; A160-A163 WeakPolarHBondContact O-CB 3.4Å; A160-A163 PolarHBondContact O-N 2.93Å; A160-A163 VanDerWaalsContact O-N 3.14Å; L161-A163 VanDerWaalsContact C-N 3.34Å; L161-A163 PolarHBondContact O-N 3.28Å; A163-A165 VanDerWaalsContact C-N 3.34Å; A163-A165 PolarHBondContact O-N 3.29Å; A163-T166 PolarHBondContact O-N 2.97Å; A163-T166 VanDerWaalsContact O-N 3.14Å; A163-T166 PolarHBondContact O-OG1 3.39Å; A163-Q167 PolarHBondContact O-N 3.37Å
164	V	96.3	Very high	95.2	Very high	88 Å²	88	94.3 Å²	94.3	53%	0.533	50%	0.502	S	S	.	.	H	α-helix	trans	-59.7	-43.4	175.6	172.3	0	0	0	0	111.1	A160 L161 T166 Q167 K168	A160-V164 WeakPolarHBondContact O-CG2 3.3Å; A160-V164 PolarHBondContact O-N 3.23Å; L161-V164 PolarHBondContact O-N 2.79Å; V164-T166 VanDerWaalsContact C-N 3.31Å; V164-T166 PolarHBondContact O-N 3.36Å; V164-Q167 WeakPolarHBondContact O-CB 3.49Å; V164-Q167 PolarHBondContact O-N 3.38Å; V164-Q167 VanDerWaalsContact O-N 3.08Å; V164-K168 PolarHBondContact O-N 3.48Å
165	A	93.9	Very high	95.2	Very high	48 Å²	48	96.5 Å²	96.5	40%	0.397	51%	0.508	S	S	.	.	H	α-helix	trans	-61.1	-37.7	176.1	0	0	0	0	0	112.4	L161 S162 A163 K169	L161-A165 WeakPolarHBondContact O-CB 3.38Å; L161-A165 PolarHBondContact O-N 3.48Å; S162-A165 PolarHBondContact O-N 3.03Å; A163-A165 VanDerWaalsContact C-N 3.34Å; A163-A165 PolarHBondContact O-N 3.29Å; A165-K169 WeakPolarHBondContact O-CG 3.49Å; A165-K169 PolarHBondContact O-N 2.85Å; A165-K169 VanDerWaalsContact O-N 3.15Å
166	T	94.1	Very high	95.3	Very high	80 Å²	80	100 Å²	100	49%	0.491	52%	0.515	S	S	.	.	H	α-helix	trans	-69.1	-34.6	173.3	67.8	0	0	0	0	113	S162 A163 V164 K170	S162-T166 WeakPolarHBondContact O-CG2 3.2Å; S162-T166 PolarHBondContact O-N 2.97Å; A163-T166 PolarHBondContact O-N 2.97Å; A163-T166 VanDerWaalsContact O-N 3.14Å; A163-T166 PolarHBondContact O-OG1 3.39Å; V164-T166 VanDerWaalsContact C-N 3.31Å; V164-T166 PolarHBondContact O-N 3.36Å; T166-K170 WeakPolarHBondContact O-CG 3.34Å; T166-K170 PolarHBondContact O-N 3.3Å
167	Q	93.4	Very high	95.2	Very high	134 Å²	134	99.2 Å²	99.2	63%	0.626	51%	0.511	S	S	*	.	H	α-helix	trans	-68.8	-42.5	176.6	-170.9	178.7	-8.3	0	0	110.9	A163 V164 K169 K170 A171	A163-Q167 PolarHBondContact O-N 3.37Å; V164-Q167 WeakPolarHBondContact O-CB 3.49Å; V164-Q167 PolarHBondContact O-N 3.38Å; V164-Q167 VanDerWaalsContact O-N 3.08Å; Q167-K169 PolarHBondContact O-N 3.01Å; Q167-K170 WeakPolarHBondContact O-CA 3.45Å; Q167-K170 WeakPolarHBondContact O-CB 3.49Å; Q167-K170 PolarHBondContact O-N 2.92Å; Q167-A171 PolarHBondContact O-N 3.46Å
168	K	96.2	Very high	95.1	Very high	139 Å²	139	97.1 Å²	97.1	60%	0.604	50%	0.501	S	S	*	.	H	α-helix	trans	-54.9	-50.4	172.2	-176.9	177.3	178.2	176	0	111.4	V164 K170 A171 D172	V164-K168 PolarHBondContact O-N 3.48Å; K168-K170 PolarHBondContact O-N 3.24Å; K168-K170 VanDerWaalsContact O-N 3.11Å; K168-A171 WeakPolarHBondContact O-CA 3.39Å; K168-A171 WeakPolarHBondContact O-CB 3.47Å; K168-A171 PolarHBondContact O-N 2.86Å; K168-D172 VanDerWaalsContact O-CG 3.24Å; K168-D172 PolarHBondContact O-N 3.41Å
169	K	94.9	Very high	95	Very high	146 Å²	146	93.6 Å²	93.6	64%	0.635	49%	0.488	S	S	*	.	H	α-helix	trans	-59.6	-25.2	175.2	-71	177.3	-178.3	-179.8	0	114.4	A165 Q167 R173	A165-K169 WeakPolarHBondContact O-CG 3.49Å; A165-K169 PolarHBondContact O-N 2.85Å; A165-K169 VanDerWaalsContact O-N 3.15Å; Q167-K169 PolarHBondContact O-N 3.01Å; K169-R173 WeakPolarHBondContact O-CG 3.35Å; K169-R173 PolarHBondContact O-NE 3.37Å
170	K	94.2	Very high	95.1	Very high	129 Å²	129	92.3 Å²	92.3	56%	0.561	48%	0.48	S	S	*	.	H	α-helix	trans	-78.7	-41.8	172.9	-71.8	172.5	-178.9	178.4	0	111	T166 Q167 K168 R173 Y174	T166-K170 WeakPolarHBondContact O-CG 3.34Å; T166-K170 PolarHBondContact O-N 3.3Å; Q167-K170 WeakPolarHBondContact O-CA 3.45Å; Q167-K170 WeakPolarHBondContact O-CB 3.49Å; Q167-K170 PolarHBondContact O-N 2.92Å; K168-K170 PolarHBondContact O-N 3.24Å; K168-K170 VanDerWaalsContact O-N 3.11Å; K170-R173 PolarHBondContact O-N 2.96Å; K170-Y174 PolarHBondContact O-N 2.9Å; K170-Y174 VanDerWaalsContact O-N 3.15Å
171	A	94.4	Very high	94.9	Very high	46 Å²	46	95.1 Å²	95.1	38%	0.38	49%	0.485	S	S	.	.	H	α-helix	trans	-63.4	-45.6	176.3	0	0	0	0	0	111.7	Q167 K168 R173 Y174 I175	Q167-A171 PolarHBondContact O-N 3.46Å; K168-A171 WeakPolarHBondContact O-CA 3.39Å; K168-A171 WeakPolarHBondContact O-CB 3.47Å; K168-A171 PolarHBondContact O-N 2.86Å; A171-R173 VanDerWaalsContact C-N 3.31Å; A171-R173 PolarHBondContact O-N 2.96Å; A171-Y174 WeakPolarHBondContact O-CB 3.32Å; A171-Y174 PolarHBondContact O-N 2.86Å; A171-I175 WeakPolarHBondContact O-CG1 3.25Å; A171-I175 PolarHBondContact O-N 3.47Å
172	D	95.3	Very high	94.9	Very high	78 Å²	78	97.5 Å²	97.5	42%	0.417	49%	0.486	S	S	.	.	H	α-helix	trans	-59.6	-41.5	178.9	-61.8	-20.3	0	0	0	111.6	K168 Y174 I175 E176	K168-D172 VanDerWaalsContact O-CG 3.24Å; K168-D172 PolarHBondContact O-N 3.41Å; D172-Y174 VanDerWaalsContact C-N 3.35Å; D172-Y174 PolarHBondContact O-N 3.3Å; D172-I175 PolarHBondContact O-N 3.23Å; D172-E176 PolarHBondContact O-N 3.08Å
173	R	95.3	Very high	94.9	Very high	145 Å²	145	97.2 Å²	97.2	55%	0.547	48%	0.478	S	S	.	.	H	α-helix	trans	-63.6	-39.9	174.8	-76.3	-172.1	-64.5	147.1	0.1	112.5	K169 K170 A171 E176 E177	K169-R173 WeakPolarHBondContact O-CG 3.35Å; K169-R173 PolarHBondContact O-NE 3.37Å; K170-R173 PolarHBondContact O-N 2.96Å; A171-R173 VanDerWaalsContact C-N 3.31Å; A171-R173 PolarHBondContact O-N 2.96Å; R173-E176 PolarHBondContact O-N 3.05Å; R173-E177 WeakPolarHBondContact O-CG 3.41Å; R173-E177 PolarHBondContact O-N 2.7Å
174	Y	95.6	Very high	94.9	Very high	91 Å²	91	97 Å²	97	36%	0.357	48%	0.477	S	S	.	.	H	α-helix	trans	-66.6	-40.9	177.4	178.4	-111.4	0	0	0	111.7	K170 A171 D172 E176 E177 L178 Q313	K170-Y174 PolarHBondContact O-N 2.9Å; K170-Y174 VanDerWaalsContact O-N 3.15Å; A171-Y174 WeakPolarHBondContact O-CB 3.32Å; A171-Y174 PolarHBondContact O-N 2.86Å; D172-Y174 VanDerWaalsContact C-N 3.35Å; D172-Y174 PolarHBondContact O-N 3.3Å; Y174-E176 VanDerWaalsContact C-N 3.32Å; Y174-E176 PolarHBondContact O-N 3.43Å; Y174-E177 PolarHBondContact O-N 3.09Å; Y174-L178 HydrophobicContact CD1-CD1 3.97Å; Y174-L178 HydrophobicContact CD1-CG 4.48Å; Y174-L178 HydrophobicContact CE1-CD1 3.45Å; Y174-L178 VanDerWaalsContact CE1-CD1 3.45Å; Y174-L178 HydrophobicContact CE1-CG 4.11Å; Y174-L178 HydrophobicContact CE2-CD1 4.42Å; Y174-L178 HydrophobicContact CE2-CD2 4.32Å; Y174-L178 HydrophobicContact CE2-CG 4.21Å; Y174-L178 WeakPolarHBondContact O-CG 3.32Å; Y174-L178 PolarHBondContact O-N 2.91Å; Y174-Q313 VanDerWaalsContact OH-CD 3.26Å; Y174-Q313 PolarHBondContact OH-NE2 3.49Å; Y174-Q313 PolarHBondContact OH-OE1 2.88Å
175	I	94.1	Very high	94.9	Very high	86 Å²	86	97.4 Å²	97.4	44%	0.441	48%	0.476	S	S	.	.	H	α-helix	trans	-61.6	-41.4	173.5	-66.8	166.9	0	0	0	110.8	A171 D172 E177 L178 T179	A171-I175 WeakPolarHBondContact O-CG1 3.25Å; A171-I175 PolarHBondContact O-N 3.47Å; D172-I175 PolarHBondContact O-N 3.23Å; I175-E177 VanDerWaalsContact C-N 3.32Å; I175-E177 PolarHBondContact O-N 2.84Å; I175-L178 PolarHBondContact O-N 3.43Å; I175-T179 WeakPolarHBondContact O-CB 3.47Å; I175-T179 PolarHBondContact O-N 3.01Å; I175-T179 PolarHBondContact O-OG1 3.31Å
176	E	94.9	Very high	95.1	Very high	107 Å²	107	98.4 Å²	98.4	50%	0.5	48%	0.48	S	S	.	.	H	α-helix	trans	-63.9	-37.1	176.8	-159.1	-168	147.6	0	0	112.2	D172 R173 Y174 K180	D172-E176 PolarHBondContact O-N 3.08Å; R173-E176 PolarHBondContact O-N 3.05Å; Y174-E176 VanDerWaalsContact C-N 3.32Å; Y174-E176 PolarHBondContact O-N 3.43Å; E176-K180 WeakPolarHBondContact O-CD 3.39Å; E176-K180 VanDerWaalsContact O-CG 3.3Å; E176-K180 WeakPolarHBondContact O-CG 3.23Å; E176-K180 PolarHBondContact O-N 3.16Å; E176-K180 VanDerWaalsContact O-N 3.16Å; E176-K180 WeakPolarHBondContact OE1-CE 3.38Å; E176-K180 IonicContact OE1-NZ 2.76Å; E176-K180 PolarHBondContact OE1-NZ 3.2Å
177	E	95.5	Very high	95	Very high	107 Å²	107	99.6 Å²	99.6	50%	0.5	48%	0.482	S	S	.	.	H	α-helix	trans	-66	-49.2	173.3	-73.7	172.4	-175.1	0	0	111.7	R173 Y174 I175 T179 K180 E181	R173-E177 WeakPolarHBondContact O-CG 3.41Å; R173-E177 PolarHBondContact O-N 2.7Å; Y174-E177 PolarHBondContact O-N 3.09Å; I175-E177 VanDerWaalsContact C-N 3.32Å; I175-E177 PolarHBondContact O-N 2.84Å; E177-T179 VanDerWaalsContact C-N 3.27Å; E177-T179 PolarHBondContact O-N 3.47Å; E177-K180 WeakPolarHBondContact O-CB 3.48Å; E177-K180 PolarHBondContact O-N 2.96Å; E177-K180 VanDerWaalsContact O-N 3.12Å; E177-E181 PolarHBondContact O-N 2.9Å
178	L	93.8	Very high	95.1	Very high	46 Å²	46	98.1 Å²	98.1	24%	0.241	48%	0.476	C	S	.	.	H	α-helix	trans	-59.2	-38.2	176.1	-72	179.4	0	0	0	112.4	Y174 I175 E181 R182 M310	Y174-L178 HydrophobicContact CD1-CD1 3.97Å; Y174-L178 HydrophobicContact CD1-CG 4.48Å; Y174-L178 HydrophobicContact CE1-CD1 3.45Å; Y174-L178 VanDerWaalsContact CE1-CD1 3.45Å; Y174-L178 HydrophobicContact CE1-CG 4.11Å; Y174-L178 HydrophobicContact CE2-CD1 4.42Å; Y174-L178 HydrophobicContact CE2-CD2 4.32Å; Y174-L178 HydrophobicContact CE2-CG 4.21Å; Y174-L178 WeakPolarHBondContact O-CG 3.32Å; Y174-L178 PolarHBondContact O-N 2.91Å; I175-L178 PolarHBondContact O-N 3.43Å; L178-E181 PolarHBondContact O-N 3.37Å; L178-R182 WeakPolarHBondContact O-CB 3.23Å; L178-R182 PolarHBondContact O-N 3.16Å; L178-M310 HydrophobicContact CD2-SD 4.23Å
179	T	93.7	Very high	94.9	Very high	59 Å²	59	97 Å²	97	36%	0.362	48%	0.475	S	S	.	.	H	α-helix	trans	-64.5	-42.6	177.1	-55	0	0	0	0	110.9	I175 E177 E181 R182 D183	I175-T179 WeakPolarHBondContact O-CB 3.47Å; I175-T179 PolarHBondContact O-N 3.01Å; I175-T179 PolarHBondContact O-OG1 3.31Å; E177-T179 VanDerWaalsContact C-N 3.27Å; E177-T179 PolarHBondContact O-N 3.47Å; T179-E181 VanDerWaalsContact C-N 3.34Å; T179-E181 PolarHBondContact O-N 3.08Å; T179-R182 PolarHBondContact O-N 2.81Å; T179-D183 WeakPolarHBondContact O-CB 3.43Å; T179-D183 PolarHBondContact O-N 3.05Å
180	K	96.1	Very high	94.8	Very high	118 Å²	118	97.5 Å²	97.5	51%	0.513	47%	0.474	S	S	.	.	H	α-helix	trans	-63.4	-40	175.5	-71.7	164.8	-173.4	161	0	111.9	E176 E177 D183 A184	E176-K180 WeakPolarHBondContact O-CD 3.39Å; E176-K180 VanDerWaalsContact O-CG 3.3Å; E176-K180 WeakPolarHBondContact O-CG 3.23Å; E176-K180 PolarHBondContact O-N 3.16Å; E176-K180 VanDerWaalsContact O-N 3.16Å; E176-K180 WeakPolarHBondContact OE1-CE 3.38Å; E176-K180 IonicContact OE1-NZ 2.76Å; E176-K180 PolarHBondContact OE1-NZ 3.2Å; E177-K180 WeakPolarHBondContact O-CB 3.48Å; E177-K180 PolarHBondContact O-N 2.96Å; E177-K180 VanDerWaalsContact O-N 3.12Å; K180-D183 PolarHBondContact O-N 3.33Å; K180-A184 VanDerWaalsContact O-CB 3.32Å; K180-A184 WeakPolarHBondContact O-CB 3.3Å; K180-A184 PolarHBondContact O-N 2.97Å
181	E	94.7	Very high	94.7	Very high	111 Å²	111	99 Å²	99	52%	0.519	48%	0.477	S	S	.	.	H	α-helix	trans	-65.6	-45	176	-71.6	-179.9	177.5	0	0	111.7	E177 L178 T179 D183 A184 L185	E177-E181 PolarHBondContact O-N 2.9Å; L178-E181 PolarHBondContact O-N 3.37Å; T179-E181 VanDerWaalsContact C-N 3.34Å; T179-E181 PolarHBondContact O-N 3.08Å; E181-D183 VanDerWaalsContact C-N 3.33Å; E181-D183 PolarHBondContact O-N 3.14Å; E181-A184 PolarHBondContact O-N 2.84Å; E181-L185 WeakPolarHBondContact O-CB 3.42Å; E181-L185 WeakPolarHBondContact O-CG 3.37Å; E181-L185 PolarHBondContact O-N 3.26Å
182	R	95.7	Very high	94.7	Very high	159 Å²	159	101.4 Å²	101.4	60%	0.6	48%	0.483	S	S	*	.	H	α-helix	trans	-56.3	-48.2	173.9	-171.9	-74.8	-56.1	-115	1.4	111.1	L178 T179 L185 S186	L178-R182 WeakPolarHBondContact O-CB 3.23Å; L178-R182 PolarHBondContact O-N 3.16Å; T179-R182 PolarHBondContact O-N 2.81Å; R182-L185 PolarHBondContact O-N 3.12Å; R182-S186 WeakPolarHBondContact O-CB 3.49Å; R182-S186 PolarHBondContact O-N 3.37Å
183	D	94.6	Very high	94.5	Very high	70 Å²	70	102.1 Å²	102.1	37%	0.374	49%	0.49	S	S	.	.	H	α-helix	trans	-65.4	-39.2	179.6	-67	-11.4	0	0	0	111.7	T179 K180 E181 S186 L187	T179-D183 WeakPolarHBondContact O-CB 3.43Å; T179-D183 PolarHBondContact O-N 3.05Å; K180-D183 PolarHBondContact O-N 3.33Å; E181-D183 VanDerWaalsContact C-N 3.33Å; E181-D183 PolarHBondContact O-N 3.14Å; D183-S186 PolarHBondContact O-N 3.47Å; D183-L187 WeakPolarHBondContact O-CG 3.42Å; D183-L187 PolarHBondContact O-N 3.38Å
184	A	96.8	Very high	94.4	Very high	50 Å²	50	98.6 Å²	98.6	41%	0.413	48%	0.481	S	S	.	.	H	α-helix	trans	-63.2	-46.3	175.4	0	0	0	0	0	111.9	K180 E181 L187 E188	K180-A184 VanDerWaalsContact O-CB 3.32Å; K180-A184 WeakPolarHBondContact O-CB 3.3Å; K180-A184 PolarHBondContact O-N 2.97Å; E181-A184 PolarHBondContact O-N 2.84Å; A184-L187 WeakPolarHBondContact O-CB 3.49Å; A184-L187 PolarHBondContact O-N 2.84Å; A184-E188 PolarHBondContact O-N 3.24Å
185	L	96.7	Very high	94.1	Very high	97 Å²	97	97.4 Å²	97.4	51%	0.508	48%	0.484	S	S	.	.	H	α-helix	trans	-64.8	-39.4	176.5	-72.5	173.8	0	0	0	111.8	E181 R182 L187 E188 L189	E181-L185 WeakPolarHBondContact O-CB 3.42Å; E181-L185 WeakPolarHBondContact O-CG 3.37Å; E181-L185 PolarHBondContact O-N 3.26Å; R182-L185 PolarHBondContact O-N 3.12Å; L185-L187 VanDerWaalsContact C-N 3.3Å; L185-L187 PolarHBondContact O-N 3.22Å; L185-E188 PolarHBondContact O-N 3.41Å; L185-E188 VanDerWaalsContact O-N 3.15Å; L185-L189 WeakPolarHBondContact O-CG 3.43Å; L185-L189 PolarHBondContact O-N 2.88Å
186	S	96.6	Very high	94	Very high	69 Å²	69	96.9 Å²	96.9	48%	0.483	48%	0.482	S	S	.	.	H	α-helix	trans	-60.3	-40.5	174.9	-170.1	0	0	0	0	111.7	R182 D183 L189 Y190	R182-S186 WeakPolarHBondContact O-CB 3.49Å; R182-S186 PolarHBondContact O-N 3.37Å; D183-S186 PolarHBondContact O-N 3.47Å; S186-L189 PolarHBondContact O-N 2.8Å; S186-Y190 PolarHBondContact O-N 2.9Å
187	L	93.6	Very high	93.9	Very high	105 Å²	105	97.3 Å²	97.3	55%	0.55	48%	0.484	S	S	.	.	H	α-helix	trans	-67.2	-36.7	173.9	-73.1	169.2	0	0	0	112.8	D183 A184 L185 Y190 R191	D183-L187 WeakPolarHBondContact O-CG 3.42Å; D183-L187 PolarHBondContact O-N 3.38Å; A184-L187 WeakPolarHBondContact O-CB 3.49Å; A184-L187 PolarHBondContact O-N 2.84Å; L185-L187 VanDerWaalsContact C-N 3.3Å; L185-L187 PolarHBondContact O-N 3.22Å; L187-Y190 PolarHBondContact O-N 3.34Å; L187-R191 WeakPolarHBondContact O-CG 3.39Å; L187-R191 PolarHBondContact O-N 3.48Å
188	E	93.7	Very high	93.7	Very high	103 Å²	103	96.5 Å²	96.5	48%	0.481	48%	0.48	S	S	.	.	H	α-helix	trans	-66.9	-42.5	174.4	-74.6	-173.5	170.8	0	0	112	A184 L185 Y190 R191 N192	A184-E188 PolarHBondContact O-N 3.24Å; L185-E188 PolarHBondContact O-N 3.41Å; L185-E188 VanDerWaalsContact O-N 3.15Å; E188-Y190 VanDerWaalsContact C-N 3.32Å; E188-Y190 PolarHBondContact O-N 2.91Å; E188-R191 WeakPolarHBondContact O-CB 3.46Å; E188-R191 PolarHBondContact O-N 3.48Å; E188-N192 WeakPolarHBondContact O-CB 3.4Å; E188-N192 VanDerWaalsContact O-CG 3.23Å; E188-N192 PolarHBondContact O-N 3.46Å
189	L	92.1	Very high	93.5	Very high	114 Å²	114	99.3 Å²	99.3	60%	0.597	50%	0.495	S	S	*	.	H	α-helix	trans	-60.7	-41.4	174.1	-72.6	175.1	0	0	0	111.9	L185 S186 N192 T193	L185-L189 WeakPolarHBondContact O-CG 3.43Å; L185-L189 PolarHBondContact O-N 2.88Å; S186-L189 PolarHBondContact O-N 2.8Å; L189-N192 PolarHBondContact O-N 3.33Å; L189-T193 WeakPolarHBondContact O-CB 3.36Å; L189-T193 PolarHBondContact O-N 3.06Å; L189-T193 PolarHBondContact O-OG1 3.23Å
190	Y	92.7	Very high	93.5	Very high	157 Å²	157	102 Å²	102	62%	0.616	50%	0.501	S	S	*	.	H	α-helix	trans	-63.1	-42.4	174.8	-176.4	-104	0	0	0	112	S186 L187 E188 T193 I194	S186-Y190 PolarHBondContact O-N 2.9Å; L187-Y190 PolarHBondContact O-N 3.34Å; E188-Y190 VanDerWaalsContact C-N 3.32Å; E188-Y190 PolarHBondContact O-N 2.91Å; Y190-T193 PolarHBondContact O-N 3.38Å; Y190-I194 HydrophobicContact CD1-CD1 3.82Å; Y190-I194 HydrophobicContact CE1-CD1 3.35Å; Y190-I194 HydrophobicContact CE1-CG1 4.36Å; Y190-I194 WeakPolarHBondContact O-CG1 3.5Å; Y190-I194 PolarHBondContact O-N 3.19Å; Y190-I194 VanDerWaalsContact O-N 3.1Å
191	R	93.8	Very high	93.4	Very high	162 Å²	162	101.3 Å²	101.3	61%	0.611	50%	0.5	S	S	*	.	H	α-helix	trans	-62.4	-44.6	174.1	-74.6	173.3	179.8	167.1	3	111.8	L187 E188 T193 I194 T195	L187-R191 WeakPolarHBondContact O-CG 3.39Å; L187-R191 PolarHBondContact O-N 3.48Å; E188-R191 WeakPolarHBondContact O-CB 3.46Å; E188-R191 PolarHBondContact O-N 3.48Å; R191-T193 VanDerWaalsContact C-N 3.3Å; R191-T193 PolarHBondContact O-N 3.4Å; R191-I194 PolarHBondContact O-N 2.88Å; R191-T195 WeakPolarHBondContact O-CG2 3.3Å; R191-T195 PolarHBondContact O-N 3.36Å; R191-T195 PolarHBondContact O-OG1 3.14Å
192	N	92.6	Very high	93.3	Very high	96 Å²	96	100.9 Å²	100.9	51%	0.513	50%	0.496	S	S	.	.	H	α-helix	trans	-62.4	-40.9	179	-71.9	-12.5	0	0	0	110.9	E188 L189 I194 T195 D196	E188-N192 WeakPolarHBondContact O-CB 3.4Å; E188-N192 VanDerWaalsContact O-CG 3.23Å; E188-N192 PolarHBondContact O-N 3.46Å; L189-N192 PolarHBondContact O-N 3.33Å; N192-I194 PolarHBondContact O-N 3.49Å; N192-T195 VanDerWaalsContact CA-OG1 3.32Å; N192-T195 WeakPolarHBondContact CA-OG1 3.5Å; N192-T195 PolarHBondContact O-N 2.93Å; N192-T195 PolarHBondContact O-OG1 2.85Å; N192-D196 WeakPolarHBondContact O-CB 3.34Å; N192-D196 PolarHBondContact O-N 3.45Å
193	T	92.4	Very high	93.2	Very high	92 Å²	92	97.6 Å²	97.6	56%	0.564	49%	0.491	S	S	*	.	H	α-helix	trans	-59.8	-45.2	175.3	-54.2	0	0	0	0	111.4	L189 Y190 R191 T195 D196 E197	L189-T193 WeakPolarHBondContact O-CB 3.36Å; L189-T193 PolarHBondContact O-N 3.06Å; L189-T193 PolarHBondContact O-OG1 3.23Å; Y190-T193 PolarHBondContact O-N 3.38Å; R191-T193 VanDerWaalsContact C-N 3.3Å; R191-T193 PolarHBondContact O-N 3.4Å; T193-T195 PolarHBondContact O-N 2.94Å; T193-D196 PolarHBondContact O-N 3.25Å; T193-E197 PolarHBondContact O-N 3.5Å; T193-E197 VanDerWaalsContact O-N 3.09Å
194	I	91.8	Very high	93.1	Very high	71 Å²	71	96.4 Å²	96.4	36%	0.364	49%	0.491	S	S	.	.	H	α-helix	trans	-61.6	-45	175.3	-67	167.1	0	0	0	110.9	Y190 R191 N192 D196 E197 E198	Y190-I194 HydrophobicContact CD1-CD1 3.82Å; Y190-I194 HydrophobicContact CE1-CD1 3.35Å; Y190-I194 HydrophobicContact CE1-CG1 4.36Å; Y190-I194 WeakPolarHBondContact O-CG1 3.5Å; Y190-I194 PolarHBondContact O-N 3.19Å; Y190-I194 VanDerWaalsContact O-N 3.1Å; R191-I194 PolarHBondContact O-N 2.88Å; N192-I194 PolarHBondContact O-N 3.49Å; I194-D196 PolarHBondContact O-N 3.23Å; I194-E197 PolarHBondContact O-N 3.47Å; I194-E198 PolarHBondContact O-N 3.46Å
195	T	90.9	Very high	92.9	Very high	67 Å²	67	98.4 Å²	98.4	41%	0.411	49%	0.49	S	S	.	.	H	α-helix	trans	-66.8	-36.4	-179.2	56.6	0	0	0	0	112.9	R191 N192 T193 E198 L199	R191-T195 WeakPolarHBondContact O-CG2 3.3Å; R191-T195 PolarHBondContact O-N 3.36Å; R191-T195 PolarHBondContact O-OG1 3.14Å; N192-T195 VanDerWaalsContact CA-OG1 3.32Å; N192-T195 WeakPolarHBondContact CA-OG1 3.5Å; N192-T195 PolarHBondContact O-N 2.93Å; N192-T195 PolarHBondContact O-OG1 2.85Å; T193-T195 PolarHBondContact O-N 2.94Å; T195-E198 PolarHBondContact O-N 3.4Å; T195-L199 WeakPolarHBondContact O-CG 3.39Å; T195-L199 PolarHBondContact O-N 3.49Å
196	D	91.4	Very high	92.7	Very high	74 Å²	74	98.9 Å²	98.9	40%	0.396	49%	0.493	S	S	.	.	H	α-helix	trans	-65.2	-42.1	175.9	-174.4	58.7	0	0	0	110.9	N192 T193 I194 E198 L199 K200	N192-D196 WeakPolarHBondContact O-CB 3.34Å; N192-D196 PolarHBondContact O-N 3.45Å; T193-D196 PolarHBondContact O-N 3.25Å; I194-D196 PolarHBondContact O-N 3.23Å; D196-E198 PolarHBondContact O-N 2.99Å; D196-L199 PolarHBondContact O-N 2.83Å; D196-L199 VanDerWaalsContact O-N 3.15Å; D196-K200 WeakPolarHBondContact O-CG 3.37Å; D196-K200 PolarHBondContact O-N 3.3Å; D196-K200 WeakPolarHBondContact OD2-CE 3.41Å; D196-K200 IonicContact OD2-NZ 2.84Å; D196-K200 PolarHBondContact OD2-NZ 3.04Å
197	E	92.2	Very high	92.6	Very high	117 Å²	117	101.1 Å²	101.1	55%	0.547	50%	0.495	S	S	.	.	H	α-helix	trans	-64.1	-40.5	175.9	-159.7	60.8	-159.5	0	0	112	T193 I194 L199 K200 E201	T193-E197 PolarHBondContact O-N 3.5Å; T193-E197 VanDerWaalsContact O-N 3.09Å; I194-E197 PolarHBondContact O-N 3.47Å; E197-L199 VanDerWaalsContact C-N 3.33Å; E197-L199 PolarHBondContact O-N 2.8Å; E197-K200 PolarHBondContact O-N 3.21Å; E197-K200 IonicContact OE2-NZ 3.88Å; E197-E201 PolarHBondContact O-N 3.38Å
198	E	91.9	Very high	92.5	Very high	90 Å²	90	102.4 Å²	102.4	42%	0.421	50%	0.499	S	S	.	.	H	α-helix	trans	-62.6	-37.8	172	-74	-172.1	-165.6	0	0	112.9	I194 T195 D196 K202	I194-E198 PolarHBondContact O-N 3.46Å; T195-E198 PolarHBondContact O-N 3.4Å; D196-E198 PolarHBondContact O-N 2.99Å; E198-K202 WeakPolarHBondContact O-CB 3.47Å; E198-K202 WeakPolarHBondContact O-CD 3.43Å; E198-K202 VanDerWaalsContact O-CG 3.24Å; E198-K202 WeakPolarHBondContact O-CG 3.35Å; E198-K202 PolarHBondContact O-N 2.68Å; E198-K202 IonicContact OE2-NZ 3.34Å; E198-K202 PolarHBondContact OE2-NZ 3Å; E198-K202 VanDerWaalsContact OE2-NZ 3.16Å
199	L	90.2	Very high	92.5	Very high	105 Å²	105	104 Å²	104	55%	0.55	50%	0.504	S	S	.	.	H	α-helix	trans	-69	-41.7	177.5	-75.4	174.5	0	0	0	111	T195 D196 E197 K202 N203	T195-L199 WeakPolarHBondContact O-CG 3.39Å; T195-L199 PolarHBondContact O-N 3.49Å; D196-L199 PolarHBondContact O-N 2.83Å; D196-L199 VanDerWaalsContact O-N 3.15Å; E197-L199 VanDerWaalsContact C-N 3.33Å; E197-L199 PolarHBondContact O-N 2.8Å; L199-K202 PolarHBondContact O-N 2.86Å; L199-N203 VanDerWaalsContact O-CB 3.31Å; L199-N203 WeakPolarHBondContact O-CB 3.28Å; L199-N203 PolarHBondContact O-N 2.82Å
200	K	93.1	Very high	92.6	Very high	114 Å²	114	103.4 Å²	103.4	50%	0.496	50%	0.501	S	S	.	.	H	α-helix	trans	-59.2	-45.6	172.5	-75.9	167.1	174.7	157.9	0	111.6	D196 E197 K202 N203 A204	D196-K200 WeakPolarHBondContact O-CG 3.37Å; D196-K200 PolarHBondContact O-N 3.3Å; D196-K200 WeakPolarHBondContact OD2-CE 3.41Å; D196-K200 IonicContact OD2-NZ 2.84Å; D196-K200 PolarHBondContact OD2-NZ 3.04Å; E197-K200 PolarHBondContact O-N 3.21Å; E197-K200 IonicContact OE2-NZ 3.88Å; K200-K202 PolarHBondContact O-N 2.97Å; K200-N203 PolarHBondContact O-N 3.36Å; K200-A204 WeakPolarHBondContact O-CB 3.46Å; K200-A204 PolarHBondContact O-N 3.45Å
201	E	93.3	Very high	92.6	Very high	105 Å²	105	102.2 Å²	102.2	49%	0.491	50%	0.501	S	S	.	.	H	α-helix	trans	-62.5	-43	177.1	-164.7	-160.8	177.2	0	0	111.6	E197 N203 A204 K205	E197-E201 PolarHBondContact O-N 3.38Å; E201-N203 VanDerWaalsContact C-N 3.33Å; E201-N203 PolarHBondContact O-N 3.35Å; E201-A204 PolarHBondContact O-N 3.09Å; E201-K205 WeakPolarHBondContact O-CG 3.43Å; E201-K205 PolarHBondContact O-N 3.22Å; E201-K205 VanDerWaalsContact OE1-CE 3.23Å; E201-K205 WeakPolarHBondContact OE1-CE 3.34Å; E201-K205 IonicContact OE1-NZ 3.63Å; E201-K205 PolarHBondContact OE1-NZ 2.96Å; E201-K205 IonicContact OE2-NZ 2.97Å; E201-K205 PolarHBondContact OE2-NZ 3.3Å
202	K	94	Very high	92.6	Very high	101 Å²	101	99.2 Å²	99.2	44%	0.439	50%	0.496	S	S	.	.	H	α-helix	trans	-63.5	-40	175.1	-74.4	165.7	-170.9	146.1	0	111.5	E198 L199 K200 K205 L206	E198-K202 WeakPolarHBondContact O-CB 3.47Å; E198-K202 WeakPolarHBondContact O-CD 3.43Å; E198-K202 VanDerWaalsContact O-CG 3.24Å; E198-K202 WeakPolarHBondContact O-CG 3.35Å; E198-K202 PolarHBondContact O-N 2.68Å; E198-K202 IonicContact OE2-NZ 3.34Å; E198-K202 PolarHBondContact OE2-NZ 3Å; E198-K202 VanDerWaalsContact OE2-NZ 3.16Å; L199-K202 PolarHBondContact O-N 2.86Å; K200-K202 PolarHBondContact O-N 2.97Å; K202-K205 PolarHBondContact O-N 3.42Å; K202-L206 WeakPolarHBondContact O-CG 3.47Å; K202-L206 PolarHBondContact O-N 3Å
203	N	92.7	Very high	92.6	Very high	90 Å²	90	98.6 Å²	98.6	48%	0.481	50%	0.496	S	S	.	.	H	α-helix	trans	-67.3	-42.9	179	-155.8	-1.5	0	0	0	111.1	L199 K200 E201 K205 L206 Q207	L199-N203 VanDerWaalsContact O-CB 3.31Å; L199-N203 WeakPolarHBondContact O-CB 3.28Å; L199-N203 PolarHBondContact O-N 2.82Å; K200-N203 PolarHBondContact O-N 3.36Å; E201-N203 VanDerWaalsContact C-N 3.33Å; E201-N203 PolarHBondContact O-N 3.35Å; N203-K205 PolarHBondContact O-N 3.43Å; N203-L206 PolarHBondContact O-N 2.88Å; N203-L206 VanDerWaalsContact O-N 3.14Å; N203-Q207 WeakPolarHBondContact O-CG 3.38Å; N203-Q207 PolarHBondContact O-N 3.47Å
204	A	93.4	Very high	92.6	Very high	45 Å²	45	99.3 Å²	99.3	37%	0.372	49%	0.493	S	S	.	.	H	α-helix	trans	-58.2	-46.9	172.4	0	0	0	0	0	111.8	K200 E201 L206 Q207 E208	K200-A204 WeakPolarHBondContact O-CB 3.46Å; K200-A204 PolarHBondContact O-N 3.45Å; E201-A204 PolarHBondContact O-N 3.09Å; A204-L206 VanDerWaalsContact C-N 3.29Å; A204-L206 PolarHBondContact O-N 2.92Å; A204-Q207 PolarHBondContact O-N 3.5Å; A204-E208 PolarHBondContact O-N 3.32Å
205	K	92.7	Very high	92.4	Very high	92 Å²	92	99 Å²	99	40%	0.4	50%	0.497	S	S	.	.	H	α-helix	trans	-61.3	-34.4	175.2	-73.7	170.9	-175.7	164.7	0	113	E201 K202 N203 K209	E201-K205 WeakPolarHBondContact O-CG 3.43Å; E201-K205 PolarHBondContact O-N 3.22Å; E201-K205 VanDerWaalsContact OE1-CE 3.23Å; E201-K205 WeakPolarHBondContact OE1-CE 3.34Å; E201-K205 IonicContact OE1-NZ 3.63Å; E201-K205 PolarHBondContact OE1-NZ 2.96Å; E201-K205 IonicContact OE2-NZ 2.97Å; E201-K205 PolarHBondContact OE2-NZ 3.3Å; K202-K205 PolarHBondContact O-N 3.42Å; N203-K205 PolarHBondContact O-N 3.43Å; K205-K209 VanDerWaalsContact O-CG 3.29Å; K205-K209 WeakPolarHBondContact O-CG 3.37Å; K205-K209 PolarHBondContact O-N 2.64Å; K205-K209 VanDerWaalsContact O-N 3.16Å
206	L	93	Very high	92.5	Very high	108 Å²	108	100.5 Å²	100.5	57%	0.565	50%	0.499	S	S	*	.	H	α-helix	trans	-72.2	-39.9	176.1	-76.1	172.4	0	0	0	111.6	K202 N203 A204 K209 L210	K202-L206 WeakPolarHBondContact O-CG 3.47Å; K202-L206 PolarHBondContact O-N 3Å; N203-L206 PolarHBondContact O-N 2.88Å; N203-L206 VanDerWaalsContact O-N 3.14Å; A204-L206 VanDerWaalsContact C-N 3.29Å; A204-L206 PolarHBondContact O-N 2.92Å; L206-K209 PolarHBondContact O-N 2.94Å; L206-L210 WeakPolarHBondContact O-CB 3.44Å; L206-L210 PolarHBondContact O-N 3.45Å
207	Q	92.6	Very high	92.5	Very high	115 Å²	115	103.2 Å²	103.2	54%	0.537	51%	0.508	S	S	.	.	H	α-helix	trans	-61.8	-42.9	173.9	-72.6	177.2	-10	0	0	111.7	N203 A204 K209 L210 Q211	N203-Q207 WeakPolarHBondContact O-CG 3.38Å; N203-Q207 PolarHBondContact O-N 3.47Å; A204-Q207 PolarHBondContact O-N 3.5Å; Q207-K209 PolarHBondContact O-N 3.27Å; Q207-L210 WeakPolarHBondContact O-CB 3.5Å; Q207-L210 PolarHBondContact O-N 2.91Å; Q207-Q211 WeakPolarHBondContact O-CG 3.36Å; Q207-Q211 PolarHBondContact O-N 2.96Å
208	E	92.7	Very high	92.1	Very high	132 Å²	132	100.7 Å²	100.7	62%	0.617	50%	0.503	S	S	*	.	H	α-helix	trans	-60.4	-44.9	174.2	-73.6	179.9	172.5	0	0	112.1	A204 L210 Q211 L212	A204-E208 PolarHBondContact O-N 3.32Å; E208-L210 VanDerWaalsContact C-N 3.31Å; E208-L210 PolarHBondContact O-N 3.48Å; E208-Q211 PolarHBondContact O-N 3.15Å; E208-L212 PolarHBondContact O-N 3.31Å
209	K	94.2	Very high	91.9	Very high	136 Å²	136	102.3 Å²	102.3	59%	0.591	51%	0.511	S	S	*	.	H	α-helix	trans	-63.5	-39	176.1	-75	174.3	-178.5	179.7	0	112	K205 L206 Q207 L212 V213	K205-K209 VanDerWaalsContact O-CG 3.29Å; K205-K209 WeakPolarHBondContact O-CG 3.37Å; K205-K209 PolarHBondContact O-N 2.64Å; K205-K209 VanDerWaalsContact O-N 3.16Å; L206-K209 PolarHBondContact O-N 2.94Å; Q207-K209 PolarHBondContact O-N 3.27Å; K209-L212 PolarHBondContact O-N 2.68Å; K209-V213 WeakPolarHBondContact O-CG2 3.47Å; K209-V213 PolarHBondContact O-N 2.94Å
210	L	94.1	Very high	91.9	Very high	102 Å²	102	102.4 Å²	102.4	53%	0.534	51%	0.51	S	S	.	.	H	α-helix	trans	-63.7	-47.2	177.1	-174.5	66.8	0	0	0	110.6	L206 Q207 E208 L212 V213 E214	L206-L210 WeakPolarHBondContact O-CB 3.44Å; L206-L210 PolarHBondContact O-N 3.45Å; Q207-L210 WeakPolarHBondContact O-CB 3.5Å; Q207-L210 PolarHBondContact O-N 2.91Å; E208-L210 VanDerWaalsContact C-N 3.31Å; E208-L210 PolarHBondContact O-N 3.48Å; L210-L212 VanDerWaalsContact C-N 3.29Å; L210-L212 PolarHBondContact O-N 2.86Å; L210-V213 PolarHBondContact O-N 3.42Å; L210-E214 WeakPolarHBondContact O-CG 3.38Å; L210-E214 PolarHBondContact O-N 2.8Å
211	Q	92.1	Very high	91.7	Very high	132 Å²	132	101.9 Å²	101.9	62%	0.617	51%	0.51	S	S	*	.	H	α-helix	trans	-58.4	-40.6	174.8	-74	-177.5	2	0	0	112.2	Q207 E208 E214 S215	Q207-Q211 WeakPolarHBondContact O-CG 3.36Å; Q207-Q211 PolarHBondContact O-N 2.96Å; E208-Q211 PolarHBondContact O-N 3.15Å; Q211-E214 PolarHBondContact O-N 3.38Å; Q211-S215 PolarHBondContact O-N 2.99Å
212	L	93.3	Very high	91.4	Very high	99 Å²	99	102.3 Å²	102.3	52%	0.518	52%	0.515	S	S	.	.	H	α-helix	trans	-61.1	-49.2	175.8	-176.9	66	0	0	0	111.3	E208 K209 L210 E214 S215 E216	E208-L212 PolarHBondContact O-N 3.31Å; K209-L212 PolarHBondContact O-N 2.68Å; L210-L212 VanDerWaalsContact C-N 3.29Å; L210-L212 PolarHBondContact O-N 2.86Å; L212-E214 VanDerWaalsContact C-N 3.3Å; L212-E214 PolarHBondContact O-N 3Å; L212-S215 PolarHBondContact O-N 3.15Å; L212-S215 VanDerWaalsContact O-N 3.14Å; L212-S215 PolarHBondContact O-OG 2.81Å; L212-E216 PolarHBondContact O-N 3.29Å
213	V	92.5	Very high	91.2	Very high	84 Å²	84	101.6 Å²	101.6	51%	0.509	52%	0.516	S	S	.	.	H	α-helix	trans	-63.6	-36.4	178.6	172	0	0	0	0	111.8	K209 L210 S215 E216 K217	K209-V213 WeakPolarHBondContact O-CG2 3.47Å; K209-V213 PolarHBondContact O-N 2.94Å; L210-V213 PolarHBondContact O-N 3.42Å; V213-S215 VanDerWaalsContact C-N 3.33Å; V213-E216 PolarHBondContact O-N 2.93Å; V213-K217 WeakPolarHBondContact O-CB 3.42Å; V213-K217 PolarHBondContact O-N 3.42Å
214	E	92.4	Very high	90.9	Very high	107 Å²	107	101.3 Å²	101.3	50%	0.5	52%	0.517	S	S	.	.	H	α-helix	trans	-64	-38.3	174.2	-74.4	176.9	170.9	0	0	112.3	L210 Q211 L212 S218	L210-E214 WeakPolarHBondContact O-CG 3.38Å; L210-E214 PolarHBondContact O-N 2.8Å; Q211-E214 PolarHBondContact O-N 3.38Å; L212-E214 VanDerWaalsContact C-N 3.3Å; L212-E214 PolarHBondContact O-N 3Å; E214-S218 WeakPolarHBondContact O-CB 3.48Å; E214-S218 PolarHBondContact O-N 3.17Å; E214-S218 PolarHBondContact O-OG 2.92Å
215	S	87.7	Confident	90.5	Very high	64 Å²	64	105.6 Å²	105.6	45%	0.448	53%	0.528	S	S	.	.	H	α-helix	trans	-66	-44.4	174.8	76.5	0	0	0	0	112	Q211 L212 V213 K217 S218 E219	Q211-S215 PolarHBondContact O-N 2.99Å; L212-S215 PolarHBondContact O-N 3.15Å; L212-S215 VanDerWaalsContact O-N 3.14Å; L212-S215 PolarHBondContact O-OG 2.81Å; V213-S215 VanDerWaalsContact C-N 3.33Å; S215-K217 PolarHBondContact O-N 2.96Å; S215-S218 WeakPolarHBondContact O-CB 3.4Å; S215-S218 PolarHBondContact O-N 3.07Å; S215-S218 VanDerWaalsContact O-N 3.16Å; S215-E219 PolarHBondContact O-N 3.41Å
216	E	92.3	Very high	90.1	Very high	98 Å²	98	105.4 Å²	105.4	46%	0.458	53%	0.528	S	S	.	.	H	α-helix	trans	-62.7	-42.4	176	-69.4	178.6	173.7	0	0	111.6	L212 V213 S218 E219 I220	L212-E216 PolarHBondContact O-N 3.29Å; V213-E216 PolarHBondContact O-N 2.93Å; E216-S218 VanDerWaalsContact C-N 3.28Å; E216-S218 PolarHBondContact O-N 2.97Å; E216-E219 PolarHBondContact O-N 3.36Å; E216-I220 VanDerWaalsContact O-CG1 3.3Å; E216-I220 WeakPolarHBondContact O-CG1 3.34Å; E216-I220 PolarHBondContact O-N 3.07Å
217	K	91.4	Very high	89.6	Confident	132 Å²	132	105.6 Å²	105.6	57%	0.574	53%	0.529	S	S	*	.	H	α-helix	trans	-58.8	-41.8	174.4	178.4	-176.6	174.7	-174.7	0	111.3	V213 S215 Q221	V213-K217 WeakPolarHBondContact O-CB 3.42Å; V213-K217 PolarHBondContact O-N 3.42Å; S215-K217 PolarHBondContact O-N 2.96Å; K217-Q221 WeakPolarHBondContact O-CB 3.45Å; K217-Q221 WeakPolarHBondContact O-CG 3.44Å; K217-Q221 PolarHBondContact O-N 2.91Å
218	S	84.2	Confident	89.3	Confident	64 Å²	64	106.2 Å²	106.2	45%	0.448	53%	0.53	S	S	.	.	H	α-helix	trans	-66.7	-41.6	179	-58.7	0	0	0	0	111.6	E214 S215 E216 Q221 L222	E214-S218 WeakPolarHBondContact O-CB 3.48Å; E214-S218 PolarHBondContact O-N 3.17Å; E214-S218 PolarHBondContact O-OG 2.92Å; S215-S218 WeakPolarHBondContact O-CB 3.4Å; S215-S218 PolarHBondContact O-N 3.07Å; S215-S218 VanDerWaalsContact O-N 3.16Å; E216-S218 VanDerWaalsContact C-N 3.28Å; E216-S218 PolarHBondContact O-N 2.97Å; S218-Q221 PolarHBondContact O-N 3.35Å; S218-L222 WeakPolarHBondContact O-CG 3.36Å; S218-L222 PolarHBondContact O-N 2.85Å
219	E	89.3	Confident	88.5	Confident	124 Å²	124	108 Å²	108	58%	0.579	53%	0.531	S	S	*	.	H	α-helix	trans	-63.7	-45.3	175	-171.4	-178.9	175.4	0	0	112	S215 E216 Q221 L222 N223	S215-E219 PolarHBondContact O-N 3.41Å; E216-E219 PolarHBondContact O-N 3.36Å; E219-Q221 VanDerWaalsContact C-N 3.32Å; E219-Q221 PolarHBondContact O-N 3.31Å; E219-L222 PolarHBondContact O-N 3.43Å; E219-N223 PolarHBondContact O-N 2.82Å; E219-N223 PolarHBondContact O-ND2 3.23Å
220	I	88.5	Confident	87.9	Confident	106 Å²	106	106.6 Å²	106.6	54%	0.544	53%	0.525	S	S	.	.	H	α-helix	trans	-61.2	-42.6	175.7	-68.1	166.9	0	0	0	110.5	E216 L222 N223 V224	E216-I220 VanDerWaalsContact O-CG1 3.3Å; E216-I220 WeakPolarHBondContact O-CG1 3.34Å; E216-I220 PolarHBondContact O-N 3.07Å; I220-L222 VanDerWaalsContact C-N 3.34Å; I220-L222 PolarHBondContact O-N 2.87Å; I220-N223 PolarHBondContact O-N 2.95Å; I220-V224 HydrophobicContact CG2-CG2 4.31Å; I220-V224 VanDerWaalsContact O-CG2 3.3Å; I220-V224 WeakPolarHBondContact O-CG2 3.41Å; I220-V224 PolarHBondContact O-N 3.35Å
221	Q	89.5	Confident	87.4	Confident	103 Å²	103	106.3 Å²	106.3	48%	0.481	52%	0.523	S	S	.	.	H	α-helix	trans	-60.8	-41.3	176.2	-82.2	-174.5	3.7	0	0	112.5	K217 S218 E219 V224 K225	K217-Q221 WeakPolarHBondContact O-CB 3.45Å; K217-Q221 WeakPolarHBondContact O-CG 3.44Å; K217-Q221 PolarHBondContact O-N 2.91Å; S218-Q221 PolarHBondContact O-N 3.35Å; E219-Q221 VanDerWaalsContact C-N 3.32Å; E219-Q221 PolarHBondContact O-N 3.31Å; Q221-V224 PolarHBondContact O-N 3.13Å; Q221-K225 WeakPolarHBondContact O-CG 3.47Å; Q221-K225 PolarHBondContact O-N 3.32Å
222	L	86.9	Confident	86.6	Confident	115 Å²	115	104.8 Å²	104.8	60%	0.602	52%	0.516	S	S	*	.	H	α-helix	trans	-62.9	-46	174.4	-73.4	173.7	0	0	0	111.5	S218 E219 I220 V224 K225 E226	S218-L222 WeakPolarHBondContact O-CG 3.36Å; S218-L222 PolarHBondContact O-N 2.85Å; E219-L222 PolarHBondContact O-N 3.43Å; I220-L222 VanDerWaalsContact C-N 3.34Å; I220-L222 PolarHBondContact O-N 2.87Å; L222-V224 VanDerWaalsContact C-N 3.32Å; L222-V224 PolarHBondContact O-N 3.04Å; L222-K225 WeakPolarHBondContact O-CB 3.32Å; L222-K225 PolarHBondContact O-N 3.26Å; L222-K225 VanDerWaalsContact O-N 3.17Å; L222-E226 WeakPolarHBondContact O-CB 3.44Å; L222-E226 PolarHBondContact O-N 3.49Å
223	N	89.5	Confident	85.5	Confident	85 Å²	85	106.7 Å²	106.7	46%	0.455	52%	0.517	S	S	.	.	H	α-helix	trans	-61.3	-39.2	177.3	-75.6	-33.1	0	0	0	112.4	E219 I220 E226 L227	E219-N223 PolarHBondContact O-N 2.82Å; E219-N223 PolarHBondContact O-ND2 3.23Å; I220-N223 PolarHBondContact O-N 2.95Å; N223-E226 WeakPolarHBondContact O-CB 3.47Å; N223-E226 PolarHBondContact O-N 3.43Å; N223-L227 WeakPolarHBondContact O-CB 3.49Å; N223-L227 VanDerWaalsContact O-CG 3.31Å; N223-L227 WeakPolarHBondContact O-CG 3.46Å; N223-L227 PolarHBondContact O-N 3.47Å
224	V	87.4	Confident	84.4	Confident	85 Å²	85	105.1 Å²	105.1	52%	0.515	51%	0.513	S	S	.	.	H	α-helix	trans	-65.2	-42	174.9	169.8	0	0	0	0	111.2	I220 Q221 L222 L227 K228	I220-V224 HydrophobicContact CG2-CG2 4.31Å; I220-V224 VanDerWaalsContact O-CG2 3.3Å; I220-V224 WeakPolarHBondContact O-CG2 3.41Å; I220-V224 PolarHBondContact O-N 3.35Å; Q221-V224 PolarHBondContact O-N 3.13Å; L222-V224 VanDerWaalsContact C-N 3.32Å; L222-V224 PolarHBondContact O-N 3.04Å; V224-L227 PolarHBondContact O-N 3.35Å; V224-K228 WeakPolarHBondContact O-CB 3.29Å; V224-K228 PolarHBondContact O-N 3.49Å
225	K	85	Confident	83.1	Confident	135 Å²	135	106.9 Å²	106.9	59%	0.587	52%	0.519	S	S	*	.	H	α-helix	trans	-62	-44.2	175.1	-73	175.8	-178.3	-179.8	0	111.5	Q221 L222 K228 R229	Q221-K225 WeakPolarHBondContact O-CG 3.47Å; Q221-K225 PolarHBondContact O-N 3.32Å; L222-K225 WeakPolarHBondContact O-CB 3.32Å; L222-K225 PolarHBondContact O-N 3.26Å; L222-K225 VanDerWaalsContact O-N 3.17Å; K225-K228 PolarHBondContact O-N 3.16Å; K225-R229 PolarHBondContact O-N 2.85Å
226	E	83.5	Confident	81.6	Confident	87 Å²	87	111.1 Å²	111.1	41%	0.407	54%	0.535	S	S	.	.	H	α-helix	trans	-58.5	-48.6	175.5	-179.9	77.4	-155	0	0	111.4	L222 N223 K228 R229 K230	L222-E226 WeakPolarHBondContact O-CB 3.44Å; L222-E226 PolarHBondContact O-N 3.49Å; N223-E226 WeakPolarHBondContact O-CB 3.47Å; N223-E226 PolarHBondContact O-N 3.43Å; E226-K228 VanDerWaalsContact C-N 3.34Å; E226-K228 PolarHBondContact O-N 3.09Å; E226-R229 PolarHBondContact O-N 3.01Å; E226-K230 HydrophobicContact CG-CD 4.41Å; E226-K230 WeakPolarHBondContact O-CG 3.47Å; E226-K230 PolarHBondContact O-N 3.4Å; E226-K230 WeakPolarHBondContact OE1-CE 3.46Å; E226-K230 IonicContact OE1-NZ 2.73Å; E226-K230 PolarHBondContact OE1-NZ 3.29Å
227	L	82.2	Confident	79.2	Confident	112 Å²	112	113.3 Å²	113.3	59%	0.586	55%	0.549	S	S	*	.	H	α-helix	trans	-62.1	-40.2	176.4	-74.3	173.1	0	0	0	112	N223 V224 K230 L231	N223-L227 WeakPolarHBondContact O-CB 3.49Å; N223-L227 VanDerWaalsContact O-CG 3.31Å; N223-L227 WeakPolarHBondContact O-CG 3.46Å; N223-L227 PolarHBondContact O-N 3.47Å; V224-L227 PolarHBondContact O-N 3.35Å; L227-K230 PolarHBondContact O-N 2.9Å; L227-L231 WeakPolarHBondContact O-CB 3.38Å; L227-L231 PolarHBondContact O-N 3.21Å
228	K	85.9	Confident	76.9	Confident	129 Å²	129	113.6 Å²	113.6	56%	0.561	56%	0.557	S	S	*	*	H	α-helix	trans	-62.9	-43.6	176.3	-164.3	176.4	-179.3	-174.7	0	111.6	V224 K225 E226 K230 L231 E232	V224-K228 WeakPolarHBondContact O-CB 3.29Å; V224-K228 PolarHBondContact O-N 3.49Å; K225-K228 PolarHBondContact O-N 3.16Å; E226-K228 VanDerWaalsContact C-N 3.34Å; E226-K228 PolarHBondContact O-N 3.09Å; K228-K230 VanDerWaalsContact C-N 3.34Å; K228-K230 PolarHBondContact O-N 3.29Å; K228-L231 PolarHBondContact O-N 2.84Å; K228-E232 PolarHBondContact O-N 3.4Å
229	R	77	Confident	74.4	Confident	168 Å²	168	116.5 Å²	116.5	63%	0.634	57%	0.574	S	S	*	*	H	α-helix	trans	-63.2	-37.6	173.5	-70.3	-177.3	95	101.4	-4.6	112.4	K225 E226 R233	K225-R229 PolarHBondContact O-N 2.85Å; E226-R229 PolarHBondContact O-N 3.01Å; R229-R233 WeakPolarHBondContact O-CB 3.4Å; R229-R233 WeakPolarHBondContact O-CG 3.19Å; R229-R233 PolarHBondContact O-N 3.15Å; R229-R233 PolarHBondContact O-NE 2.91Å
230	K	80.9	Confident	71.7	Confident	107 Å²	107	118.7 Å²	118.7	47%	0.465	58%	0.584	S	S	.	*	H	α-helix	trans	-66.3	-42.1	174.7	-73.5	171.4	-178.8	163	0	111.4	E226 L227 K228 R233 A234	E226-K230 HydrophobicContact CG-CD 4.41Å; E226-K230 WeakPolarHBondContact O-CG 3.47Å; E226-K230 PolarHBondContact O-N 3.4Å; E226-K230 WeakPolarHBondContact OE1-CE 3.46Å; E226-K230 IonicContact OE1-NZ 2.73Å; E226-K230 PolarHBondContact OE1-NZ 3.29Å; L227-K230 PolarHBondContact O-N 2.9Å; K228-K230 VanDerWaalsContact C-N 3.34Å; K228-K230 PolarHBondContact O-N 3.29Å; K230-R233 PolarHBondContact O-N 3.09Å; K230-A234 WeakPolarHBondContact O-CB 3.35Å; K230-A234 PolarHBondContact O-N 3.38Å
231	L	83.3	Confident	69	Low	96 Å²	96	122 Å²	122	50%	0.503	60%	0.597	S	S	.	*	H	α-helix	trans	-64.2	-42.7	176.4	-179.2	65.4	0	0	0	112.1	L227 K228 A234 K235	L227-L231 WeakPolarHBondContact O-CB 3.38Å; L227-L231 PolarHBondContact O-N 3.21Å; K228-L231 PolarHBondContact O-N 2.84Å; L231-A234 WeakPolarHBondContact O-CB 3.45Å; L231-A234 PolarHBondContact O-N 2.86Å; L231-K235 WeakPolarHBondContact O-CG 3.48Å; L231-K235 PolarHBondContact O-N 2.83Å
232	E	75.2	Confident	66.4	Low	100 Å²	100	124.5 Å²	124.5	47%	0.467	61%	0.609	S	S	.	*	H	α-helix	trans	-64.6	-42.3	175.6	-77.7	172.3	-172	0	0	112.1	K228 A234 K235 L236	K228-E232 PolarHBondContact O-N 3.4Å; E232-A234 VanDerWaalsContact C-N 3.29Å; E232-A234 PolarHBondContact O-N 3.26Å; E232-K235 PolarHBondContact O-N 3.37Å; E232-L236 PolarHBondContact O-N 2.76Å; E232-L236 VanDerWaalsContact O-N 3.09Å
233	R	71.6	Confident	64.1	Low	139 Å²	139	124.6 Å²	124.6	53%	0.525	61%	0.61	S	S	.	*	H	α-helix	trans	-59.3	-40.4	171.9	-78.3	-174.2	-87.4	-154.2	0.2	112.1	R229 K230 L236 L237	R229-R233 WeakPolarHBondContact O-CB 3.4Å; R229-R233 WeakPolarHBondContact O-CG 3.19Å; R229-R233 PolarHBondContact O-N 3.15Å; R229-R233 PolarHBondContact O-NE 2.91Å; K230-R233 PolarHBondContact O-N 3.09Å; R233-L236 PolarHBondContact O-N 3.22Å; R233-L237 PolarHBondContact O-N 3.39Å
234	A	68.2	Low	61.6	Low	52 Å²	52	128 Å²	128	43%	0.43	62%	0.623	S	S	.	*	H	α-helix	trans	-65.9	-40	175.8	0	0	0	0	0	112.3	K230 L231 E232 L236 L237	K230-A234 WeakPolarHBondContact O-CB 3.35Å; K230-A234 PolarHBondContact O-N 3.38Å; L231-A234 WeakPolarHBondContact O-CB 3.45Å; L231-A234 PolarHBondContact O-N 2.86Å; E232-A234 VanDerWaalsContact C-N 3.29Å; E232-A234 PolarHBondContact O-N 3.26Å; A234-L236 VanDerWaalsContact C-N 3.29Å; A234-L236 PolarHBondContact O-N 2.91Å; A234-L237 PolarHBondContact O-N 3.12Å
235	K	64.9	Low	59.6	Low	143 Å²	143	127.5 Å²	127.5	62%	0.622	63%	0.628	S	S	*	*	H	α-helix	trans	-62.6	-34.4	176.4	-74.4	176.1	179.7	-179.2	0	112.7	L231 E232 L237	L231-K235 WeakPolarHBondContact O-CG 3.48Å; L231-K235 PolarHBondContact O-N 2.83Å; E232-K235 PolarHBondContact O-N 3.37Å; K235-L237 VanDerWaalsContact C-N 3.31Å
236	L	56.3	Low	57.7	Low	153 Å²	153	123.9 Å²	123.9	80%	0.801	61%	0.613	S	S	*	*	H	α-helix	trans	-75.5	-17.8	178.4	-71.6	167.4	0	0	0	113.6	E232 R233 A234	E232-L236 PolarHBondContact O-N 2.76Å; E232-L236 VanDerWaalsContact O-N 3.09Å; R233-L236 PolarHBondContact O-N 3.22Å; A234-L236 VanDerWaalsContact C-N 3.29Å; A234-L236 PolarHBondContact O-N 2.91Å
237	L	42.9	Very low	56	Low	144 Å²	144	122 Å²	122	75%	0.754	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.9	22.9	-178.9	-86	162.9	0	0	0	113.4	R233 A234 K235 P239	R233-L237 PolarHBondContact O-N 3.39Å; A234-L237 PolarHBondContact O-N 3.12Å; K235-L237 VanDerWaalsContact C-N 3.31Å; L237-P239 WeakPolarHBondContact O-CD 3.36Å
238	L	42	Very low	54.1	Low	138 Å²	138	122.9 Å²	122.9	72%	0.723	62%	0.617	S	S	*	*			trans	-95.9	105.6	175.5	-107.2	103.6	0	0	0	112.2	Q240	L238-Q240 PolarHBondContact O-N 2.89Å
239	P	32.3	Very low	52.9	Low	125 Å²	125	121 Å²	121	81%	0.812	61%	0.61	S	S	*	*			trans	-57.1	116.1	164.6	-29.7	34.5	0	0	0	113.2	L237 Q241	L237-P239 WeakPolarHBondContact O-CD 3.36Å; P239-Q241 PolarHBondContact O-N 3.48Å
240	Q	33.3	Very low	52	Low	170 Å²	170	117.6 Å²	117.6	79%	0.794	60%	0.604	S	S	*	*			trans	-83.4	84.6	-178.3	-177.4	-178.4	49.8	0	0	111.2	L238	L238-Q240 PolarHBondContact O-N 2.89Å
241	Q	31.1	Very low	51.1	Low	176 Å²	176	114.3 Å²	114.3	82%	0.822	60%	0.601	S	S	*	*			trans	-152.7	75.7	167.5	-72.9	-166.5	1.9	0	0	112.9	P239	P239-Q241 PolarHBondContact O-N 3.48Å
242	Q	35.9	Very low	50.4	Low	155 Å²	155	117.3 Å²	117.3	72%	0.724	61%	0.61	S	S	*	*			trans	-165.1	51.4	155.8	-107.1	148.2	33.5	0	0	114	Q244 E246	Q242-Q244 VanDerWaalsContact C-N 3.28Å; Q242-Q244 PolarHBondContact O-N 3.43Å; Q242-E246 WeakPolarHBondContact O-CG 3.41Å
243	L	37.9	Very low	50	Low	118 Å²	118	116.5 Å²	116.5	62%	0.618	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.5	11.6	-170.5	-93.6	160	0	0	0	119.1	E246	L243-E246 WeakPolarHBondContact CD2-OE2 3.34Å; L243-E246 WeakPolarHBondContact CG-OE2 3.49Å
244	Q	35.9	Very low	50.1	Low	155 Å²	155	116.1 Å²	116.1	72%	0.724	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-123.2	-27.4	177.2	-161.4	64.6	37.7	0	0	114.4	Q242 A247	Q242-Q244 VanDerWaalsContact C-N 3.28Å; Q242-Q244 PolarHBondContact O-N 3.43Å; Q244-A247 PolarHBondContact O-N 3.43Å
245	A	46.2	Very low	50.3	Low	75 Å²	75	120.7 Å²	120.7	62%	0.62	63%	0.626	S	S	*	*	H	α-helix	trans	-67.4	-27.7	158.7	0	0	0	0	0	110.3	A247 H249	A245-A247 VanDerWaalsContact C-N 3.29Å; A245-A247 PolarHBondContact O-N 3.16Å; A245-H249 WeakPolarHBondContact O-CB 3.31Å; A245-H249 PolarHBondContact O-N 3.1Å
246	E	45.9	Very low	50.8	Low	60 Å²	60	116 Å²	116	28%	0.28	61%	0.612	S	S	.	*	H	α-helix	trans	-60.8	-26.5	174.2	-76.7	170.1	-151.2	0	0	113.3	Q242 L243 H249 L250	Q242-E246 WeakPolarHBondContact O-CG 3.41Å; L243-E246 WeakPolarHBondContact CD2-OE2 3.34Å; L243-E246 WeakPolarHBondContact CG-OE2 3.49Å; E246-H249 CarbonylContact O-C 3.55Å; E246-L250 VanDerWaalsContact O-CA 3.31Å; E246-L250 WeakPolarHBondContact O-CA 3.48Å; E246-L250 WeakPolarHBondContact O-CB 3.46Å; E246-L250 VanDerWaalsContact O-CD1 3.31Å; E246-L250 WeakPolarHBondContact O-CD1 3.46Å; E246-L250 WeakPolarHBondContact O-CG 3.44Å; E246-L250 PolarHBondContact O-N 3.03Å
247	A	46.1	Very low	51.6	Low	47 Å²	47	112.4 Å²	112.4	39%	0.388	60%	0.596	S	S	.	*	H	α-helix	trans	-72.6	-44.5	-179.1	0	0	0	0	0	113.5	Q244 A245 L250 G251	Q244-A247 PolarHBondContact O-N 3.43Å; A245-A247 VanDerWaalsContact C-N 3.29Å; A245-A247 PolarHBondContact O-N 3.16Å; A247-L250 PolarHBondContact O-N 3.2Å; A247-G251 PolarHBondContact O-N 2.97Å
248	D	44.1	Very low	53.1	Low	130 Å²	130	108.9 Å²	108.9	70%	0.695	58%	0.583	S	S	*	*	H	α-helix	trans	-76.3	-33.1	176	-69.3	-32.2	0	0	0	111.6	L250 G251 K252	D248-L250 VanDerWaalsContact C-N 3.35Å; D248-G251 PolarHBondContact O-N 3.39Å; D248-K252 PolarHBondContact O-N 3.44Å; D248-K252 VanDerWaalsContact O-N 3.08Å
249	H	59	Low	54.8	Low	90 Å²	90	105.2 Å²	105.2	42%	0.417	57%	0.573	S	S	.	*	H	α-helix	trans	-60.8	-43.4	165.6	167.1	-53.9	0	0	0	110.7	A245 E246 G251 K252 E253	A245-H249 WeakPolarHBondContact O-CB 3.31Å; A245-H249 PolarHBondContact O-N 3.1Å; E246-H249 CarbonylContact O-C 3.55Å; H249-G251 VanDerWaalsContact C-N 3.32Å; H249-G251 PolarHBondContact O-N 2.96Å; H249-K252 CarbonylContact O-C 3.6Å; H249-K252 PolarHBondContact O-N 2.76Å; H249-E253 VanDerWaalsContact CE1-CG 3.49Å; H249-E253 WeakPolarHBondContact CE1-CG 3.42Å; H249-E253 IonicContact CE1-OE1 3.19Å; H249-E253 PolarHBondContact CE1-OE1 3.49Å; H249-E253 IonicContact CE1-OE2 3.99Å; H249-E253 PolarHBondContact CE1-OE2 2.85Å; H249-E253 VanDerWaalsContact ND1-CD 3.32Å; H249-E253 WeakPolarHBondContact ND1-CG 3.45Å; H249-E253 IonicContact ND1-OE1 3.91Å; H249-E253 IonicContact ND1-OE2 2.92Å; H249-E253 PolarHBondContact ND1-OE2 3.16Å; H249-E253 IonicContact NE2-OE1 3.68Å; H249-E253 WeakPolarHBondContact O-CA 3.42Å; H249-E253 VanDerWaalsContact O-CB 3.23Å; H249-E253 WeakPolarHBondContact O-CB 3.35Å; H249-E253 WeakPolarHBondContact O-CG 3.34Å; H249-E253 PolarHBondContact O-N 3.33Å
250	L	60.1	Low	57.2	Low	96 Å²	96	105.3 Å²	105.3	50%	0.503	56%	0.56	S	S	.	*	H	α-helix	trans	-66.3	-34.7	178.2	-82.1	166.3	0	0	0	110.5	E246 A247 D248 E253 L254	E246-L250 VanDerWaalsContact O-CA 3.31Å; E246-L250 WeakPolarHBondContact O-CA 3.48Å; E246-L250 WeakPolarHBondContact O-CB 3.46Å; E246-L250 VanDerWaalsContact O-CD1 3.31Å; E246-L250 WeakPolarHBondContact O-CD1 3.46Å; E246-L250 WeakPolarHBondContact O-CG 3.44Å; E246-L250 PolarHBondContact O-N 3.03Å; A247-L250 PolarHBondContact O-N 3.2Å; D248-L250 VanDerWaalsContact C-N 3.35Å; L250-E253 CarbonylContact O-C 3.51Å; L250-E253 PolarHBondContact O-N 2.76Å; L250-L254 WeakPolarHBondContact O-CA 3.23Å; L250-L254 WeakPolarHBondContact O-CB 3.37Å; L250-L254 PolarHBondContact O-N 3.23Å
251	G	60.1	Low	59.3	Low	38 Å²	38	102.2 Å²	102.2	39%	0.392	55%	0.549	S	S	.	.	H	α-helix	trans	-64.3	-45.6	172.2	0	0	0	0	0	112.6	A247 D248 H249 E253 L254 Q255	A247-G251 PolarHBondContact O-N 2.97Å; D248-G251 PolarHBondContact O-N 3.39Å; H249-G251 VanDerWaalsContact C-N 3.32Å; H249-G251 PolarHBondContact O-N 2.96Å; G251-E253 VanDerWaalsContact C-N 3.33Å; G251-L254 PolarHBondContact O-N 3.46Å; G251-Q255 PolarHBondContact O-N 3.39Å
252	K	69	Low	61.8	Low	160 Å²	160	99.2 Å²	99.2	70%	0.696	54%	0.535	S	S	*	.	H	α-helix	trans	-68.4	-32.6	173.3	-71.7	178.3	-177.7	174.6	0	112.5	D248 H249 S256	D248-K252 PolarHBondContact O-N 3.44Å; D248-K252 VanDerWaalsContact O-N 3.08Å; H249-K252 CarbonylContact O-C 3.6Å; H249-K252 PolarHBondContact O-N 2.76Å; K252-S256 WeakPolarHBondContact O-CB 3.38Å; K252-S256 PolarHBondContact O-N 2.88Å
253	E	67.2	Low	64	Low	83 Å²	83	94.2 Å²	94.2	39%	0.388	52%	0.52	S	S	.	.	H	α-helix	trans	-74.6	-34.5	174.7	-82.1	-153.4	153	0	0	111.6	H249 L250 G251 Q255 S256 V257	H249-E253 VanDerWaalsContact CE1-CG 3.49Å; H249-E253 WeakPolarHBondContact CE1-CG 3.42Å; H249-E253 IonicContact CE1-OE1 3.19Å; H249-E253 PolarHBondContact CE1-OE1 3.49Å; H249-E253 IonicContact CE1-OE2 3.99Å; H249-E253 PolarHBondContact CE1-OE2 2.85Å; H249-E253 VanDerWaalsContact ND1-CD 3.32Å; H249-E253 WeakPolarHBondContact ND1-CG 3.45Å; H249-E253 IonicContact ND1-OE1 3.91Å; H249-E253 IonicContact ND1-OE2 2.92Å; H249-E253 PolarHBondContact ND1-OE2 3.16Å; H249-E253 IonicContact NE2-OE1 3.68Å; H249-E253 WeakPolarHBondContact O-CA 3.42Å; H249-E253 VanDerWaalsContact O-CB 3.23Å; H249-E253 WeakPolarHBondContact O-CB 3.35Å; H249-E253 WeakPolarHBondContact O-CG 3.34Å; H249-E253 PolarHBondContact O-N 3.33Å; L250-E253 CarbonylContact O-C 3.51Å; L250-E253 PolarHBondContact O-N 2.76Å; G251-E253 VanDerWaalsContact C-N 3.33Å; E253-Q255 VanDerWaalsContact C-N 3.33Å; E253-S256 CarbonylContact O-C 3.59Å; E253-S256 PolarHBondContact O-N 2.8Å; E253-V257 WeakPolarHBondContact O-CA 3.45Å; E253-V257 WeakPolarHBondContact O-CB 3.49Å; E253-V257 WeakPolarHBondContact O-CG2 3.41Å; E253-V257 PolarHBondContact O-N 3.05Å
254	L	72.9	Confident	66.1	Low	130 Å²	130	94.3 Å²	94.3	68%	0.681	52%	0.517	S	S	*	.	H	α-helix	trans	-67	-40.7	173.9	-163.4	88	0	0	0	109.5	L250 G251 V257 S258	L250-L254 WeakPolarHBondContact O-CA 3.23Å; L250-L254 WeakPolarHBondContact O-CB 3.37Å; L250-L254 PolarHBondContact O-N 3.23Å; G251-L254 PolarHBondContact O-N 3.46Å; L254-V257 PolarHBondContact O-N 3.44Å; L254-S258 WeakPolarHBondContact O-CB 3.31Å; L254-S258 PolarHBondContact O-N 3.22Å
255	Q	72.5	Confident	68.2	Low	148 Å²	148	90.2 Å²	90.2	69%	0.692	50%	0.503	S	S	*	.	H	α-helix	trans	-66.1	-40.3	171.3	-75.7	-175	-7	0	0	112.1	G251 E253 A259	G251-Q255 PolarHBondContact O-N 3.39Å; E253-Q255 VanDerWaalsContact C-N 3.33Å; Q255-A259 VanDerWaalsContact O-CB 3.23Å; Q255-A259 WeakPolarHBondContact O-CB 3.24Å; Q255-A259 PolarHBondContact O-N 2.9Å
256	S	76.7	Confident	69.8	Low	46 Å²	46	91.2 Å²	91.2	32%	0.322	49%	0.494	S	S	.	.	H	α-helix	trans	-65.8	-39.5	174.7	176.8	0	0	0	0	111.9	K252 E253 A259 K260	K252-S256 WeakPolarHBondContact O-CB 3.38Å; K252-S256 PolarHBondContact O-N 2.88Å; E253-S256 CarbonylContact O-C 3.59Å; E253-S256 PolarHBondContact O-N 2.8Å; S256-A259 CarbonylContact O-C 3.52Å; S256-A259 PolarHBondContact O-N 2.79Å; S256-K260 VanDerWaalsContact O-CB 3.28Å; S256-K260 WeakPolarHBondContact O-CB 3.4Å; S256-K260 WeakPolarHBondContact O-CD 3.44Å; S256-K260 WeakPolarHBondContact O-CG 3.45Å; S256-K260 PolarHBondContact O-N 3.35Å; S256-K260 WeakPolarHBondContact OG-CE 3.43Å; S256-K260 PolarHBondContact OG-NZ 3.5Å
257	V	72.9	Confident	71.6	Confident	77 Å²	77	94.5 Å²	94.5	47%	0.467	51%	0.51	S	S	.	.	H	α-helix	trans	-72.5	-40.2	178.5	167.9	0	0	0	0	109.3	E253 L254 K260 L261	E253-V257 WeakPolarHBondContact O-CA 3.45Å; E253-V257 WeakPolarHBondContact O-CB 3.49Å; E253-V257 WeakPolarHBondContact O-CG2 3.41Å; E253-V257 PolarHBondContact O-N 3.05Å; L254-V257 PolarHBondContact O-N 3.44Å; V257-K260 CarbonylContact O-C 3.53Å; V257-K260 PolarHBondContact O-N 3.34Å; V257-L261 WeakPolarHBondContact O-CB 3.34Å; V257-L261 PolarHBondContact O-N 2.95Å
258	S	74.2	Confident	73.5	Confident	70 Å²	70	96.5 Å²	96.5	49%	0.49	51%	0.514	S	S	.	.	H	α-helix	trans	-61.7	-45.2	171	-176.8	0	0	0	0	110.6	L254 K260 L261 Q262	L254-S258 WeakPolarHBondContact O-CB 3.31Å; L254-S258 PolarHBondContact O-N 3.22Å; S258-K260 VanDerWaalsContact C-N 3.35Å; S258-K260 PolarHBondContact O-N 3.08Å; S258-L261 PolarHBondContact O-N 3.36Å; S258-Q262 WeakPolarHBondContact O-CB 3.37Å; S258-Q262 PolarHBondContact O-N 3.08Å
259	A	78.4	Confident	75.4	Confident	61 Å²	61	94.9 Å²	94.9	50%	0.504	50%	0.502	S	S	.	.	H	α-helix	trans	-64.6	-36.5	173.7	0	0	0	0	0	112.5	Q255 S256 A263	Q255-A259 VanDerWaalsContact O-CB 3.23Å; Q255-A259 WeakPolarHBondContact O-CB 3.24Å; Q255-A259 PolarHBondContact O-N 2.9Å; S256-A259 CarbonylContact O-C 3.52Å; S256-A259 PolarHBondContact O-N 2.79Å; A259-A263 WeakPolarHBondContact O-CB 3.24Å; A259-A263 PolarHBondContact O-N 2.86Å
260	K	81.2	Confident	76.7	Confident	127 Å²	127	95.8 Å²	95.8	55%	0.552	51%	0.509	S	S	*	.	H	α-helix	trans	-69.5	-39.6	174.3	-77	164.3	-179	170.2	0	111.4	S256 V257 S258 A263 Q264	S256-K260 VanDerWaalsContact O-CB 3.28Å; S256-K260 WeakPolarHBondContact O-CB 3.4Å; S256-K260 WeakPolarHBondContact O-CD 3.44Å; S256-K260 WeakPolarHBondContact O-CG 3.45Å; S256-K260 PolarHBondContact O-N 3.35Å; S256-K260 WeakPolarHBondContact OG-CE 3.43Å; S256-K260 PolarHBondContact OG-NZ 3.5Å; V257-K260 CarbonylContact O-C 3.53Å; V257-K260 PolarHBondContact O-N 3.34Å; S258-K260 VanDerWaalsContact C-N 3.35Å; S258-K260 PolarHBondContact O-N 3.08Å; K260-A263 PolarHBondContact O-N 3.44Å; K260-Q264 WeakPolarHBondContact O-CB 3.44Å; K260-Q264 PolarHBondContact O-N 3.34Å
261	L	78.6	Confident	77.9	Confident	105 Å²	105	98.6 Å²	98.6	55%	0.55	51%	0.514	S	S	.	.	H	α-helix	trans	-68.4	-44.1	177.3	-168.5	81.9	0	0	0	109.7	V257 S258 Q264 V265	V257-L261 WeakPolarHBondContact O-CB 3.34Å; V257-L261 PolarHBondContact O-N 2.95Å; S258-L261 PolarHBondContact O-N 3.36Å; L261-Q264 CarbonylContact O-C 3.59Å; L261-Q264 PolarHBondContact O-N 2.91Å; L261-V265 VanDerWaalsContact O-CG2 3.3Å; L261-V265 WeakPolarHBondContact O-CG2 3.49Å; L261-V265 PolarHBondContact O-N 2.95Å
262	Q	82.6	Confident	79.1	Confident	113 Å²	113	100.3 Å²	100.3	53%	0.528	51%	0.514	S	S	.	.	H	α-helix	trans	-58.8	-49.4	172.1	-173.5	80.1	26.5	0	0	110.4	S258 Q264 V265 E266	S258-Q262 WeakPolarHBondContact O-CB 3.37Å; S258-Q262 PolarHBondContact O-N 3.08Å; Q262-Q264 VanDerWaalsContact C-N 3.28Å; Q262-Q264 PolarHBondContact O-N 2.94Å; Q262-V265 PolarHBondContact O-N 3.41Å; Q262-E266 WeakPolarHBondContact O-CB 3.41Å; Q262-E266 WeakPolarHBondContact O-CG 3.46Å; Q262-E266 PolarHBondContact O-N 3.37Å
263	A	82.1	Confident	80	Confident	50 Å²	50	98.7 Å²	98.7	41%	0.413	50%	0.503	S	S	.	.	H	α-helix	trans	-61.8	-35.8	175.8	0	0	0	0	0	112.1	A259 K260 E266 E267	A259-A263 WeakPolarHBondContact O-CB 3.24Å; A259-A263 PolarHBondContact O-N 2.86Å; K260-A263 PolarHBondContact O-N 3.44Å; A263-E266 PolarHBondContact O-N 3.4Å; A263-E267 VanDerWaalsContact O-CB 3.23Å; A263-E267 WeakPolarHBondContact O-CB 3.34Å; A263-E267 PolarHBondContact O-N 3.01Å
264	Q	81.7	Confident	81	Confident	119 Å²	119	99.4 Å²	99.4	56%	0.556	51%	0.509	S	S	*	.	H	α-helix	trans	-72.3	-35	177	-163	-175.9	15.2	0	0	111.8	K260 L261 Q262 E267 N268	K260-Q264 WeakPolarHBondContact O-CB 3.44Å; K260-Q264 PolarHBondContact O-N 3.34Å; L261-Q264 CarbonylContact O-C 3.59Å; L261-Q264 PolarHBondContact O-N 2.91Å; Q262-Q264 VanDerWaalsContact C-N 3.28Å; Q262-Q264 PolarHBondContact O-N 2.94Å; Q264-E267 PolarHBondContact O-N 3.26Å; Q264-N268 VanDerWaalsContact O-CB 3.28Å; Q264-N268 WeakPolarHBondContact O-CB 3.11Å; Q264-N268 PolarHBondContact O-N 2.86Å
265	V	80.4	Confident	81.8	Confident	70 Å²	70	95.5 Å²	95.5	42%	0.424	49%	0.489	S	S	.	.	H	α-helix	trans	-66.5	-45.3	171.7	169.6	0	0	0	0	109.8	L261 Q262 E267 N268 E269	L261-V265 VanDerWaalsContact O-CG2 3.3Å; L261-V265 WeakPolarHBondContact O-CG2 3.49Å; L261-V265 PolarHBondContact O-N 2.95Å; Q262-V265 PolarHBondContact O-N 3.41Å; V265-E267 VanDerWaalsContact C-N 3.34Å; V265-E267 PolarHBondContact O-N 3.12Å; V265-N268 CarbonylContact O-C 3.49Å; V265-N268 PolarHBondContact O-N 3.18Å; V265-N268 VanDerWaalsContact O-N 3.17Å; V265-E269 WeakPolarHBondContact O-CG 3.48Å; V265-E269 PolarHBondContact O-N 3.45Å
266	E	81.1	Confident	82.5	Confident	95 Å²	95	93.8 Å²	93.8	44%	0.444	48%	0.481	S	S	.	.	H	α-helix	trans	-62.4	-40.1	174.7	-72.3	173.1	-166.9	0	0	111.7	Q262 A263 N268 E269 L270	Q262-E266 WeakPolarHBondContact O-CB 3.41Å; Q262-E266 WeakPolarHBondContact O-CG 3.46Å; Q262-E266 PolarHBondContact O-N 3.37Å; A263-E266 PolarHBondContact O-N 3.4Å; E266-N268 VanDerWaalsContact C-N 3.34Å; E266-E269 PolarHBondContact O-N 2.86Å; E266-L270 WeakPolarHBondContact O-CB 3.43Å; E266-L270 VanDerWaalsContact O-CG 3.23Å; E266-L270 WeakPolarHBondContact O-CG 3.42Å; E266-L270 PolarHBondContact O-N 3.44Å
267	E	82.8	Confident	83	Confident	130 Å²	130	96.7 Å²	96.7	61%	0.607	49%	0.489	S	S	*	.	H	α-helix	trans	-61.1	-42.5	172.4	-176.8	-179.3	-173.2	0	0	111.2	A263 Q264 V265 L270 W271	A263-E267 VanDerWaalsContact O-CB 3.23Å; A263-E267 WeakPolarHBondContact O-CB 3.34Å; A263-E267 PolarHBondContact O-N 3.01Å; Q264-E267 PolarHBondContact O-N 3.26Å; V265-E267 VanDerWaalsContact C-N 3.34Å; V265-E267 PolarHBondContact O-N 3.12Å; E267-L270 PolarHBondContact O-N 3.05Å; E267-W271 WeakPolarHBondContact O-CB 3.35Å; E267-W271 PolarHBondContact O-N 3.01Å
268	N	85.6	Confident	83.7	Confident	88 Å²	88	98.6 Å²	98.6	47%	0.471	49%	0.493	S	S	.	.	H	α-helix	trans	-68.7	-38.5	177.6	-152.1	-35.4	0	0	0	111.4	Q264 V265 E266 W271 N272	Q264-N268 VanDerWaalsContact O-CB 3.28Å; Q264-N268 WeakPolarHBondContact O-CB 3.11Å; Q264-N268 PolarHBondContact O-N 2.86Å; V265-N268 CarbonylContact O-C 3.49Å; V265-N268 PolarHBondContact O-N 3.18Å; V265-N268 VanDerWaalsContact O-N 3.17Å; E266-N268 VanDerWaalsContact C-N 3.34Å; N268-W271 PolarHBondContact O-N 3.48Å; N268-N272 WeakPolarHBondContact O-CB 3.4Å; N268-N272 PolarHBondContact O-N 3.04Å; N268-N272 PolarHBondContact O-ND2 3.43Å; N268-N272 PolarHBondContact OD1-ND2 3.32Å
269	E	83.4	Confident	84.3	Confident	97 Å²	97	100.6 Å²	100.6	45%	0.453	50%	0.495	S	S	.	.	H	α-helix	trans	-65.2	-37.5	171.5	-73	-178.4	-179.6	0	0	112.8	V265 E266 R273	V265-E269 WeakPolarHBondContact O-CG 3.48Å; V265-E269 PolarHBondContact O-N 3.45Å; E266-E269 PolarHBondContact O-N 2.86Å; E269-R273 WeakPolarHBondContact O-CB 3.44Å; E269-R273 WeakPolarHBondContact O-CG 3.46Å; E269-R273 PolarHBondContact O-N 3.44Å; E269-R273 PolarHBondContact O-NE 2.87Å; E269-R273 IonicContact OE2-NH2 3.75Å
270	L	86.9	Confident	84.7	Confident	108 Å²	108	103.1 Å²	103.1	57%	0.565	50%	0.496	S	S	*	.	H	α-helix	trans	-65.8	-41.5	172.7	-73.9	169.8	0	0	0	110.8	E266 E267 R273 L274	E266-L270 WeakPolarHBondContact O-CB 3.43Å; E266-L270 VanDerWaalsContact O-CG 3.23Å; E266-L270 WeakPolarHBondContact O-CG 3.42Å; E266-L270 PolarHBondContact O-N 3.44Å; E267-L270 PolarHBondContact O-N 3.05Å; L270-R273 PolarHBondContact O-N 3.4Å; L270-L274 WeakPolarHBondContact O-CB 3.41Å; L270-L274 PolarHBondContact O-N 3.15Å
271	W	85.8	Confident	85.1	Confident	156 Å²	156	103.1 Å²	103.1	59%	0.591	50%	0.496	S	S	*	.	H	α-helix	trans	-64.6	-44.2	176.3	-167.6	84.3	0	0	0	111.6	E267 N268 R273 L274 N275	E267-W271 WeakPolarHBondContact O-CB 3.35Å; E267-W271 PolarHBondContact O-N 3.01Å; N268-W271 PolarHBondContact O-N 3.48Å; W271-R273 PolarHBondContact O-N 2.99Å; W271-L274 WeakPolarHBondContact O-CB 3.27Å; W271-L274 PolarHBondContact O-N 3.36Å; W271-N275 WeakPolarHBondContact O-CB 3.36Å; W271-N275 PolarHBondContact O-N 2.88Å
272	N	85	Confident	85.3	Confident	74 Å²	74	103.6 Å²	103.6	40%	0.396	50%	0.497	S	S	.	.	H	α-helix	trans	-62.4	-41.2	175	-72.2	-38.7	0	0	0	111.9	N268 N275 Q276	N268-N272 WeakPolarHBondContact O-CB 3.4Å; N268-N272 PolarHBondContact O-N 3.04Å; N268-N272 PolarHBondContact O-ND2 3.43Å; N268-N272 PolarHBondContact OD1-ND2 3.32Å; N272-N275 PolarHBondContact O-N 2.87Å; N272-Q276 WeakPolarHBondContact O-CB 3.5Å; N272-Q276 WeakPolarHBondContact O-CG 3.44Å; N272-Q276 PolarHBondContact O-N 2.93Å
273	R	87.3	Confident	85.6	Confident	125 Å²	125	106.2 Å²	106.2	47%	0.472	50%	0.502	S	S	.	.	H	α-helix	trans	-64.4	-40.1	173.3	-80.5	-178.3	-78.7	-141.1	-5.5	112.2	E269 L270 W271 Q277	E269-R273 WeakPolarHBondContact O-CB 3.44Å; E269-R273 WeakPolarHBondContact O-CG 3.46Å; E269-R273 PolarHBondContact O-N 3.44Å; E269-R273 PolarHBondContact O-NE 2.87Å; E269-R273 IonicContact OE2-NH2 3.75Å; L270-R273 PolarHBondContact O-N 3.4Å; W271-R273 PolarHBondContact O-N 2.99Å; R273-Q277 WeakPolarHBondContact O-CB 3.44Å; R273-Q277 WeakPolarHBondContact O-CG 3.45Å; R273-Q277 PolarHBondContact O-N 3.25Å
274	L	89.6	Confident	85.9	Confident	98 Å²	98	111 Å²	111	51%	0.513	51%	0.509	S	S	.	.	H	α-helix	trans	-65.9	-41.6	176.8	-175.6	65.5	0	0	0	111.2	L270 W271 Q277 Q278	L270-L274 WeakPolarHBondContact O-CB 3.41Å; L270-L274 PolarHBondContact O-N 3.15Å; W271-L274 WeakPolarHBondContact O-CB 3.27Å; W271-L274 PolarHBondContact O-N 3.36Å; L274-Q277 PolarHBondContact O-N 3.18Å; L274-Q278 PolarHBondContact O-N 3.29Å
275	N	88	Confident	86	Confident	48 Å²	48	111 Å²	111	26%	0.257	51%	0.509	S	S	.	.	H	α-helix	trans	-64.8	-46.1	176.6	-168.5	58.4	0	0	0	111.2	W271 N272 Q277 Q278 E279	W271-N275 WeakPolarHBondContact O-CB 3.36Å; W271-N275 PolarHBondContact O-N 2.88Å; N272-N275 PolarHBondContact O-N 2.87Å; N275-Q277 VanDerWaalsContact C-N 3.31Å; N275-Q277 PolarHBondContact O-N 2.8Å; N275-Q278 CarbonylContact O-C 3.55Å; N275-Q278 WeakPolarHBondContact O-CA 3.42Å; N275-Q278 WeakPolarHBondContact O-CB 3.39Å; N275-Q278 PolarHBondContact O-N 3.03Å; N275-E279 PolarHBondContact ND2-OE1 3.29Å; N275-E279 PolarHBondContact O-N 3.46Å
276	Q	88	Confident	86.3	Confident	112 Å²	112	112 Å²	112	52%	0.523	51%	0.509	S	S	.	.	H	α-helix	trans	-57.8	-42.4	172.4	-78.8	178.5	-10.8	0	0	112.1	N272 Q278 E279 E280	N272-Q276 WeakPolarHBondContact O-CB 3.5Å; N272-Q276 WeakPolarHBondContact O-CG 3.44Å; N272-Q276 PolarHBondContact O-N 2.93Å; Q276-Q278 VanDerWaalsContact C-N 3.28Å; Q276-Q278 PolarHBondContact O-N 3.17Å; Q276-E279 PolarHBondContact O-N 3.48Å; Q276-E280 WeakPolarHBondContact O-CB 3.34Å; Q276-E280 WeakPolarHBondContact O-CG 3.45Å; Q276-E280 PolarHBondContact O-N 2.89Å
277	Q	88.4	Confident	86.5	Confident	107 Å²	107	111.3 Å²	111.3	50%	0.5	51%	0.506	S	S	.	.	H	α-helix	trans	-65	-30.2	174.9	-76.7	-174.6	6.5	0	0	113.2	R273 L274 N275 K281	R273-Q277 WeakPolarHBondContact O-CB 3.44Å; R273-Q277 WeakPolarHBondContact O-CG 3.45Å; R273-Q277 PolarHBondContact O-N 3.25Å; L274-Q277 PolarHBondContact O-N 3.18Å; N275-Q277 VanDerWaalsContact C-N 3.31Å; N275-Q277 PolarHBondContact O-N 2.8Å; Q277-K281 WeakPolarHBondContact O-CB 3.35Å; Q277-K281 WeakPolarHBondContact O-CD 3.44Å; Q277-K281 WeakPolarHBondContact O-CG 3.42Å; Q277-K281 PolarHBondContact O-N 2.85Å
278	Q	86.6	Confident	87	Confident	118 Å²	118	111.4 Å²	111.4	55%	0.551	51%	0.505	S	S	*	.	H	α-helix	trans	-73.3	-45.6	173.7	-106.4	-177	-25.6	0	0	111.6	L274 N275 Q276 E280 K281 M282	L274-Q278 PolarHBondContact O-N 3.29Å; N275-Q278 CarbonylContact O-C 3.55Å; N275-Q278 WeakPolarHBondContact O-CA 3.42Å; N275-Q278 WeakPolarHBondContact O-CB 3.39Å; N275-Q278 PolarHBondContact O-N 3.03Å; Q276-Q278 VanDerWaalsContact C-N 3.28Å; Q276-Q278 PolarHBondContact O-N 3.17Å; Q278-E280 PolarHBondContact O-N 3.32Å; Q278-K281 WeakPolarHBondContact O-CB 3.49Å; Q278-K281 PolarHBondContact O-N 3.37Å; Q278-K281 VanDerWaalsContact O-N 3.12Å; Q278-M282 WeakPolarHBondContact O-CG 3.33Å; Q278-M282 PolarHBondContact O-N 2.95Å
279	E	85.9	Confident	87.1	Confident	112 Å²	112	110.6 Å²	110.6	52%	0.523	50%	0.5	S	S	.	.	H	α-helix	trans	-59.5	-43.7	175.2	-72.7	172.9	-174.9	0	0	111.5	N275 Q276 K281 M282 W283	N275-E279 PolarHBondContact ND2-OE1 3.29Å; N275-E279 PolarHBondContact O-N 3.46Å; Q276-E279 PolarHBondContact O-N 3.48Å; E279-K281 VanDerWaalsContact C-N 3.31Å; E279-K281 PolarHBondContact O-N 2.96Å; E279-M282 WeakPolarHBondContact O-CB 3.47Å; E279-M282 PolarHBondContact O-N 3.42Å; E279-W283 WeakPolarHBondContact O-CB 3.47Å; E279-W283 PolarHBondContact O-N 3.41Å
280	E	87.2	Confident	87	Confident	113 Å²	113	110.8 Å²	110.8	53%	0.528	50%	0.501	S	S	.	.	H	α-helix	trans	-63.2	-36.7	174.4	-77.1	-174.9	-173.2	0	0	112.5	Q276 Q278 R284	Q276-E280 WeakPolarHBondContact O-CB 3.34Å; Q276-E280 WeakPolarHBondContact O-CG 3.45Å; Q276-E280 PolarHBondContact O-N 2.89Å; Q278-E280 PolarHBondContact O-N 3.32Å; E280-R284 WeakPolarHBondContact O-CB 3.48Å; E280-R284 VanDerWaalsContact O-CG 3.24Å; E280-R284 WeakPolarHBondContact O-CG 3.23Å; E280-R284 PolarHBondContact O-N 2.98Å
281	K	90.4	Very high	87.1	Confident	127 Å²	127	110.2 Å²	110.2	55%	0.552	50%	0.495	S	S	*	.	H	α-helix	trans	-68.6	-40.8	175.5	-77.3	170.2	-173.7	173.6	0	111.5	Q277 Q278 E279 Q285	Q277-K281 WeakPolarHBondContact O-CB 3.35Å; Q277-K281 WeakPolarHBondContact O-CD 3.44Å; Q277-K281 WeakPolarHBondContact O-CG 3.42Å; Q277-K281 PolarHBondContact O-N 2.85Å; Q278-K281 WeakPolarHBondContact O-CB 3.49Å; Q278-K281 PolarHBondContact O-N 3.37Å; Q278-K281 VanDerWaalsContact O-N 3.12Å; E279-K281 VanDerWaalsContact C-N 3.31Å; E279-K281 PolarHBondContact O-N 2.96Å; K281-Q285 WeakPolarHBondContact O-CG 3.24Å; K281-Q285 PolarHBondContact O-N 3.3Å
282	M	82.4	Confident	87.1	Confident	115 Å²	115	111.2 Å²	111.2	57%	0.567	50%	0.499	S	S	*	.	H	α-helix	trans	-61.7	-49.7	174.2	-74.3	-68.1	-62.8	0	0	110.2	Q278 E279 R284 Q285 E286	Q278-M282 WeakPolarHBondContact O-CG 3.33Å; Q278-M282 PolarHBondContact O-N 2.95Å; E279-M282 WeakPolarHBondContact O-CB 3.47Å; E279-M282 PolarHBondContact O-N 3.42Å; M282-R284 PolarHBondContact O-N 3.11Å; M282-Q285 CarbonylContact O-C 3.48Å; M282-Q285 WeakPolarHBondContact O-CA 3.36Å; M282-Q285 WeakPolarHBondContact O-CB 3.35Å; M282-Q285 PolarHBondContact O-N 3.48Å; M282-E286 WeakPolarHBondContact O-CB 3.43Å; M282-E286 PolarHBondContact O-N 3.23Å
283	W	89.3	Confident	87.2	Confident	168 Å²	168	112.4 Å²	112.4	64%	0.636	50%	0.502	S	S	*	.	H	α-helix	trans	-60.6	-42.5	179.3	-167	82.6	0	0	0	112.2	E279 Q285 E286 E287	E279-W283 WeakPolarHBondContact O-CB 3.47Å; E279-W283 PolarHBondContact O-N 3.41Å; W283-Q285 VanDerWaalsContact C-N 3.27Å; W283-Q285 PolarHBondContact O-N 2.92Å; W283-E286 PolarHBondContact O-N 3.48Å; W283-E287 WeakPolarHBondContact CZ3-OE2 3.41Å; W283-E287 WeakPolarHBondContact O-CB 3.26Å; W283-E287 PolarHBondContact O-N 3.27Å
284	R	88	Confident	87.2	Confident	150 Å²	150	112.3 Å²	112.3	57%	0.566	51%	0.507	S	S	*	.	H	α-helix	trans	-66.8	-24.8	173.3	-72.6	177.7	-165.1	-105.9	6	113.8	E280 M282 K288	E280-R284 WeakPolarHBondContact O-CB 3.48Å; E280-R284 VanDerWaalsContact O-CG 3.24Å; E280-R284 WeakPolarHBondContact O-CG 3.23Å; E280-R284 PolarHBondContact O-N 2.98Å; M282-R284 PolarHBondContact O-N 3.11Å; R284-K288 WeakPolarHBondContact O-CD 3.42Å; R284-K288 VanDerWaalsContact O-CG 3.27Å; R284-K288 WeakPolarHBondContact O-CG 3.28Å
285	Q	84.2	Confident	87.3	Confident	119 Å²	119	113.5 Å²	113.5	56%	0.556	51%	0.508	S	S	*	.	H	α-helix	trans	-78.8	-43.3	173	-78.5	-178.2	-0.8	0	0	110.3	K281 M282 W283 K288 I289	K281-Q285 WeakPolarHBondContact O-CG 3.24Å; K281-Q285 PolarHBondContact O-N 3.3Å; M282-Q285 CarbonylContact O-C 3.48Å; M282-Q285 WeakPolarHBondContact O-CA 3.36Å; M282-Q285 WeakPolarHBondContact O-CB 3.35Å; M282-Q285 PolarHBondContact O-N 3.48Å; W283-Q285 VanDerWaalsContact C-N 3.27Å; W283-Q285 PolarHBondContact O-N 2.92Å; Q285-K288 WeakPolarHBondContact O-CB 3.45Å; Q285-K288 PolarHBondContact O-N 3.24Å; Q285-K288 VanDerWaalsContact O-N 3.15Å; Q285-I289 WeakPolarHBondContact O-CG1 3.45Å; Q285-I289 PolarHBondContact O-N 3.42Å
286	E	85.8	Confident	87.4	Confident	91 Å²	91	115.3 Å²	115.3	43%	0.425	52%	0.517	S	S	.	.	H	α-helix	trans	-59.6	-46.2	176.1	-159.3	66.8	-164.8	0	0	111.4	M282 W283 K288 I289 Q290	M282-E286 WeakPolarHBondContact O-CB 3.43Å; M282-E286 PolarHBondContact O-N 3.23Å; W283-E286 PolarHBondContact O-N 3.48Å; E286-K288 VanDerWaalsContact C-N 3.26Å; E286-K288 PolarHBondContact O-N 3.26Å; E286-I289 CarbonylContact O-C 3.57Å; E286-I289 WeakPolarHBondContact O-CA 3.37Å; E286-I289 WeakPolarHBondContact O-CB 3.32Å; E286-I289 PolarHBondContact O-N 2.89Å; E286-Q290 WeakPolarHBondContact O-CG 3.45Å; E286-Q290 PolarHBondContact O-N 3.49Å
287	E	87	Confident	87.1	Confident	81 Å²	81	115.4 Å²	115.4	38%	0.379	52%	0.517	S	S	.	.	H	α-helix	trans	-57.9	-39.3	175.2	-173.5	-178.4	-155.4	0	0	111.4	W283 E291	W283-E287 WeakPolarHBondContact CZ3-OE2 3.41Å; W283-E287 WeakPolarHBondContact O-CB 3.26Å; W283-E287 PolarHBondContact O-N 3.27Å; E287-E291 WeakPolarHBondContact O-CG 3.48Å; E287-E291 PolarHBondContact O-N 3.04Å
288	K	91.4	Very high	87.1	Confident	132 Å²	132	115.5 Å²	115.5	57%	0.574	52%	0.517	S	S	*	.	H	α-helix	trans	-72.6	-28.7	175.5	-72.2	174.4	-176.3	-179.5	0	113.4	R284 Q285 E286 R292	R284-K288 WeakPolarHBondContact O-CD 3.42Å; R284-K288 VanDerWaalsContact O-CG 3.27Å; R284-K288 WeakPolarHBondContact O-CG 3.28Å; Q285-K288 WeakPolarHBondContact O-CB 3.45Å; Q285-K288 PolarHBondContact O-N 3.24Å; Q285-K288 VanDerWaalsContact O-N 3.15Å; E286-K288 VanDerWaalsContact C-N 3.26Å; E286-K288 PolarHBondContact O-N 3.26Å; K288-R292 WeakPolarHBondContact O-CD 3.42Å; K288-R292 VanDerWaalsContact O-CG 3.23Å; K288-R292 WeakPolarHBondContact O-CG 3.32Å; K288-R292 PolarHBondContact O-N 3.12Å
289	I	88.1	Confident	87	Confident	72 Å²	72	115.7 Å²	115.7	37%	0.369	52%	0.518	S	S	.	.	H	α-helix	trans	-72.1	-47.8	174.4	-69.9	165.9	0	0	0	108.4	Q285 E286 E291 R292 E293	Q285-I289 WeakPolarHBondContact O-CG1 3.45Å; Q285-I289 PolarHBondContact O-N 3.42Å; E286-I289 CarbonylContact O-C 3.57Å; E286-I289 WeakPolarHBondContact O-CA 3.37Å; E286-I289 WeakPolarHBondContact O-CB 3.32Å; E286-I289 PolarHBondContact O-N 2.89Å; I289-E291 PolarHBondContact O-N 3.41Å; I289-R292 CarbonylContact O-C 3.59Å; I289-R292 WeakPolarHBondContact O-CA 3.47Å; I289-R292 WeakPolarHBondContact O-CB 3.45Å; I289-R292 PolarHBondContact O-N 2.88Å; I289-E293 HydrophobicContact CG2-CG 4.25Å; I289-E293 WeakPolarHBondContact O-CG 3.4Å; I289-E293 PolarHBondContact O-N 2.87Å
290	Q	82.6	Confident	87	Confident	101 Å²	101	114.6 Å²	114.6	47%	0.472	51%	0.513	S	S	.	.	H	α-helix	trans	-57.6	-46.5	175.4	-72.1	179.6	-14.2	0	0	112.1	E286 R292 E293 E294	E286-Q290 WeakPolarHBondContact O-CG 3.45Å; E286-Q290 PolarHBondContact O-N 3.49Å; Q290-R292 PolarHBondContact O-N 3.47Å; Q290-E293 PolarHBondContact O-N 3.03Å; Q290-E293 VanDerWaalsContact O-N 3.15Å; Q290-E294 WeakPolarHBondContact O-CG 3.41Å; Q290-E294 PolarHBondContact O-N 3.41Å
291	E	88.1	Confident	87.1	Confident	96 Å²	96	115.1 Å²	115.1	45%	0.449	52%	0.516	S	S	.	.	H	α-helix	trans	-60.9	-28.6	174	-80.1	-172.3	179.7	0	0	113.3	E287 I289 K295	E287-E291 WeakPolarHBondContact O-CG 3.48Å; E287-E291 PolarHBondContact O-N 3.04Å; I289-E291 PolarHBondContact O-N 3.41Å; E291-K295 WeakPolarHBondContact O-CD 3.45Å; E291-K295 VanDerWaalsContact O-CG 3.24Å; E291-K295 WeakPolarHBondContact O-CG 3.44Å; E291-K295 PolarHBondContact O-N 3.14Å
292	R	86.4	Confident	87.1	Confident	177 Å²	177	114.7 Å²	114.7	67%	0.668	51%	0.514	S	S	*	.	H	α-helix	trans	-78.8	-40	175.1	-76.4	172.5	176.5	-169	-2.1	111.2	K288 I289 Q290 K295 I296	K288-R292 WeakPolarHBondContact O-CD 3.42Å; K288-R292 VanDerWaalsContact O-CG 3.23Å; K288-R292 WeakPolarHBondContact O-CG 3.32Å; K288-R292 PolarHBondContact O-N 3.12Å; I289-R292 CarbonylContact O-C 3.59Å; I289-R292 WeakPolarHBondContact O-CA 3.47Å; I289-R292 WeakPolarHBondContact O-CB 3.45Å; I289-R292 PolarHBondContact O-N 2.88Å; Q290-R292 PolarHBondContact O-N 3.47Å; R292-K295 PolarHBondContact O-N 3.39Å; R292-I296 VanDerWaalsContact O-CG1 3.26Å; R292-I296 WeakPolarHBondContact O-CG1 3.48Å; R292-I296 PolarHBondContact O-N 2.89Å
293	E	86.1	Confident	87.4	Confident	99 Å²	99	113.3 Å²	113.3	46%	0.463	51%	0.508	S	S	.	.	H	α-helix	trans	-62.2	-44.8	175.1	-72.4	176.3	170.8	0	0	111	I289 Q290 K295 I296 Q297	I289-E293 HydrophobicContact CG2-CG 4.25Å; I289-E293 WeakPolarHBondContact O-CG 3.4Å; I289-E293 PolarHBondContact O-N 2.87Å; Q290-E293 PolarHBondContact O-N 3.03Å; Q290-E293 VanDerWaalsContact O-N 3.15Å; E293-K295 VanDerWaalsContact C-N 3.32Å; E293-K295 PolarHBondContact O-N 2.8Å; E293-I296 PolarHBondContact O-N 3.05Å; E293-I296 VanDerWaalsContact O-N 3.16Å; E293-Q297 WeakPolarHBondContact O-CG 3.35Å; E293-Q297 PolarHBondContact O-N 3.39Å
294	E	88.1	Confident	87.3	Confident	123 Å²	123	112.4 Å²	112.4	58%	0.575	50%	0.504	S	S	*	.	H	α-helix	trans	-59.7	-41.8	174.1	-74.2	-177.4	171.1	0	0	111.6	Q290 I296 Q297 E298	Q290-E294 WeakPolarHBondContact O-CG 3.41Å; Q290-E294 PolarHBondContact O-N 3.41Å; E294-I296 PolarHBondContact O-N 3.31Å; E294-Q297 PolarHBondContact O-N 3.15Å; E294-E298 WeakPolarHBondContact O-CG 3.34Å; E294-E298 PolarHBondContact O-N 3.09Å
295	K	91.6	Very high	87.2	Confident	122 Å²	122	110.6 Å²	110.6	53%	0.53	50%	0.502	S	S	.	.	H	α-helix	trans	-66.6	-36.2	175.9	-74.9	169.9	-170.7	160.9	0	112.9	E291 R292 E293 Q299	E291-K295 WeakPolarHBondContact O-CD 3.45Å; E291-K295 VanDerWaalsContact O-CG 3.24Å; E291-K295 WeakPolarHBondContact O-CG 3.44Å; E291-K295 PolarHBondContact O-N 3.14Å; R292-K295 PolarHBondContact O-N 3.39Å; E293-K295 VanDerWaalsContact C-N 3.32Å; E293-K295 PolarHBondContact O-N 2.8Å; K295-Q299 WeakPolarHBondContact O-CG 3.48Å; K295-Q299 PolarHBondContact O-N 2.85Å; K295-Q299 VanDerWaalsContact O-N 3.08Å
296	I	88.8	Confident	87.2	Confident	86 Å²	86	110.8 Å²	110.8	44%	0.441	50%	0.503	S	S	.	.	H	α-helix	trans	-67.1	-45.4	174.8	-70.4	164.3	0	0	0	109.3	R292 E293 E294 E298 Q299 E300	R292-I296 VanDerWaalsContact O-CG1 3.26Å; R292-I296 WeakPolarHBondContact O-CG1 3.48Å; R292-I296 PolarHBondContact O-N 2.89Å; E293-I296 PolarHBondContact O-N 3.05Å; E293-I296 VanDerWaalsContact O-N 3.16Å; E294-I296 PolarHBondContact O-N 3.31Å; I296-E298 PolarHBondContact O-N 2.88Å; I296-Q299 CarbonylContact O-C 3.57Å; I296-Q299 WeakPolarHBondContact O-CA 3.47Å; I296-Q299 WeakPolarHBondContact O-CB 3.31Å; I296-Q299 PolarHBondContact O-N 3.34Å; I296-E300 HydrophobicContact CG2-CG 4.28Å; I296-E300 WeakPolarHBondContact O-CG 3.48Å; I296-E300 PolarHBondContact O-N 3.19Å
297	Q	83.1	Confident	87.1	Confident	114 Å²	114	111.7 Å²	111.7	53%	0.533	51%	0.508	S	S	.	.	H	α-helix	trans	-59.8	-44.5	176.3	-73.3	177.7	-0	0	0	111.9	E293 E294 Q299 E300 E301	E293-Q297 WeakPolarHBondContact O-CG 3.35Å; E293-Q297 PolarHBondContact O-N 3.39Å; E294-Q297 PolarHBondContact O-N 3.15Å; Q297-Q299 VanDerWaalsContact C-N 3.27Å; Q297-Q299 PolarHBondContact O-N 3.45Å; Q297-E300 PolarHBondContact O-N 3.45Å; Q297-E301 PolarHBondContact O-N 3.22Å
298	E	87.9	Confident	87.1	Confident	109 Å²	109	112.6 Å²	112.6	51%	0.509	51%	0.512	S	S	.	.	H	α-helix	trans	-61.9	-34	173.8	-77.1	-173.1	-176	0	0	112.8	E294 I296 K302	E294-E298 WeakPolarHBondContact O-CG 3.34Å; E294-E298 PolarHBondContact O-N 3.09Å; I296-E298 PolarHBondContact O-N 2.88Å; E298-K302 WeakPolarHBondContact O-CD 3.44Å; E298-K302 VanDerWaalsContact O-CG 3.28Å; E298-K302 WeakPolarHBondContact O-CG 3.46Å; E298-K302 PolarHBondContact O-N 2.85Å
299	Q	85	Confident	87.1	Confident	122 Å²	122	111.6 Å²	111.6	57%	0.57	51%	0.507	S	S	*	.	H	α-helix	trans	-71.7	-41.7	174.5	-77.4	-174.7	-20.5	0	0	111.5	K295 I296 Q297 K302 I303	K295-Q299 WeakPolarHBondContact O-CG 3.48Å; K295-Q299 PolarHBondContact O-N 2.85Å; K295-Q299 VanDerWaalsContact O-N 3.08Å; I296-Q299 CarbonylContact O-C 3.57Å; I296-Q299 WeakPolarHBondContact O-CA 3.47Å; I296-Q299 WeakPolarHBondContact O-CB 3.31Å; I296-Q299 PolarHBondContact O-N 3.34Å; Q297-Q299 VanDerWaalsContact C-N 3.27Å; Q297-Q299 PolarHBondContact O-N 3.45Å; Q299-K302 PolarHBondContact O-N 3.08Å; Q299-I303 VanDerWaalsContact O-CG1 3.31Å; Q299-I303 WeakPolarHBondContact O-CG1 3.41Å; Q299-I303 PolarHBondContact O-N 3.37Å
300	E	85.8	Confident	86.9	Confident	90 Å²	90	111.9 Å²	111.9	42%	0.421	51%	0.508	S	S	.	.	H	α-helix	trans	-61.7	-41.6	174.7	-73	-179.5	-179.2	0	0	111.6	I296 Q297 I303 R304	I296-E300 HydrophobicContact CG2-CG 4.28Å; I296-E300 WeakPolarHBondContact O-CG 3.48Å; I296-E300 PolarHBondContact O-N 3.19Å; Q297-E300 PolarHBondContact O-N 3.45Å; E300-I303 PolarHBondContact O-N 2.88Å; E300-R304 WeakPolarHBondContact O-CG 3.27Å; E300-R304 PolarHBondContact O-N 2.92Å
301	E	88.2	Confident	87.2	Confident	124 Å²	124	115.6 Å²	115.6	58%	0.579	52%	0.518	S	S	*	.	H	α-helix	trans	-62.9	-41.8	174.2	-75.9	-169.6	163.3	0	0	111.9	Q297 I303 R304 E305	Q297-E301 PolarHBondContact O-N 3.22Å; E301-I303 VanDerWaalsContact C-N 3.33Å; E301-I303 PolarHBondContact O-N 3.34Å; E301-R304 PolarHBondContact O-N 3.23Å; E301-E305 WeakPolarHBondContact O-CG 3.4Å; E301-E305 PolarHBondContact O-N 3.33Å
302	K	91.9	Very high	87.2	Confident	118 Å²	118	117.7 Å²	117.7	51%	0.513	52%	0.521	S	S	.	.	H	α-helix	trans	-63.3	-38.9	175.1	-74.3	167.2	-171.5	157.9	0	112.4	E298 Q299 Q306	E298-K302 WeakPolarHBondContact O-CD 3.44Å; E298-K302 VanDerWaalsContact O-CG 3.28Å; E298-K302 WeakPolarHBondContact O-CG 3.46Å; E298-K302 PolarHBondContact O-N 2.85Å; Q299-K302 PolarHBondContact O-N 3.08Å; K302-Q306 WeakPolarHBondContact O-CG 3.47Å; K302-Q306 PolarHBondContact O-N 3.45Å
303	I	88.4	Confident	87	Confident	85 Å²	85	113.3 Å²	113.3	44%	0.436	51%	0.509	S	S	.	.	H	α-helix	trans	-64.8	-47.8	174.8	-68.6	165.5	0	0	0	109.7	Q299 E300 E301 E305 Q306 E307	Q299-I303 VanDerWaalsContact O-CG1 3.31Å; Q299-I303 WeakPolarHBondContact O-CG1 3.41Å; Q299-I303 PolarHBondContact O-N 3.37Å; E300-I303 PolarHBondContact O-N 2.88Å; E301-I303 VanDerWaalsContact C-N 3.33Å; E301-I303 PolarHBondContact O-N 3.34Å; I303-E305 VanDerWaalsContact C-N 3.33Å; I303-E305 PolarHBondContact O-N 2.97Å; I303-Q306 CarbonylContact O-C 3.57Å; I303-Q306 WeakPolarHBondContact O-CA 3.47Å; I303-Q306 WeakPolarHBondContact O-CB 3.44Å; I303-Q306 PolarHBondContact O-N 3.49Å; I303-E307 HydrophobicContact CG2-CG 4.26Å; I303-E307 WeakPolarHBondContact O-CG 3.42Å; I303-E307 PolarHBondContact O-N 2.94Å
304	R	86.6	Confident	86.7	Confident	150 Å²	150	114 Å²	114	57%	0.566	51%	0.512	S	S	*	.	H	α-helix	trans	-58.7	-42.1	176.7	-72.8	178.5	-168.8	174.6	8.4	112.4	E300 E301 Q306 E307 E308	E300-R304 WeakPolarHBondContact O-CG 3.27Å; E300-R304 PolarHBondContact O-N 2.92Å; E301-R304 PolarHBondContact O-N 3.23Å; R304-Q306 VanDerWaalsContact C-N 3.31Å; R304-Q306 PolarHBondContact O-N 3.48Å; R304-E307 PolarHBondContact O-N 3.42Å; R304-E308 PolarHBondContact O-N 2.88Å
305	E	86.5	Confident	86.8	Confident	111 Å²	111	114.2 Å²	114.2	52%	0.519	51%	0.513	S	S	.	.	H	α-helix	trans	-63.6	-36.1	174.6	-76.6	-171.5	179.7	0	0	112.6	E301 I303 K309	E301-E305 WeakPolarHBondContact O-CG 3.4Å; E301-E305 PolarHBondContact O-N 3.33Å; I303-E305 VanDerWaalsContact C-N 3.33Å; I303-E305 PolarHBondContact O-N 2.97Å; E305-K309 VanDerWaalsContact O-CG 3.28Å; E305-K309 WeakPolarHBondContact O-CG 3.46Å; E305-K309 PolarHBondContact O-N 3.43Å; E305-K309 VanDerWaalsContact O-N 3.12Å
306	Q	84.1	Confident	86.4	Confident	124 Å²	124	113.6 Å²	113.6	58%	0.579	51%	0.513	S	S	*	.	H	α-helix	trans	-69.4	-42.3	174	-76.7	-175.7	-30.7	0	0	111.6	K302 I303 R304 E308 K309 M310	K302-Q306 WeakPolarHBondContact O-CG 3.47Å; K302-Q306 PolarHBondContact O-N 3.45Å; I303-Q306 CarbonylContact O-C 3.57Å; I303-Q306 WeakPolarHBondContact O-CA 3.47Å; I303-Q306 WeakPolarHBondContact O-CB 3.44Å; I303-Q306 PolarHBondContact O-N 3.49Å; R304-Q306 VanDerWaalsContact C-N 3.31Å; R304-Q306 PolarHBondContact O-N 3.48Å; Q306-E308 VanDerWaalsContact C-N 3.35Å; Q306-E308 PolarHBondContact O-N 2.9Å; Q306-K309 WeakPolarHBondContact O-CB 3.34Å; Q306-K309 PolarHBondContact O-N 2.84Å; Q306-K309 VanDerWaalsContact O-N 3.14Å; Q306-M310 WeakPolarHBondContact O-CG 3.43Å; Q306-M310 PolarHBondContact O-N 3.33Å
307	E	82.4	Confident	86	Confident	110 Å²	110	113.7 Å²	113.7	51%	0.514	51%	0.513	S	S	.	.	H	α-helix	trans	-61	-41	174.3	-72.1	178.6	167.5	0	0	111.8	I303 R304 K309 M310 R311	I303-E307 HydrophobicContact CG2-CG 4.26Å; I303-E307 WeakPolarHBondContact O-CG 3.42Å; I303-E307 PolarHBondContact O-N 2.94Å; R304-E307 PolarHBondContact O-N 3.42Å; E307-K309 VanDerWaalsContact C-N 3.34Å; E307-K309 PolarHBondContact O-N 3.22Å; E307-M310 PolarHBondContact O-N 3.13Å; E307-R311 WeakPolarHBondContact O-CB 3.42Å; E307-R311 WeakPolarHBondContact O-CG 3.45Å; E307-R311 PolarHBondContact O-N 2.87Å
308	E	88.4	Confident	86.4	Confident	99 Å²	99	115.6 Å²	115.6	46%	0.463	52%	0.515	S	S	.	.	H	α-helix	trans	-64.9	-36.9	173.5	-80.4	-164.5	-178.9	0	0	112.6	R304 Q306 R312	R304-E308 PolarHBondContact O-N 2.88Å; Q306-E308 VanDerWaalsContact C-N 3.35Å; Q306-E308 PolarHBondContact O-N 2.9Å; E308-R312 VanDerWaalsContact O-CG 3.31Å; E308-R312 WeakPolarHBondContact O-CG 3.41Å; E308-R312 PolarHBondContact O-N 3.31Å; E308-R312 IonicContact OE2-CZ 3.66Å; E308-R312 IonicContact OE2-NH1 3.67Å; E308-R312 PolarHBondContact OE2-NH1 3Å; E308-R312 IonicContact OE2-NH2 2.68Å; E308-R312 PolarHBondContact OE2-NH2 2.99Å
309	K	91.3	Very high	86.4	Confident	111 Å²	111	115 Å²	115	48%	0.483	51%	0.512	S	S	.	.	H	α-helix	trans	-67.3	-42.1	175.9	-75.2	166.9	-172.8	160.8	0	111.2	E305 Q306 E307 R312 Q313	E305-K309 VanDerWaalsContact O-CG 3.28Å; E305-K309 WeakPolarHBondContact O-CG 3.46Å; E305-K309 PolarHBondContact O-N 3.43Å; E305-K309 VanDerWaalsContact O-N 3.12Å; Q306-K309 WeakPolarHBondContact O-CB 3.34Å; Q306-K309 PolarHBondContact O-N 2.84Å; Q306-K309 VanDerWaalsContact O-N 3.14Å; E307-K309 VanDerWaalsContact C-N 3.34Å; E307-K309 PolarHBondContact O-N 3.22Å; K309-R312 PolarHBondContact O-N 2.83Å; K309-Q313 WeakPolarHBondContact O-CG 3.31Å; K309-Q313 PolarHBondContact O-N 3.34Å
310	M	84.1	Confident	86.4	Confident	79 Å²	79	115 Å²	115	39%	0.389	51%	0.511	S	S	.	.	H	α-helix	trans	-59.1	-51.3	172.9	-77	-77.2	-67.1	0	0	110.9	L178 Q306 E307 R312 Q313 E314	L178-M310 HydrophobicContact CD2-SD 4.23Å; Q306-M310 WeakPolarHBondContact O-CG 3.43Å; Q306-M310 PolarHBondContact O-N 3.33Å; E307-M310 PolarHBondContact O-N 3.13Å; M310-R312 VanDerWaalsContact C-N 3.35Å; M310-R312 PolarHBondContact O-N 3.4Å; M310-Q313 CarbonylContact O-C 3.52Å; M310-Q313 WeakPolarHBondContact O-CA 3.45Å; M310-Q313 WeakPolarHBondContact O-CB 3.35Å; M310-Q313 PolarHBondContact O-N 3Å; M310-E314 WeakPolarHBondContact O-CG 3.44Å; M310-E314 PolarHBondContact O-N 2.75Å
311	R	87.7	Confident	86.2	Confident	179 Å²	179	116 Å²	116	68%	0.675	52%	0.515	S	S	*	.	H	α-helix	trans	-56.1	-45.5	176.8	-78	179.1	-179.7	-102.5	1.1	112.5	E307 Q313 E314 E315	E307-R311 WeakPolarHBondContact O-CB 3.42Å; E307-R311 WeakPolarHBondContact O-CG 3.45Å; E307-R311 PolarHBondContact O-N 2.87Å; R311-Q313 VanDerWaalsContact C-N 3.29Å; R311-Q313 PolarHBondContact O-N 3.43Å; R311-E314 PolarHBondContact O-N 2.85Å; R311-E315 WeakPolarHBondContact O-CB 3.46Å; R311-E315 PolarHBondContact O-N 3.17Å
312	R	89	Confident	86.2	Confident	139 Å²	139	111 Å²	111	53%	0.525	49%	0.492	S	S	.	.	H	α-helix	trans	-63.4	-34.6	176.1	-71.8	179.2	-169.8	113.9	5.8	112.5	E308 K309 M310 M316	E308-R312 VanDerWaalsContact O-CG 3.31Å; E308-R312 WeakPolarHBondContact O-CG 3.41Å; E308-R312 PolarHBondContact O-N 3.31Å; E308-R312 IonicContact OE2-CZ 3.66Å; E308-R312 IonicContact OE2-NH1 3.67Å; E308-R312 PolarHBondContact OE2-NH1 3Å; E308-R312 IonicContact OE2-NH2 2.68Å; E308-R312 PolarHBondContact OE2-NH2 2.99Å; K309-R312 PolarHBondContact O-N 2.83Å; M310-R312 VanDerWaalsContact C-N 3.35Å; M310-R312 PolarHBondContact O-N 3.4Å; R312-M316 WeakPolarHBondContact O-CG 3.28Å; R312-M316 PolarHBondContact O-N 2.91Å; R312-M316 VanDerWaalsContact O-N 3.13Å
313	Q	81.5	Confident	86.2	Confident	85 Å²	85	111 Å²	111	40%	0.397	49%	0.492	S	S	.	.	H	α-helix	trans	-70.5	-42.4	175.3	-76.3	177.5	-13.6	0	0	111.8	Y174 K309 M310 R311 M316 M317	Y174-Q313 VanDerWaalsContact OH-CD 3.26Å; Y174-Q313 PolarHBondContact OH-NE2 3.49Å; Y174-Q313 PolarHBondContact OH-OE1 2.88Å; K309-Q313 WeakPolarHBondContact O-CG 3.31Å; K309-Q313 PolarHBondContact O-N 3.34Å; M310-Q313 CarbonylContact O-C 3.52Å; M310-Q313 WeakPolarHBondContact O-CA 3.45Å; M310-Q313 WeakPolarHBondContact O-CB 3.35Å; M310-Q313 PolarHBondContact O-N 3Å; R311-Q313 VanDerWaalsContact C-N 3.29Å; R311-Q313 PolarHBondContact O-N 3.43Å; Q313-M316 PolarHBondContact O-N 3.41Å; Q313-M317 WeakPolarHBondContact O-CB 3.42Å; Q313-M317 WeakPolarHBondContact O-CG 3.38Å; Q313-M317 PolarHBondContact O-N 3.16Å
314	E	79.9	Confident	86.1	Confident	115 Å²	115	112 Å²	112	54%	0.537	50%	0.496	S	S	.	.	H	α-helix	trans	-60.2	-43.5	173.1	-71.5	173.1	173.4	0	0	111.3	M310 R311 M316 M317 W318	M310-E314 WeakPolarHBondContact O-CG 3.44Å; M310-E314 PolarHBondContact O-N 2.75Å; R311-E314 PolarHBondContact O-N 2.85Å; E314-M316 PolarHBondContact O-N 2.85Å; E314-M317 WeakPolarHBondContact O-CB 3.38Å; E314-M317 PolarHBondContact O-N 3.36Å; E314-W318 WeakPolarHBondContact O-CB 3.48Å; E314-W318 PolarHBondContact O-N 3.46Å
315	E	89.6	Confident	86.2	Confident	127 Å²	127	111.2 Å²	111.2	59%	0.593	49%	0.493	S	S	*	.	H	α-helix	trans	-62.1	-42.5	177	-140.7	172.4	-161.2	0	0	111.5	R311 W318 E319	R311-E315 WeakPolarHBondContact O-CB 3.46Å; R311-E315 PolarHBondContact O-N 3.17Å; E315-W318 PolarHBondContact O-N 3.42Å; E315-E319 WeakPolarHBondContact O-CG 3.3Å; E315-E319 PolarHBondContact O-N 3.06Å
316	M	83.7	Confident	86.4	Confident	109 Å²	109	112.4 Å²	112.4	54%	0.537	49%	0.493	S	S	.	.	H	α-helix	trans	-68.5	-34.3	174.6	-78.2	-129.8	-58.2	0	0	113.8	R312 Q313 E314 K320	R312-M316 WeakPolarHBondContact O-CG 3.28Å; R312-M316 PolarHBondContact O-N 2.91Å; R312-M316 VanDerWaalsContact O-N 3.13Å; Q313-M316 PolarHBondContact O-N 3.41Å; E314-M316 PolarHBondContact O-N 2.85Å; M316-K320 VanDerWaalsContact O-CG 3.32Å; M316-K320 WeakPolarHBondContact O-CG 3.17Å; M316-K320 PolarHBondContact O-N 2.94Å
317	M	81.4	Confident	86.4	Confident	88 Å²	88	112.7 Å²	112.7	43%	0.433	49%	0.494	S	S	.	.	H	α-helix	trans	-65.2	-48.5	173.5	-78.4	-78.9	-66.2	0	0	109.8	Q313 E314 E319 K320 E321	Q313-M317 WeakPolarHBondContact O-CB 3.42Å; Q313-M317 WeakPolarHBondContact O-CG 3.38Å; Q313-M317 PolarHBondContact O-N 3.16Å; E314-M317 WeakPolarHBondContact O-CB 3.38Å; E314-M317 PolarHBondContact O-N 3.36Å; M317-E319 PolarHBondContact O-N 3.44Å; M317-K320 WeakPolarHBondContact O-CA 3.43Å; M317-K320 WeakPolarHBondContact O-CB 3.47Å; M317-K320 PolarHBondContact O-N 3.49Å; M317-E321 WeakPolarHBondContact O-CG 3.41Å; M317-E321 PolarHBondContact O-N 3.25Å
318	W	91.4	Very high	86.3	Confident	154 Å²	154	113.1 Å²	113.1	58%	0.583	50%	0.496	S	S	*	.	H	α-helix	trans	-59.3	-44.5	177	-175.8	79.7	0	0	0	112	E314 E315 K320 E321 E322	E314-W318 WeakPolarHBondContact O-CB 3.48Å; E314-W318 PolarHBondContact O-N 3.46Å; E315-W318 PolarHBondContact O-N 3.42Å; W318-K320 VanDerWaalsContact C-N 3.26Å; W318-K320 PolarHBondContact O-N 3.31Å; W318-E321 PolarHBondContact O-N 2.95Å; W318-E322 VanDerWaalsContact O-CB 3.25Å; W318-E322 WeakPolarHBondContact O-CB 3.48Å; W318-E322 PolarHBondContact O-N 3.24Å
319	E	87.9	Confident	86.4	Confident	95 Å²	95	113.6 Å²	113.6	44%	0.444	50%	0.498	S	S	.	.	H	α-helix	trans	-61.1	-33.3	174.2	-79	-170.8	-178.7	0	0	113.3	E315 M317 K323	E315-E319 WeakPolarHBondContact O-CG 3.3Å; E315-E319 PolarHBondContact O-N 3.06Å; M317-E319 PolarHBondContact O-N 3.44Å; E319-K323 WeakPolarHBondContact O-CB 3.36Å; E319-K323 WeakPolarHBondContact O-CD 3.48Å; E319-K323 VanDerWaalsContact O-CG 3.26Å; E319-K323 WeakPolarHBondContact O-CG 3.39Å; E319-K323 PolarHBondContact O-N 3.16Å; E319-K323 VanDerWaalsContact O-N 3.09Å
320	K	83.7	Confident	86	Confident	124 Å²	124	113.4 Å²	113.4	54%	0.539	50%	0.5	S	S	.	.	H	α-helix	trans	-74.8	-42.9	176.5	-76.2	174.1	-177.4	172.7	0	111.6	M316 M317 W318 E322 K323 M324	M316-K320 VanDerWaalsContact O-CG 3.32Å; M316-K320 WeakPolarHBondContact O-CG 3.17Å; M316-K320 PolarHBondContact O-N 2.94Å; M317-K320 WeakPolarHBondContact O-CA 3.43Å; M317-K320 WeakPolarHBondContact O-CB 3.47Å; M317-K320 PolarHBondContact O-N 3.49Å; W318-K320 VanDerWaalsContact C-N 3.26Å; W318-K320 PolarHBondContact O-N 3.31Å; K320-E322 VanDerWaalsContact C-N 3.31Å; K320-K323 PolarHBondContact O-N 3.12Å; K320-M324 WeakPolarHBondContact O-CB 3.28Å; K320-M324 PolarHBondContact O-N 3.32Å
321	E	82.2	Confident	85.9	Confident	109 Å²	109	114.6 Å²	114.6	51%	0.509	51%	0.506	S	S	.	.	H	α-helix	trans	-60.3	-42.9	173.5	-74.4	174.5	-177.7	0	0	110.8	M317 W318 K323 M324 R325	M317-E321 WeakPolarHBondContact O-CG 3.41Å; M317-E321 PolarHBondContact O-N 3.25Å; W318-E321 PolarHBondContact O-N 2.95Å; E321-K323 PolarHBondContact O-N 2.89Å; E321-M324 WeakPolarHBondContact O-CB 3.31Å; E321-M324 PolarHBondContact O-N 3.38Å; E321-M324 VanDerWaalsContact O-N 3.16Å; E321-R325 WeakPolarHBondContact O-CB 3.49Å; E321-R325 PolarHBondContact O-N 3.46Å
322	E	88.7	Confident	86.1	Confident	20 Å²	20	112.9 Å²	112.9	9%	0.093	50%	0.5	C	S	.	.	H	α-helix	trans	-63.9	-39.5	176.1	-175	66.2	-162.9	0	0	112	W318 K320 R325 R326	W318-E322 VanDerWaalsContact O-CB 3.25Å; W318-E322 WeakPolarHBondContact O-CB 3.48Å; W318-E322 PolarHBondContact O-N 3.24Å; K320-E322 VanDerWaalsContact C-N 3.31Å; E322-R325 IonicContact OE1-CZ 2.68Å; E322-R325 IonicContact OE1-NH2 3.96Å; E322-R325 PolarHBondContact OE1-NH2 3.02Å; E322-R325 IonicContact OE2-CZ 3.99Å; E322-R325 IonicContact OE2-NH1 2.64Å; E322-R325 PolarHBondContact OE2-NH1 3.24Å; E322-R325 IonicContact OE2-NH2 3.75Å; E322-R325 PolarHBondContact OE2-NH2 2.7Å; E322-R326 VanDerWaalsContact CG-NH2 3.29Å; E322-R326 WeakPolarHBondContact O-CG 3.48Å; E322-R326 PolarHBondContact O-N 2.87Å; E322-R326 VanDerWaalsContact O-N 3.08Å; E322-R326 IonicContact OE1-CZ 3.65Å; E322-R326 IonicContact OE1-NE 2.84Å; E322-R326 IonicContact OE1-NH2 3.6Å; E322-R326 PolarHBondContact OE1-NH2 2.75Å
323	K	92	Very high	86.2	Confident	119 Å²	119	110.3 Å²	110.3	52%	0.517	49%	0.494	S	S	.	.	H	α-helix	trans	-66.3	-38	172.8	-77.7	168.2	-176.2	159.6	0	112.1	E319 K320 E321 Q327	E319-K323 WeakPolarHBondContact O-CB 3.36Å; E319-K323 WeakPolarHBondContact O-CD 3.48Å; E319-K323 VanDerWaalsContact O-CG 3.26Å; E319-K323 WeakPolarHBondContact O-CG 3.39Å; E319-K323 PolarHBondContact O-N 3.16Å; E319-K323 VanDerWaalsContact O-N 3.09Å; K320-K323 PolarHBondContact O-N 3.12Å; E321-K323 PolarHBondContact O-N 2.89Å; K323-Q327 WeakPolarHBondContact O-CG 3.39Å; K323-Q327 PolarHBondContact O-N 2.84Å
324	M	85.8	Confident	86.5	Confident	104 Å²	104	112 Å²	112	51%	0.512	50%	0.5	S	S	.	.	H	α-helix	trans	-65.7	-46.9	176.8	-160.7	-178	-48.4	0	0	110.3	K320 E321 R326 Q327 E328	K320-M324 WeakPolarHBondContact O-CB 3.28Å; K320-M324 PolarHBondContact O-N 3.32Å; E321-M324 WeakPolarHBondContact O-CB 3.31Å; E321-M324 PolarHBondContact O-N 3.38Å; E321-M324 VanDerWaalsContact O-N 3.16Å; M324-R326 VanDerWaalsContact C-N 3.32Å; M324-R326 PolarHBondContact O-N 3.42Å; M324-Q327 CarbonylContact O-C 3.51Å; M324-Q327 WeakPolarHBondContact O-CA 3.37Å; M324-Q327 WeakPolarHBondContact O-CB 3.28Å; M324-Q327 PolarHBondContact O-N 2.86Å; M324-E328 WeakPolarHBondContact O-CG 3.37Å; M324-E328 PolarHBondContact O-N 2.93Å
325	R	88.5	Confident	86.6	Confident	135 Å²	135	110.9 Å²	110.9	51%	0.509	49%	0.494	S	S	.	.	H	α-helix	trans	-57.8	-42.4	176.2	-160.3	177.2	78.6	-127.4	-7.8	112	E321 E322 Q327 E328 E329	E321-R325 WeakPolarHBondContact O-CB 3.49Å; E321-R325 PolarHBondContact O-N 3.46Å; E322-R325 IonicContact OE1-CZ 2.68Å; E322-R325 IonicContact OE1-NH2 3.96Å; E322-R325 PolarHBondContact OE1-NH2 3.02Å; E322-R325 IonicContact OE2-CZ 3.99Å; E322-R325 IonicContact OE2-NH1 2.64Å; E322-R325 PolarHBondContact OE2-NH1 3.24Å; E322-R325 IonicContact OE2-NH2 3.75Å; E322-R325 PolarHBondContact OE2-NH2 2.7Å; R325-Q327 VanDerWaalsContact C-N 3.34Å; R325-Q327 PolarHBondContact O-N 2.82Å; R325-E328 PolarHBondContact O-N 3.46Å; R325-E329 WeakPolarHBondContact O-CB 3.43Å; R325-E329 PolarHBondContact O-N 2.82Å
326	R	92.1	Very high	86.5	Confident	136 Å²	136	108.3 Å²	108.3	51%	0.513	48%	0.482	S	S	.	.	H	α-helix	trans	-65.9	-33.6	174	-71.9	179	-169.6	137.3	10.6	113.4	E322 M324 M330	E322-R326 VanDerWaalsContact CG-NH2 3.29Å; E322-R326 WeakPolarHBondContact O-CG 3.48Å; E322-R326 PolarHBondContact O-N 2.87Å; E322-R326 VanDerWaalsContact O-N 3.08Å; E322-R326 IonicContact OE1-CZ 3.65Å; E322-R326 IonicContact OE1-NE 2.84Å; E322-R326 IonicContact OE1-NH2 3.6Å; E322-R326 PolarHBondContact OE1-NH2 2.75Å; M324-R326 VanDerWaalsContact C-N 3.32Å; M324-R326 PolarHBondContact O-N 3.42Å; R326-M330 PolarHBondContact O-N 2.86Å
327	Q	83.5	Confident	86.9	Confident	129 Å²	129	108.8 Å²	108.8	60%	0.603	48%	0.481	S	S	*	.	H	α-helix	trans	-71	-40.5	174.7	-76.7	-177.6	-11.1	0	0	111.5	K323 M324 R325 M330 M331	K323-Q327 WeakPolarHBondContact O-CG 3.39Å; K323-Q327 PolarHBondContact O-N 2.84Å; M324-Q327 CarbonylContact O-C 3.51Å; M324-Q327 WeakPolarHBondContact O-CA 3.37Å; M324-Q327 WeakPolarHBondContact O-CB 3.28Å; M324-Q327 PolarHBondContact O-N 2.86Å; R325-Q327 VanDerWaalsContact C-N 3.34Å; R325-Q327 PolarHBondContact O-N 2.82Å; Q327-M330 PolarHBondContact O-N 3.3Å; Q327-M331 WeakPolarHBondContact O-CB 3.39Å; Q327-M331 VanDerWaalsContact O-CG 3.26Å; Q327-M331 WeakPolarHBondContact O-CG 3.43Å; Q327-M331 PolarHBondContact O-N 3.29Å
328	E	80.7	Confident	87.3	Confident	119 Å²	119	108.9 Å²	108.9	56%	0.556	48%	0.483	S	S	*	.	H	α-helix	trans	-62.7	-43.8	173.4	-71.7	173	174	0	0	111.2	M324 R325 M331 W332	M324-E328 WeakPolarHBondContact O-CG 3.37Å; M324-E328 PolarHBondContact O-N 2.93Å; R325-E328 PolarHBondContact O-N 3.46Å; E328-M331 WeakPolarHBondContact O-CB 3.35Å; E328-M331 PolarHBondContact O-N 3.08Å; E328-W332 WeakPolarHBondContact O-CB 3.5Å; E328-W332 PolarHBondContact O-N 3.18Å
329	E	90.4	Very high	87.2	Confident	109 Å²	109	106.9 Å²	106.9	51%	0.509	48%	0.475	S	S	.	.	H	α-helix	trans	-61.4	-46	175.3	-169.3	173.5	-162.5	0	0	111.5	R325 M331 W332 E333	R325-E329 WeakPolarHBondContact O-CB 3.43Å; R325-E329 PolarHBondContact O-N 2.82Å; E329-M331 VanDerWaalsContact C-N 3.33Å; E329-M331 PolarHBondContact O-N 3.03Å; E329-W332 PolarHBondContact O-N 3.43Å; E329-E333 WeakPolarHBondContact O-CG 3.4Å; E329-E333 PolarHBondContact O-N 3.32Å
330	M	82	Confident	87.3	Confident	107 Å²	107	106.7 Å²	106.7	53%	0.527	47%	0.474	S	S	.	.	H	α-helix	trans	-65.2	-33.6	173.9	-80.7	-142.6	-54.1	0	0	113.8	R326 Q327 K334	R326-M330 PolarHBondContact O-N 2.86Å; Q327-M330 PolarHBondContact O-N 3.3Å; M330-K334 WeakPolarHBondContact O-CG 3.26Å; M330-K334 PolarHBondContact O-N 2.85Å
331	M	83.1	Confident	87.4	Confident	104 Å²	104	105.9 Å²	105.9	51%	0.512	48%	0.475	S	S	.	.	H	α-helix	trans	-66.8	-45	174.4	-80.8	-73.2	-62.5	0	0	110.1	Q327 E328 E329 K334 E335	Q327-M331 WeakPolarHBondContact O-CB 3.39Å; Q327-M331 VanDerWaalsContact O-CG 3.26Å; Q327-M331 WeakPolarHBondContact O-CG 3.43Å; Q327-M331 PolarHBondContact O-N 3.29Å; E328-M331 WeakPolarHBondContact O-CB 3.35Å; E328-M331 PolarHBondContact O-N 3.08Å; E329-M331 VanDerWaalsContact C-N 3.33Å; E329-M331 PolarHBondContact O-N 3.03Å; M331-K334 WeakPolarHBondContact O-CB 3.44Å; M331-K334 PolarHBondContact O-N 3.28Å; M331-K334 VanDerWaalsContact O-N 3.1Å; M331-E335 WeakPolarHBondContact O-CG 3.35Å; M331-E335 PolarHBondContact O-N 2.97Å
332	W	91.8	Very high	87.5	Confident	144 Å²	144	105.7 Å²	105.7	55%	0.545	48%	0.475	S	S	.	.	H	α-helix	trans	-61.5	-45	177.9	-171	82.5	0	0	0	111.9	E328 E329 K334 E335 E336	E328-W332 WeakPolarHBondContact O-CB 3.5Å; E328-W332 PolarHBondContact O-N 3.18Å; E329-W332 PolarHBondContact O-N 3.43Å; W332-K334 VanDerWaalsContact C-N 3.26Å; W332-K334 PolarHBondContact O-N 2.9Å; W332-E335 PolarHBondContact O-N 2.84Å; W332-E336 VanDerWaalsContact CZ3-OE2 3.29Å; W332-E336 WeakPolarHBondContact CZ3-OE2 3.49Å; W332-E336 WeakPolarHBondContact O-CB 3.44Å; W332-E336 PolarHBondContact O-N 3.49Å
333	E	89.8	Confident	87.5	Confident	84 Å²	84	110.3 Å²	110.3	39%	0.393	50%	0.496	S	S	.	.	H	α-helix	trans	-60.3	-34.7	173.4	-74	-176.8	-174.7	0	0	112.9	E329 K337	E329-E333 WeakPolarHBondContact O-CG 3.4Å; E329-E333 PolarHBondContact O-N 3.32Å; E333-K337 VanDerWaalsContact O-CG 3.29Å; E333-K337 WeakPolarHBondContact O-CG 3.32Å; E333-K337 PolarHBondContact O-N 3.34Å
334	K	88.3	Confident	87.5	Confident	122 Å²	122	109.9 Å²	109.9	53%	0.53	49%	0.494	S	S	.	.	H	α-helix	trans	-72.4	-41.9	176.1	-76.3	176	-178.6	178.5	0	111.5	M330 M331 W332 E336 K337 I338	M330-K334 WeakPolarHBondContact O-CG 3.26Å; M330-K334 PolarHBondContact O-N 2.85Å; M331-K334 WeakPolarHBondContact O-CB 3.44Å; M331-K334 PolarHBondContact O-N 3.28Å; M331-K334 VanDerWaalsContact O-N 3.1Å; W332-K334 VanDerWaalsContact C-N 3.26Å; W332-K334 PolarHBondContact O-N 2.9Å; K334-E336 VanDerWaalsContact C-N 3.3Å; K334-K337 PolarHBondContact O-N 2.99Å; K334-I338 VanDerWaalsContact O-CG1 3.24Å; K334-I338 WeakPolarHBondContact O-CG1 3.44Å; K334-I338 PolarHBondContact O-N 3.01Å
335	E	81.6	Confident	87.3	Confident	90 Å²	90	111.3 Å²	111.3	42%	0.421	50%	0.501	S	S	.	.	H	α-helix	trans	-62.9	-38	174.6	-73.5	175.5	-176.1	0	0	111.4	M331 W332 I338 R339	M331-E335 WeakPolarHBondContact O-CG 3.35Å; M331-E335 PolarHBondContact O-N 2.97Å; W332-E335 PolarHBondContact O-N 2.84Å; E335-I338 PolarHBondContact O-N 3.37Å; E335-R339 WeakPolarHBondContact O-CB 3.41Å; E335-R339 PolarHBondContact O-N 3.38Å
336	E	87.8	Confident	87.1	Confident	73 Å²	73	110.3 Å²	110.3	34%	0.341	50%	0.502	S	S	.	.	H	α-helix	trans	-63.8	-47.2	173.5	-169.5	176.9	-154.6	0	0	111.6	W332 K334 I338 R339 E340	W332-E336 VanDerWaalsContact CZ3-OE2 3.29Å; W332-E336 WeakPolarHBondContact CZ3-OE2 3.49Å; W332-E336 WeakPolarHBondContact O-CB 3.44Å; W332-E336 PolarHBondContact O-N 3.49Å; K334-E336 VanDerWaalsContact C-N 3.3Å; E336-I338 VanDerWaalsContact C-N 3.31Å; E336-I338 PolarHBondContact O-N 3.46Å; E336-R339 WeakPolarHBondContact O-CB 3.36Å; E336-R339 PolarHBondContact O-N 3.34Å; E336-R339 VanDerWaalsContact O-N 3.16Å; E336-E340 PolarHBondContact O-N 2.93Å
337	K	93	Very high	86.9	Confident	119 Å²	119	109.6 Å²	109.6	52%	0.517	51%	0.505	S	S	.	.	H	α-helix	trans	-61.9	-36.7	174.6	-73.8	167.9	-174	162.2	0	112.8	E333 K334 L341	E333-K337 VanDerWaalsContact O-CG 3.29Å; E333-K337 WeakPolarHBondContact O-CG 3.32Å; E333-K337 PolarHBondContact O-N 3.34Å; K334-K337 PolarHBondContact O-N 2.99Å; K337-L341 WeakPolarHBondContact O-CB 3.47Å; K337-L341 VanDerWaalsContact O-CG 3.25Å; K337-L341 WeakPolarHBondContact O-CG 3.45Å; K337-L341 PolarHBondContact O-N 2.89Å
338	I	89.1	Confident	86.6	Confident	90 Å²	90	108.7 Å²	108.7	46%	0.462	50%	0.5	S	S	.	.	H	α-helix	trans	-64.2	-46.6	174.4	-71.6	164.7	0	0	0	109.8	K334 E335 E336 E340 L341 E342	K334-I338 VanDerWaalsContact O-CG1 3.24Å; K334-I338 WeakPolarHBondContact O-CG1 3.44Å; K334-I338 PolarHBondContact O-N 3.01Å; E335-I338 PolarHBondContact O-N 3.37Å; E336-I338 VanDerWaalsContact C-N 3.31Å; E336-I338 PolarHBondContact O-N 3.46Å; I338-E340 PolarHBondContact O-N 3.33Å; I338-L341 WeakPolarHBondContact O-CB 3.42Å; I338-L341 PolarHBondContact O-N 3.02Å; I338-L341 VanDerWaalsContact O-N 3.09Å; I338-E342 HydrophobicContact CG2-CG 4.32Å; I338-E342 WeakPolarHBondContact O-CG 3.4Å; I338-E342 PolarHBondContact O-N 2.72Å
339	R	89.1	Confident	86.6	Confident	113 Å²	113	107.9 Å²	107.9	43%	0.426	50%	0.496	S	S	.	.	H	α-helix	trans	-60	-44	178.1	-164.3	-179.6	-59.6	105.3	4.3	112	E335 E336 L341 E342 E343	E335-R339 WeakPolarHBondContact O-CB 3.41Å; E335-R339 PolarHBondContact O-N 3.38Å; E336-R339 WeakPolarHBondContact O-CB 3.36Å; E336-R339 PolarHBondContact O-N 3.34Å; E336-R339 VanDerWaalsContact O-N 3.16Å; R339-L341 VanDerWaalsContact C-N 3.32Å; R339-L341 PolarHBondContact O-N 3.4Å; R339-E342 PolarHBondContact O-N 3.35Å; R339-E343 WeakPolarHBondContact O-CG 3.48Å; R339-E343 PolarHBondContact O-N 2.9Å
340	E	89.8	Confident	86.4	Confident	90 Å²	90	109.1 Å²	109.1	42%	0.421	50%	0.5	S	S	.	.	H	α-helix	trans	-62.6	-37.6	174.1	-72	-174.2	-179.6	0	0	112.8	E336 I338 K344	E336-E340 PolarHBondContact O-N 2.93Å; I338-E340 PolarHBondContact O-N 3.33Å; E340-K344 WeakPolarHBondContact O-CB 3.46Å; E340-K344 VanDerWaalsContact O-CG 3.27Å; E340-K344 WeakPolarHBondContact O-CG 3.37Å; E340-K344 PolarHBondContact O-N 3.33Å; E340-K344 IonicContact OE2-NZ 2.7Å
341	L	86.9	Confident	86.7	Confident	107 Å²	107	109.5 Å²	109.5	56%	0.56	50%	0.503	S	S	*	.	H	α-helix	trans	-69.4	-38.5	176.3	-74.9	171.5	0	0	0	111.6	K337 I338 R339 K344 M345	K337-L341 WeakPolarHBondContact O-CB 3.47Å; K337-L341 VanDerWaalsContact O-CG 3.25Å; K337-L341 WeakPolarHBondContact O-CG 3.45Å; K337-L341 PolarHBondContact O-N 2.89Å; I338-L341 WeakPolarHBondContact O-CB 3.42Å; I338-L341 PolarHBondContact O-N 3.02Å; I338-L341 VanDerWaalsContact O-N 3.09Å; R339-L341 VanDerWaalsContact C-N 3.32Å; R339-L341 PolarHBondContact O-N 3.4Å; L341-K344 PolarHBondContact O-N 2.86Å; L341-M345 WeakPolarHBondContact O-CB 3.37Å; L341-M345 WeakPolarHBondContact O-CG 3.46Å; L341-M345 PolarHBondContact O-N 2.84Å
342	E	82.8	Confident	86.7	Confident	106 Å²	106	112.7 Å²	112.7	50%	0.495	51%	0.51	S	S	.	.	H	α-helix	trans	-64.6	-42.4	174.1	-73.4	175.8	169.3	0	0	111.4	I338 R339 M345 H346	I338-E342 HydrophobicContact CG2-CG 4.32Å; I338-E342 WeakPolarHBondContact O-CG 3.4Å; I338-E342 PolarHBondContact O-N 2.72Å; R339-E342 PolarHBondContact O-N 3.35Å; E342-M345 WeakPolarHBondContact O-CB 3.42Å; E342-M345 PolarHBondContact O-N 2.98Å; E342-H346 PolarHBondContact O-CD2 3.47Å; E342-H346 PolarHBondContact O-N 3.37Å
343	E	89	Confident	86.2	Confident	116 Å²	116	110.5 Å²	110.5	54%	0.542	51%	0.505	S	S	.	.	H	α-helix	trans	-61.2	-47.3	173.4	-75.5	179.9	-178.6	0	0	111.5	R339 M345 H346 E347	R339-E343 WeakPolarHBondContact O-CG 3.48Å; R339-E343 PolarHBondContact O-N 2.9Å; E343-M345 VanDerWaalsContact C-N 3.3Å; E343-M345 PolarHBondContact O-N 3.49Å; E343-H346 PolarHBondContact O-N 3.06Å; E343-E347 WeakPolarHBondContact O-CG 3.49Å; E343-E347 PolarHBondContact O-N 3.15Å
344	K	93.1	Very high	85.8	Confident	110 Å²	110	112 Å²	112	48%	0.478	51%	0.512	S	S	.	.	H	α-helix	trans	-61.4	-37.9	175.1	-74.5	167.7	-176	160.1	0	112.2	E340 L341 E347 Q348	E340-K344 WeakPolarHBondContact O-CB 3.46Å; E340-K344 VanDerWaalsContact O-CG 3.27Å; E340-K344 WeakPolarHBondContact O-CG 3.37Å; E340-K344 PolarHBondContact O-N 3.33Å; E340-K344 IonicContact OE2-NZ 2.7Å; L341-K344 PolarHBondContact O-N 2.86Å; K344-E347 PolarHBondContact O-N 3.04Å; K344-Q348 WeakPolarHBondContact O-CB 3.3Å; K344-Q348 WeakPolarHBondContact O-CG 3.45Å; K344-Q348 PolarHBondContact O-N 2.81Å
345	M	80.1	Confident	85.4	Confident	134 Å²	134	110.5 Å²	110.5	66%	0.66	51%	0.507	S	S	*	.	H	α-helix	trans	-64	-46.3	174.2	-83	-177.6	38.6	0	0	111.5	L341 E342 E343 E347 Q348 E349	L341-M345 WeakPolarHBondContact O-CB 3.37Å; L341-M345 WeakPolarHBondContact O-CG 3.46Å; L341-M345 PolarHBondContact O-N 2.84Å; E342-M345 WeakPolarHBondContact O-CB 3.42Å; E342-M345 PolarHBondContact O-N 2.98Å; E343-M345 VanDerWaalsContact C-N 3.3Å; E343-M345 PolarHBondContact O-N 3.49Å; M345-E347 VanDerWaalsContact C-N 3.34Å; M345-E347 PolarHBondContact O-N 3.33Å; M345-Q348 PolarHBondContact O-N 2.84Å; M345-E349 WeakPolarHBondContact O-CB 3.44Å; M345-E349 PolarHBondContact O-N 3.16Å
346	H	84.9	Confident	85.4	Confident	115 Å²	115	111.7 Å²	111.7	53%	0.532	51%	0.513	S	S	.	.	H	α-helix	trans	-64.7	-35.9	176.4	-81.6	-46.2	0	0	0	112.8	E342 E343 E349 K350	E342-H346 PolarHBondContact O-CD2 3.47Å; E342-H346 PolarHBondContact O-N 3.37Å; E343-H346 PolarHBondContact O-N 3.06Å; H346-E349 IonicContact ND1-OE2 3.74Å; H346-E349 PolarHBondContact ND1-OE2 2.98Å; H346-E349 PolarHBondContact O-N 3.04Å; H346-K350 WeakPolarHBondContact O-CG 3.32Å; H346-K350 PolarHBondContact O-N 2.87Å
347	E	87.4	Confident	85.3	Confident	121 Å²	121	114.2 Å²	114.2	57%	0.565	52%	0.523	S	S	*	.	H	α-helix	trans	-65.5	-44.8	172.4	-74	-178.2	168.3	0	0	111.7	E343 K344 M345 E349 K350 I351	E343-E347 WeakPolarHBondContact O-CG 3.49Å; E343-E347 PolarHBondContact O-N 3.15Å; K344-E347 PolarHBondContact O-N 3.04Å; M345-E347 VanDerWaalsContact C-N 3.34Å; M345-E347 PolarHBondContact O-N 3.33Å; E347-E349 VanDerWaalsContact C-N 3.31Å; E347-E349 PolarHBondContact O-N 3.36Å; E347-K350 PolarHBondContact O-N 3.45Å; E347-I351 VanDerWaalsContact O-CG1 3.31Å; E347-I351 WeakPolarHBondContact O-CG1 3.37Å; E347-I351 PolarHBondContact O-N 3.28Å
348	Q	77.9	Confident	85	Confident	109 Å²	109	116 Å²	116	51%	0.509	53%	0.526	S	S	.	.	H	α-helix	trans	-62.1	-38.8	174.1	-77.1	-164.1	18.9	0	0	112.2	K344 M345 I351 R352	K344-Q348 WeakPolarHBondContact O-CB 3.3Å; K344-Q348 WeakPolarHBondContact O-CG 3.45Å; K344-Q348 PolarHBondContact O-N 2.81Å; M345-Q348 PolarHBondContact O-N 2.84Å; Q348-I351 PolarHBondContact O-N 3.09Å; Q348-R352 VanDerWaalsContact O-CG 3.3Å; Q348-R352 WeakPolarHBondContact O-CG 3.49Å; Q348-R352 PolarHBondContact O-N 3Å
349	E	81	Confident	84.5	Confident	102 Å²	102	115.9 Å²	115.9	48%	0.477	52%	0.524	S	S	.	.	H	α-helix	trans	-64	-45.5	176.1	-171.6	170.7	-146.5	0	0	111.2	M345 H346 E347 I351 R352 E353	M345-E349 WeakPolarHBondContact O-CB 3.44Å; M345-E349 PolarHBondContact O-N 3.16Å; H346-E349 IonicContact ND1-OE2 3.74Å; H346-E349 PolarHBondContact ND1-OE2 2.98Å; H346-E349 PolarHBondContact O-N 3.04Å; E347-E349 VanDerWaalsContact C-N 3.31Å; E347-E349 PolarHBondContact O-N 3.36Å; E349-I351 VanDerWaalsContact C-N 3.31Å; E349-I351 PolarHBondContact O-N 3.15Å; E349-R352 WeakPolarHBondContact O-CB 3.25Å; E349-R352 PolarHBondContact O-N 3.44Å; E349-R352 VanDerWaalsContact O-N 3.12Å; E349-E353 WeakPolarHBondContact O-CG 3.5Å; E349-E353 PolarHBondContact O-N 3.34Å
350	K	85.9	Confident	84.1	Confident	136 Å²	136	115.3 Å²	115.3	59%	0.591	53%	0.526	S	S	*	.	H	α-helix	trans	-58.9	-40.9	173.6	-77.1	175.1	-177.3	170.2	0	112.7	H346 E347 Q354	H346-K350 WeakPolarHBondContact O-CG 3.32Å; H346-K350 PolarHBondContact O-N 2.87Å; E347-K350 PolarHBondContact O-N 3.45Å; K350-Q354 WeakPolarHBondContact O-CB 3.32Å; K350-Q354 WeakPolarHBondContact O-CG 3.48Å; K350-Q354 PolarHBondContact O-N 3.01Å
351	I	88.2	Confident	83.7	Confident	114 Å²	114	115.7 Å²	115.7	59%	0.585	53%	0.528	S	S	*	.	H	α-helix	trans	-65	-43.2	176.5	-67.2	165.3	0	0	0	110.1	E347 Q348 E349 Q354 E355	E347-I351 VanDerWaalsContact O-CG1 3.31Å; E347-I351 WeakPolarHBondContact O-CG1 3.37Å; E347-I351 PolarHBondContact O-N 3.28Å; Q348-I351 PolarHBondContact O-N 3.09Å; E349-I351 VanDerWaalsContact C-N 3.31Å; E349-I351 PolarHBondContact O-N 3.15Å; I351-Q354 PolarHBondContact O-N 2.83Å; I351-E355 WeakPolarHBondContact O-CB 3.26Å; I351-E355 PolarHBondContact O-N 2.69Å
352	R	82.3	Confident	83.7	Confident	172 Å²	172	116 Å²	116	65%	0.649	53%	0.526	S	S	*	.	H	α-helix	trans	-62.5	-45.6	176.7	-73.8	175.2	-171.8	-174.7	6.5	112.1	Q348 E349 Q354 E355 E356	Q348-R352 VanDerWaalsContact O-CG 3.3Å; Q348-R352 WeakPolarHBondContact O-CG 3.49Å; Q348-R352 PolarHBondContact O-N 3Å; E349-R352 WeakPolarHBondContact O-CB 3.25Å; E349-R352 PolarHBondContact O-N 3.44Å; E349-R352 VanDerWaalsContact O-N 3.12Å; R352-Q354 VanDerWaalsContact C-N 3.31Å; R352-Q354 PolarHBondContact O-N 2.88Å; R352-E355 PolarHBondContact O-N 2.85Å; R352-E356 WeakPolarHBondContact O-CB 3.42Å; R352-E356 PolarHBondContact O-N 3.41Å
353	E	81.5	Confident	83.8	Confident	98 Å²	98	117 Å²	117	46%	0.458	53%	0.529	S	S	.	.	H	α-helix	trans	-61.7	-39.1	176.1	-73.9	-175	174.5	0	0	112.1	E349 K357	E349-E353 WeakPolarHBondContact O-CG 3.5Å; E349-E353 PolarHBondContact O-N 3.34Å; E353-K357 WeakPolarHBondContact O-CB 3.41Å; E353-K357 WeakPolarHBondContact O-CG 3.49Å; E353-K357 PolarHBondContact O-N 3.32Å
354	Q	81.6	Confident	83.7	Confident	115 Å²	115	115.9 Å²	115.9	54%	0.537	53%	0.525	S	S	.	.	H	α-helix	trans	-66.5	-39.5	175.2	-77	-172.8	11.4	0	0	112.1	K350 I351 R352 R358	K350-Q354 WeakPolarHBondContact O-CB 3.32Å; K350-Q354 WeakPolarHBondContact O-CG 3.48Å; K350-Q354 PolarHBondContact O-N 3.01Å; I351-Q354 PolarHBondContact O-N 2.83Å; R352-Q354 VanDerWaalsContact C-N 3.31Å; R352-Q354 PolarHBondContact O-N 2.88Å; Q354-R358 VanDerWaalsContact O-CG 3.32Å; Q354-R358 WeakPolarHBondContact O-CG 3.31Å; Q354-R358 PolarHBondContact O-N 3.44Å
355	E	80.1	Confident	83.1	Confident	90 Å²	90	117.2 Å²	117.2	42%	0.421	53%	0.527	S	S	.	.	H	α-helix	trans	-68.8	-40.7	176.9	-175.4	56	-152.2	0	0	111.6	I351 R352 K357 R358 Q359	I351-E355 WeakPolarHBondContact O-CB 3.26Å; I351-E355 PolarHBondContact O-N 2.69Å; R352-E355 PolarHBondContact O-N 2.85Å; E355-K357 PolarHBondContact O-N 3.42Å; E355-R358 WeakPolarHBondContact O-CB 3.46Å; E355-R358 PolarHBondContact O-N 3.44Å; E355-Q359 WeakPolarHBondContact O-CG 3.49Å; E355-Q359 PolarHBondContact O-N 3.13Å; E355-Q359 PolarHBondContact OE1-NE2 2.93Å; E355-Q359 VanDerWaalsContact OE1-NE2 3.14Å
356	E	81.7	Confident	83.3	Confident	116 Å²	116	115.4 Å²	115.4	54%	0.542	52%	0.517	S	S	.	.	H	α-helix	trans	-61	-45.6	174.5	-172.8	169.3	-159.3	0	0	111.2	R352 R358 Q359 E360	R352-E356 WeakPolarHBondContact O-CB 3.42Å; R352-E356 PolarHBondContact O-N 3.41Å; E356-R358 VanDerWaalsContact C-N 3.33Å; E356-R358 PolarHBondContact O-N 2.99Å; E356-Q359 PolarHBondContact O-N 3.24Å; E356-E360 WeakPolarHBondContact O-CG 3.47Å; E356-E360 PolarHBondContact O-N 3.13Å
357	K	86.6	Confident	83.1	Confident	126 Å²	126	115.1 Å²	115.1	55%	0.548	52%	0.516	S	S	.	.	H	α-helix	trans	-58.9	-41.8	173.1	-77.3	174.7	-178.7	167.3	0	112.5	E353 E355 E360 E361	E353-K357 WeakPolarHBondContact O-CB 3.41Å; E353-K357 WeakPolarHBondContact O-CG 3.49Å; E353-K357 PolarHBondContact O-N 3.32Å; E355-K357 PolarHBondContact O-N 3.42Å; K357-E360 PolarHBondContact O-N 2.95Å; K357-E361 WeakPolarHBondContact O-CB 3.42Å; K357-E361 WeakPolarHBondContact O-CG 3.42Å; K357-E361 PolarHBondContact O-N 3.22Å
358	R	85.2	Confident	83	Confident	157 Å²	157	115 Å²	115	59%	0.592	52%	0.516	S	S	*	.	H	α-helix	trans	-62.8	-43.2	175.9	-74.5	177.5	-166.6	-153.1	7.6	111.7	Q354 E355 E356 E361 E362	Q354-R358 VanDerWaalsContact O-CG 3.32Å; Q354-R358 WeakPolarHBondContact O-CG 3.31Å; Q354-R358 PolarHBondContact O-N 3.44Å; E355-R358 WeakPolarHBondContact O-CB 3.46Å; E355-R358 PolarHBondContact O-N 3.44Å; E356-R358 VanDerWaalsContact C-N 3.33Å; E356-R358 PolarHBondContact O-N 2.99Å; R358-E361 PolarHBondContact O-N 3.11Å; R358-E362 WeakPolarHBondContact O-CB 3.43Å; R358-E362 PolarHBondContact O-N 3.27Å
359	Q	79.6	Confident	83.5	Confident	87 Å²	87	116.1 Å²	116.1	41%	0.407	52%	0.519	S	S	.	.	H	α-helix	trans	-67.5	-37.4	178.1	-71.1	-179.4	17.8	0	0	112.2	E355 E356 E362 K363	E355-Q359 WeakPolarHBondContact O-CG 3.49Å; E355-Q359 PolarHBondContact O-N 3.13Å; E355-Q359 PolarHBondContact OE1-NE2 2.93Å; E355-Q359 VanDerWaalsContact OE1-NE2 3.14Å; E356-Q359 PolarHBondContact O-N 3.24Å; Q359-E362 PolarHBondContact O-N 2.82Å; Q359-K363 WeakPolarHBondContact O-CB 3.49Å; Q359-K363 VanDerWaalsContact O-CG 3.26Å; Q359-K363 WeakPolarHBondContact O-CG 3.47Å; Q359-K363 PolarHBondContact O-N 3.3Å
360	E	80.5	Confident	83.6	Confident	100 Å²	100	118.8 Å²	118.8	47%	0.467	53%	0.525	S	S	.	.	H	α-helix	trans	-65.3	-45.9	173.3	-74.4	-176.1	161.2	0	0	111.8	E356 K357 E362 K363 I364	E356-E360 WeakPolarHBondContact O-CG 3.47Å; E356-E360 PolarHBondContact O-N 3.13Å; K357-E360 PolarHBondContact O-N 2.95Å; E360-E362 VanDerWaalsContact C-N 3.27Å; E360-E362 PolarHBondContact O-N 3.2Å; E360-K363 PolarHBondContact O-N 2.84Å; E360-I364 VanDerWaalsContact O-CG1 3.3Å; E360-I364 WeakPolarHBondContact O-CG1 3.49Å; E360-I364 PolarHBondContact O-N 2.99Å
361	E	81.9	Confident	83.3	Confident	99 Å²	99	117.3 Å²	117.3	46%	0.463	52%	0.52	S	S	.	.	H	α-helix	trans	-59.1	-39.3	173.5	-77.4	-174.4	-168.2	0	0	112.1	K357 R358 I364 R365	K357-E361 WeakPolarHBondContact O-CB 3.42Å; K357-E361 WeakPolarHBondContact O-CG 3.42Å; K357-E361 PolarHBondContact O-N 3.22Å; R358-E361 PolarHBondContact O-N 3.11Å; E361-I364 PolarHBondContact O-N 3.49Å; E361-R365 WeakPolarHBondContact O-CG 3.48Å; E361-R365 PolarHBondContact O-N 3.27Å; E361-R365 IonicContact OE2-CZ 3.43Å; E361-R365 IonicContact OE2-NH2 2.82Å; E361-R365 PolarHBondContact OE2-NH2 2.93Å
362	E	85.5	Confident	83.2	Confident	112 Å²	112	116.7 Å²	116.7	52%	0.523	51%	0.514	S	S	.	.	H	α-helix	trans	-65.9	-45.6	176.5	-173	169.6	-156.8	0	0	111.6	R358 Q359 E360 I364 R365 E366	R358-E362 WeakPolarHBondContact O-CB 3.43Å; R358-E362 PolarHBondContact O-N 3.27Å; Q359-E362 PolarHBondContact O-N 2.82Å; E360-E362 VanDerWaalsContact C-N 3.27Å; E360-E362 PolarHBondContact O-N 3.2Å; E362-I364 VanDerWaalsContact C-N 3.3Å; E362-I364 PolarHBondContact O-N 2.82Å; E362-R365 PolarHBondContact O-N 3.2Å; E362-E366 WeakPolarHBondContact O-CG 3.43Å; E362-E366 PolarHBondContact O-N 3.02Å
363	K	85.1	Confident	83.3	Confident	128 Å²	128	114.6 Å²	114.6	56%	0.557	51%	0.512	S	S	*	.	H	α-helix	trans	-57.9	-42.1	174.3	-74.3	168.5	-173	166.8	0	111.7	Q359 E360 E366 Q367	Q359-K363 WeakPolarHBondContact O-CB 3.49Å; Q359-K363 VanDerWaalsContact O-CG 3.26Å; Q359-K363 WeakPolarHBondContact O-CG 3.47Å; Q359-K363 PolarHBondContact O-N 3.3Å; E360-K363 PolarHBondContact O-N 2.84Å; K363-E366 PolarHBondContact O-N 3.2Å; K363-Q367 VanDerWaalsContact O-CB 3.27Å; K363-Q367 WeakPolarHBondContact O-CB 3.42Å; K363-Q367 PolarHBondContact O-N 2.92Å
364	I	87.9	Confident	83.4	Confident	92 Å²	92	115.8 Å²	115.8	47%	0.472	52%	0.518	S	S	.	.	H	α-helix	trans	-62.7	-48.2	176	-68.2	165.7	0	0	0	110.2	E360 E361 E362 E366 Q367 E368	E360-I364 VanDerWaalsContact O-CG1 3.3Å; E360-I364 WeakPolarHBondContact O-CG1 3.49Å; E360-I364 PolarHBondContact O-N 2.99Å; E361-I364 PolarHBondContact O-N 3.49Å; E362-I364 VanDerWaalsContact C-N 3.3Å; E362-I364 PolarHBondContact O-N 2.82Å; I364-E366 VanDerWaalsContact C-N 3.32Å; I364-E366 PolarHBondContact O-N 3.06Å; I364-Q367 WeakPolarHBondContact O-CB 3.29Å; I364-Q367 PolarHBondContact O-N 3.42Å; I364-E368 HydrophobicContact CG2-CG 4.45Å; I364-E368 WeakPolarHBondContact O-CG 3.39Å; I364-E368 PolarHBondContact O-N 2.88Å
365	R	79.2	Confident	83.8	Confident	138 Å²	138	112.1 Å²	112.1	52%	0.521	51%	0.507	S	S	.	.	H	α-helix	trans	-61.8	-38.1	177.8	-72.5	175	-169	141.9	14.5	112.5	E361 E362 K369	E361-R365 WeakPolarHBondContact O-CG 3.48Å; E361-R365 PolarHBondContact O-N 3.27Å; E361-R365 IonicContact OE2-CZ 3.43Å; E361-R365 IonicContact OE2-NH2 2.82Å; E361-R365 PolarHBondContact OE2-NH2 2.93Å; E362-R365 PolarHBondContact O-N 3.2Å; R365-K369 VanDerWaalsContact O-CG 3.31Å; R365-K369 WeakPolarHBondContact O-CG 3.44Å; R365-K369 PolarHBondContact O-N 2.88Å
366	E	85	Confident	84.3	Confident	96 Å²	96	112.3 Å²	112.3	45%	0.449	51%	0.506	S	S	.	.	H	α-helix	trans	-67.5	-41.6	174.7	-74.1	-166	158.5	0	0	112	E362 K363 I364 K369 R370	E362-E366 WeakPolarHBondContact O-CG 3.43Å; E362-E366 PolarHBondContact O-N 3.02Å; K363-E366 PolarHBondContact O-N 3.2Å; I364-E366 VanDerWaalsContact C-N 3.32Å; I364-E366 PolarHBondContact O-N 3.06Å; E366-K369 PolarHBondContact O-N 3.45Å; E366-R370 WeakPolarHBondContact O-CG 3.35Å; E366-R370 PolarHBondContact O-N 2.87Å
367	Q	81.4	Confident	84.1	Confident	109 Å²	109	112 Å²	112	51%	0.509	51%	0.506	S	S	.	.	H	α-helix	trans	-63	-42.9	175.6	-175.1	174.4	-8.9	0	0	111.1	K363 I364 K369 R370 Q371	K363-Q367 VanDerWaalsContact O-CB 3.27Å; K363-Q367 WeakPolarHBondContact O-CB 3.42Å; K363-Q367 PolarHBondContact O-N 2.92Å; I364-Q367 WeakPolarHBondContact O-CB 3.29Å; I364-Q367 PolarHBondContact O-N 3.42Å; Q367-K369 PolarHBondContact O-N 3.46Å; Q367-R370 PolarHBondContact O-N 3.26Å; Q367-Q371 WeakPolarHBondContact O-CB 3.46Å; Q367-Q371 WeakPolarHBondContact O-CG 3.47Å; Q367-Q371 PolarHBondContact O-N 3.49Å
368	E	84.1	Confident	84.1	Confident	119 Å²	119	112.7 Å²	112.7	56%	0.556	51%	0.505	S	S	*	.	H	α-helix	trans	-60.3	-43.2	173.8	-74.2	178.9	162.1	0	0	111.8	I364 R370 Q371 E372	I364-E368 HydrophobicContact CG2-CG 4.45Å; I364-E368 WeakPolarHBondContact O-CG 3.39Å; I364-E368 PolarHBondContact O-N 2.88Å; E368-R370 PolarHBondContact O-N 3.2Å; E368-Q371 PolarHBondContact O-N 3.44Å; E368-E372 WeakPolarHBondContact O-CB 3.45Å; E368-E372 PolarHBondContact O-N 2.92Å
369	K	88.7	Confident	84.2	Confident	133 Å²	133	111.4 Å²	111.4	58%	0.578	50%	0.5	S	S	*	.	H	α-helix	trans	-62.7	-41.5	175	-74.6	171.8	-174.5	172.7	0	112.2	R365 E366 Q367 E372 Q373	R365-K369 VanDerWaalsContact O-CG 3.31Å; R365-K369 WeakPolarHBondContact O-CG 3.44Å; R365-K369 PolarHBondContact O-N 2.88Å; E366-K369 PolarHBondContact O-N 3.45Å; Q367-K369 PolarHBondContact O-N 3.46Å; K369-E372 PolarHBondContact O-N 3.46Å; K369-Q373 WeakPolarHBondContact O-CG 3.44Å; K369-Q373 PolarHBondContact O-N 3.28Å
370	R	84.4	Confident	84.4	Confident	158 Å²	158	113.3 Å²	113.3	60%	0.596	51%	0.509	S	S	*	.	H	α-helix	trans	-63.7	-46.9	175.6	-74	174.7	-175.7	-95.4	1.2	110.8	E366 Q367 E368 E372 Q373 E374	E366-R370 WeakPolarHBondContact O-CG 3.35Å; E366-R370 PolarHBondContact O-N 2.87Å; Q367-R370 PolarHBondContact O-N 3.26Å; E368-R370 PolarHBondContact O-N 3.2Å; R370-E372 VanDerWaalsContact C-N 3.28Å; R370-E372 PolarHBondContact O-N 3.04Å; R370-Q373 WeakPolarHBondContact O-CB 3.42Å; R370-Q373 PolarHBondContact O-N 2.86Å; R370-Q373 VanDerWaalsContact O-N 3.13Å; R370-E374 WeakPolarHBondContact O-CB 3.22Å; R370-E374 WeakPolarHBondContact O-CG 3.26Å; R370-E374 PolarHBondContact O-N 3.06Å
371	Q	78.6	Confident	84.5	Confident	104 Å²	104	112.8 Å²	112.8	49%	0.486	51%	0.507	S	S	.	.	H	α-helix	trans	-60.4	-37.8	175.3	-73.5	-180	-8.6	0	0	111.9	Q367 E368 A375	Q367-Q371 WeakPolarHBondContact O-CB 3.46Å; Q367-Q371 WeakPolarHBondContact O-CG 3.47Å; Q367-Q371 PolarHBondContact O-N 3.49Å; E368-Q371 PolarHBondContact O-N 3.44Å; Q371-A375 VanDerWaalsContact O-CB 3.27Å; Q371-A375 WeakPolarHBondContact O-CB 3.39Å; Q371-A375 PolarHBondContact O-N 3.23Å
372	E	87	Confident	84.5	Confident	101 Å²	101	112.1 Å²	112.1	47%	0.472	50%	0.504	S	S	.	.	H	α-helix	trans	-67.5	-38.6	175.4	-160.2	-162.6	155	0	0	112.1	E368 K369 R370 K376	E368-E372 WeakPolarHBondContact O-CB 3.45Å; E368-E372 PolarHBondContact O-N 2.92Å; K369-E372 PolarHBondContact O-N 3.46Å; R370-E372 VanDerWaalsContact C-N 3.28Å; R370-E372 PolarHBondContact O-N 3.04Å; E372-K376 VanDerWaalsContact O-CG 3.29Å; E372-K376 WeakPolarHBondContact O-CG 3.35Å; E372-K376 PolarHBondContact O-N 3.48Å; E372-K376 WeakPolarHBondContact OE1-CE 3.46Å; E372-K376 IonicContact OE1-NZ 3.81Å; E372-K376 PolarHBondContact OE1-NZ 2.92Å; E372-K376 IonicContact OE2-NZ 3.58Å
373	Q	83	Confident	84.7	Confident	128 Å²	128	113.1 Å²	113.1	60%	0.598	51%	0.507	S	S	*	.	H	α-helix	trans	-67.3	-44.3	174.4	-73.9	-177.9	0.2	0	0	111.9	K369 R370 A375 K376 M377	K369-Q373 WeakPolarHBondContact O-CG 3.44Å; K369-Q373 PolarHBondContact O-N 3.28Å; R370-Q373 WeakPolarHBondContact O-CB 3.42Å; R370-Q373 PolarHBondContact O-N 2.86Å; R370-Q373 VanDerWaalsContact O-N 3.13Å; Q373-A375 VanDerWaalsContact C-N 3.34Å; Q373-A375 PolarHBondContact O-N 3.15Å; Q373-K376 WeakPolarHBondContact O-CB 3.41Å; Q373-K376 PolarHBondContact O-N 3.44Å; Q373-K376 VanDerWaalsContact O-N 3.13Å; Q373-M377 PolarHBondContact O-N 3.37Å
374	E	84.7	Confident	84.7	Confident	124 Å²	124	111.4 Å²	111.4	58%	0.579	50%	0.502	S	S	*	.	H	α-helix	trans	-59.7	-44.4	173.6	-74.8	172.7	-174.8	0	0	110.7	R370 K376 M377 W378	R370-E374 WeakPolarHBondContact O-CB 3.22Å; R370-E374 WeakPolarHBondContact O-CG 3.26Å; R370-E374 PolarHBondContact O-N 3.06Å; E374-K376 VanDerWaalsContact C-N 3.31Å; E374-K376 PolarHBondContact O-N 3.16Å; E374-M377 PolarHBondContact O-N 2.84Å; E374-W378 WeakPolarHBondContact O-CB 3.49Å; E374-W378 PolarHBondContact O-N 3.46Å
375	A	88.9	Confident	84.5	Confident	37 Å²	37	114.6 Å²	114.6	31%	0.306	51%	0.509	S	S	.	.	H	α-helix	trans	-63	-35.4	174.5	0	0	0	0	0	112.5	Q371 Q373 R379	Q371-A375 VanDerWaalsContact O-CB 3.27Å; Q371-A375 WeakPolarHBondContact O-CB 3.39Å; Q371-A375 PolarHBondContact O-N 3.23Å; Q373-A375 VanDerWaalsContact C-N 3.34Å; Q373-A375 PolarHBondContact O-N 3.15Å; A375-R379 VanDerWaalsContact O-CG 3.3Å; A375-R379 WeakPolarHBondContact O-CG 3.45Å; A375-R379 PolarHBondContact O-N 2.92Å
376	K	91	Very high	84.7	Confident	94 Å²	94	112.7 Å²	112.7	41%	0.409	51%	0.506	S	S	.	.	H	α-helix	trans	-68.2	-43.8	173.7	-76.3	167.6	-173.9	163.1	0	111.7	E372 Q373 E374 R379 Q380	E372-K376 VanDerWaalsContact O-CG 3.29Å; E372-K376 WeakPolarHBondContact O-CG 3.35Å; E372-K376 PolarHBondContact O-N 3.48Å; E372-K376 WeakPolarHBondContact OE1-CE 3.46Å; E372-K376 IonicContact OE1-NZ 3.81Å; E372-K376 PolarHBondContact OE1-NZ 2.92Å; E372-K376 IonicContact OE2-NZ 3.58Å; Q373-K376 WeakPolarHBondContact O-CB 3.41Å; Q373-K376 PolarHBondContact O-N 3.44Å; Q373-K376 VanDerWaalsContact O-N 3.13Å; E374-K376 VanDerWaalsContact C-N 3.31Å; E374-K376 PolarHBondContact O-N 3.16Å; K376-R379 PolarHBondContact O-N 2.92Å; K376-Q380 WeakPolarHBondContact O-CG 3.44Å; K376-Q380 PolarHBondContact O-N 3.37Å; K376-Q380 VanDerWaalsContact O-N 3.13Å
377	M	77.7	Confident	84.6	Confident	109 Å²	109	114.3 Å²	114.3	54%	0.537	51%	0.513	S	S	.	.	H	α-helix	trans	-61	-46.6	174.4	-73.9	-142.8	-50.9	0	0	110.7	Q373 E374 R379 Q380 E381	Q373-M377 PolarHBondContact O-N 3.37Å; E374-M377 PolarHBondContact O-N 2.84Å; M377-R379 VanDerWaalsContact C-N 3.33Å; M377-R379 PolarHBondContact O-N 2.97Å; M377-Q380 CarbonylContact O-C 3.57Å; M377-Q380 WeakPolarHBondContact O-CA 3.45Å; M377-Q380 WeakPolarHBondContact O-CB 3.39Å; M377-Q380 PolarHBondContact O-N 3.14Å; M377-E381 PolarHBondContact O-N 2.86Å
378	W	86.4	Confident	84.6	Confident	141 Å²	141	113 Å²	113	53%	0.534	51%	0.507	S	S	.	.	H	α-helix	trans	-59.4	-42.6	179.4	-166.8	84.6	0	0	0	111.9	E374 Q380 E381 E382	E374-W378 WeakPolarHBondContact O-CB 3.49Å; E374-W378 PolarHBondContact O-N 3.46Å; W378-Q380 VanDerWaalsContact C-N 3.26Å; W378-Q380 PolarHBondContact O-N 3.04Å; W378-E381 PolarHBondContact O-N 2.7Å; W378-E382 WeakPolarHBondContact CZ3-OE2 3.32Å; W378-E382 WeakPolarHBondContact O-CB 3.39Å; W378-E382 PolarHBondContact O-N 3.08Å
379	R	87.9	Confident	84.6	Confident	130 Å²	130	113.2 Å²	113.2	49%	0.491	51%	0.508	S	S	.	.	H	α-helix	trans	-63.6	-27.9	172.5	-71.6	-178.9	-146	124	0.1	113.7	A375 K376 M377 K383	A375-R379 VanDerWaalsContact O-CG 3.3Å; A375-R379 WeakPolarHBondContact O-CG 3.45Å; A375-R379 PolarHBondContact O-N 2.92Å; K376-R379 PolarHBondContact O-N 2.92Å; M377-R379 VanDerWaalsContact C-N 3.33Å; M377-R379 PolarHBondContact O-N 2.97Å; R379-K383 WeakPolarHBondContact O-CD 3.38Å; R379-K383 VanDerWaalsContact O-CG 3.3Å; R379-K383 WeakPolarHBondContact O-CG 3.39Å; R379-K383 PolarHBondContact O-N 3.35Å
380	Q	83.5	Confident	84.6	Confident	127 Å²	127	112.7 Å²	112.7	59%	0.593	51%	0.506	S	S	*	.	H	α-helix	trans	-77.9	-44.3	174.1	-72.1	-177.2	-3	0	0	111	K376 M377 W378 E382 K383 I384	K376-Q380 WeakPolarHBondContact O-CG 3.44Å; K376-Q380 PolarHBondContact O-N 3.37Å; K376-Q380 VanDerWaalsContact O-N 3.13Å; M377-Q380 CarbonylContact O-C 3.57Å; M377-Q380 WeakPolarHBondContact O-CA 3.45Å; M377-Q380 WeakPolarHBondContact O-CB 3.39Å; M377-Q380 PolarHBondContact O-N 3.14Å; W378-Q380 VanDerWaalsContact C-N 3.26Å; W378-Q380 PolarHBondContact O-N 3.04Å; Q380-E382 VanDerWaalsContact C-N 3.3Å; Q380-E382 PolarHBondContact O-N 3.44Å; Q380-K383 WeakPolarHBondContact O-CB 3.26Å; Q380-K383 PolarHBondContact O-N 3.34Å; Q380-I384 WeakPolarHBondContact O-CG1 3.48Å; Q380-I384 PolarHBondContact O-N 3.37Å
381	E	81.6	Confident	84.8	Confident	90 Å²	90	109.3 Å²	109.3	42%	0.421	50%	0.499	S	S	.	.	H	α-helix	trans	-59.4	-40.3	174.4	-72.8	-178.5	175.1	0	0	111.7	M377 W378 I384 R385	M377-E381 PolarHBondContact O-N 2.86Å; W378-E381 PolarHBondContact O-N 2.7Å; E381-I384 PolarHBondContact O-N 3.1Å; E381-R385 WeakPolarHBondContact O-CB 3.47Å; E381-R385 WeakPolarHBondContact O-CG 3.29Å; E381-R385 PolarHBondContact O-N 3.3Å
382	E	82.9	Confident	84.9	Confident	85 Å²	85	111 Å²	111	40%	0.397	50%	0.501	S	S	.	.	H	α-helix	trans	-60.9	-44.8	174.9	-170.8	177.4	-149.3	0	0	111.2	W378 Q380 I384 R385 E386	W378-E382 WeakPolarHBondContact CZ3-OE2 3.32Å; W378-E382 WeakPolarHBondContact O-CB 3.39Å; W378-E382 PolarHBondContact O-N 3.08Å; Q380-E382 VanDerWaalsContact C-N 3.3Å; Q380-E382 PolarHBondContact O-N 3.44Å; E382-I384 VanDerWaalsContact C-N 3.35Å; E382-I384 PolarHBondContact O-N 2.89Å; E382-R385 PolarHBondContact O-N 3.04Å; E382-E386 WeakPolarHBondContact O-CG 3.46Å; E382-E386 PolarHBondContact O-N 2.87Å
383	K	88.9	Confident	84.5	Confident	133 Å²	133	111 Å²	111	58%	0.578	50%	0.5	S	S	*	.	H	α-helix	trans	-63.9	-38.1	174.5	-71	172	-174.9	-179.6	0	112.8	R379 Q380 Q387	R379-K383 WeakPolarHBondContact O-CD 3.38Å; R379-K383 VanDerWaalsContact O-CG 3.3Å; R379-K383 WeakPolarHBondContact O-CG 3.39Å; R379-K383 PolarHBondContact O-N 3.35Å; Q380-K383 WeakPolarHBondContact O-CB 3.26Å; Q380-K383 PolarHBondContact O-N 3.34Å; K383-Q387 WeakPolarHBondContact O-CG 3.48Å; K383-Q387 PolarHBondContact O-N 2.86Å
384	I	86.6	Confident	84.3	Confident	91 Å²	91	111.1 Å²	111.1	47%	0.467	50%	0.501	S	S	.	.	H	α-helix	trans	-64.5	-47	175.2	-68.2	166.9	0	0	0	109.3	Q380 E381 E382 E386 Q387 E388	Q380-I384 WeakPolarHBondContact O-CG1 3.48Å; Q380-I384 PolarHBondContact O-N 3.37Å; E381-I384 PolarHBondContact O-N 3.1Å; E382-I384 VanDerWaalsContact C-N 3.35Å; E382-I384 PolarHBondContact O-N 2.89Å; I384-E386 VanDerWaalsContact C-N 3.34Å; I384-E386 PolarHBondContact O-N 2.85Å; I384-Q387 CarbonylContact O-C 3.6Å; I384-Q387 PolarHBondContact O-N 2.92Å; I384-Q387 VanDerWaalsContact O-N 3.07Å; I384-E388 HydrophobicContact CG2-CG 4.3Å; I384-E388 WeakPolarHBondContact O-CG 3.43Å; I384-E388 PolarHBondContact O-N 3.2Å
385	R	82.4	Confident	84	Confident	160 Å²	160	110.2 Å²	110.2	60%	0.604	50%	0.497	S	S	*	.	H	α-helix	trans	-58.2	-43.8	176.1	-76.5	-180	-177.6	171.2	3.9	112.1	E381 E382 Q387 E388 E389	E381-R385 WeakPolarHBondContact O-CB 3.47Å; E381-R385 WeakPolarHBondContact O-CG 3.29Å; E381-R385 PolarHBondContact O-N 3.3Å; E382-R385 PolarHBondContact O-N 3.04Å; R385-Q387 VanDerWaalsContact C-N 3.32Å; R385-Q387 PolarHBondContact O-N 3.41Å; R385-E388 PolarHBondContact O-N 3.47Å; R385-E389 WeakPolarHBondContact O-CB 3.43Å; R385-E389 PolarHBondContact O-N 3.29Å
386	E	83.6	Confident	83.8	Confident	98 Å²	98	115 Å²	115	46%	0.458	51%	0.51	S	S	.	.	H	α-helix	trans	-62.6	-37.3	174.6	-74.1	-177.2	-178.4	0	0	112.6	E382 I384 K390	E382-E386 WeakPolarHBondContact O-CG 3.46Å; E382-E386 PolarHBondContact O-N 2.87Å; I384-E386 VanDerWaalsContact C-N 3.34Å; I384-E386 PolarHBondContact O-N 2.85Å; E386-K390 WeakPolarHBondContact O-CG 3.43Å; E386-K390 PolarHBondContact O-N 2.95Å; E386-K390 VanDerWaalsContact O-N 3.14Å
387	Q	83.1	Confident	83.4	Confident	130 Å²	130	116.6 Å²	116.6	61%	0.607	52%	0.517	S	S	*	.	H	α-helix	trans	-70.6	-42.7	175.3	-74.9	-165.5	0.5	0	0	112	K383 I384 R385 E389 K390 I391	K383-Q387 WeakPolarHBondContact O-CG 3.48Å; K383-Q387 PolarHBondContact O-N 2.86Å; I384-Q387 CarbonylContact O-C 3.6Å; I384-Q387 PolarHBondContact O-N 2.92Å; I384-Q387 VanDerWaalsContact O-N 3.07Å; R385-Q387 VanDerWaalsContact C-N 3.32Å; R385-Q387 PolarHBondContact O-N 3.41Å; Q387-E389 VanDerWaalsContact C-N 3.29Å; Q387-E389 PolarHBondContact O-N 3.45Å; Q387-K390 WeakPolarHBondContact O-CB 3.4Å; Q387-K390 PolarHBondContact O-N 3.31Å; Q387-I391 VanDerWaalsContact O-CG1 3.32Å; Q387-I391 WeakPolarHBondContact O-CG1 3.48Å; Q387-I391 PolarHBondContact O-N 3.18Å
388	E	81.9	Confident	82.9	Confident	82 Å²	82	116.5 Å²	116.5	38%	0.383	52%	0.517	S	S	.	.	H	α-helix	trans	-59.7	-40.5	173.4	-75.1	-175.4	-170.8	0	0	111.5	I384 R385 I391 R392	I384-E388 HydrophobicContact CG2-CG 4.3Å; I384-E388 WeakPolarHBondContact O-CG 3.43Å; I384-E388 PolarHBondContact O-N 3.2Å; R385-E388 PolarHBondContact O-N 3.47Å; E388-I391 PolarHBondContact O-N 2.9Å; E388-R392 WeakPolarHBondContact O-CB 3.25Å; E388-R392 VanDerWaalsContact O-CG 3.3Å; E388-R392 WeakPolarHBondContact O-CG 3.47Å; E388-R392 PolarHBondContact O-N 3.2Å; E388-R392 IonicContact OE2-CZ 3.34Å; E388-R392 IonicContact OE2-NH2 3.83Å; E388-R392 PolarHBondContact OE2-NH2 2.95Å
389	E	84.2	Confident	82.4	Confident	122 Å²	122	117.2 Å²	117.2	57%	0.57	52%	0.52	S	S	*	.	H	α-helix	trans	-64.3	-41.9	177.2	-165.7	173.4	-164.5	0	0	111.2	R385 Q387 I391 R392 E393	R385-E389 WeakPolarHBondContact O-CB 3.43Å; R385-E389 PolarHBondContact O-N 3.29Å; Q387-E389 VanDerWaalsContact C-N 3.29Å; Q387-E389 PolarHBondContact O-N 3.45Å; E389-I391 PolarHBondContact O-N 3.46Å; E389-R392 PolarHBondContact O-N 3.39Å; E389-E393 WeakPolarHBondContact O-CG 3.45Å; E389-E393 PolarHBondContact O-N 3.38Å
390	K	88.7	Confident	81.8	Confident	123 Å²	123	118.8 Å²	118.8	54%	0.535	53%	0.526	S	S	.	.	H	α-helix	trans	-62.3	-40.1	172.5	-71.9	167.7	-172.7	163.3	0	112.4	E386 Q387 E393 Q394	E386-K390 WeakPolarHBondContact O-CG 3.43Å; E386-K390 PolarHBondContact O-N 2.95Å; E386-K390 VanDerWaalsContact O-N 3.14Å; Q387-K390 WeakPolarHBondContact O-CB 3.4Å; Q387-K390 PolarHBondContact O-N 3.31Å; K390-E393 PolarHBondContact O-N 3.42Å; K390-Q394 WeakPolarHBondContact O-CG 3.46Å; K390-Q394 PolarHBondContact O-N 2.9Å
391	I	87.7	Confident	81	Confident	87 Å²	87	118.9 Å²	118.9	45%	0.446	53%	0.526	S	S	.	.	H	α-helix	trans	-63.7	-49.9	175.1	-69.2	166	0	0	0	109.7	Q387 E388 E389 E393 Q394 E395	Q387-I391 VanDerWaalsContact O-CG1 3.32Å; Q387-I391 WeakPolarHBondContact O-CG1 3.48Å; Q387-I391 PolarHBondContact O-N 3.18Å; E388-I391 PolarHBondContact O-N 2.9Å; E389-I391 PolarHBondContact O-N 3.46Å; I391-E393 VanDerWaalsContact C-N 3.26Å; I391-E393 PolarHBondContact O-N 3Å; I391-Q394 CarbonylContact O-C 3.56Å; I391-Q394 WeakPolarHBondContact O-CA 3.24Å; I391-Q394 WeakPolarHBondContact O-CB 3.44Å; I391-Q394 PolarHBondContact O-N 2.86Å; I391-E395 HydrophobicContact CG2-CG 4.25Å; I391-E395 WeakPolarHBondContact O-CG 3.42Å; I391-E395 PolarHBondContact O-N 2.85Å
392	R	80.7	Confident	80.4	Confident	140 Å²	140	119.7 Å²	119.7	53%	0.528	53%	0.53	S	S	.	.	H	α-helix	trans	-59	-36.5	177.1	-71.5	178.8	-152.7	167.9	8.7	112	E388 E389 K396	E388-R392 WeakPolarHBondContact O-CB 3.25Å; E388-R392 VanDerWaalsContact O-CG 3.3Å; E388-R392 WeakPolarHBondContact O-CG 3.47Å; E388-R392 PolarHBondContact O-N 3.2Å; E388-R392 IonicContact OE2-CZ 3.34Å; E388-R392 IonicContact OE2-NH2 3.83Å; E388-R392 PolarHBondContact OE2-NH2 2.95Å; E389-R392 PolarHBondContact O-N 3.39Å; R392-K396 WeakPolarHBondContact O-CB 3.41Å; R392-K396 VanDerWaalsContact O-CG 3.26Å; R392-K396 WeakPolarHBondContact O-CG 3.33Å; R392-K396 PolarHBondContact O-N 3.29Å
393	E	79.8	Confident	79.8	Confident	100 Å²	100	120.1 Å²	120.1	47%	0.467	53%	0.532	S	S	.	.	H	α-helix	trans	-67.6	-38.9	172.9	-77.7	-169.3	169.2	0	0	113	E389 K390 I391 K397	E389-E393 WeakPolarHBondContact O-CG 3.45Å; E389-E393 PolarHBondContact O-N 3.38Å; K390-E393 PolarHBondContact O-N 3.42Å; I391-E393 VanDerWaalsContact C-N 3.26Å; I391-E393 PolarHBondContact O-N 3Å; E393-K397 WeakPolarHBondContact O-CG 3.39Å; E393-K397 PolarHBondContact O-N 2.84Å; E393-K397 VanDerWaalsContact O-N 3.08Å
394	Q	78.3	Confident	79	Confident	130 Å²	130	120.3 Å²	120.3	61%	0.607	53%	0.533	S	S	*	.	H	α-helix	trans	-66.7	-42.3	173.7	-75.4	-170.9	-15	0	0	111.7	K390 I391 K397 M398	K390-Q394 WeakPolarHBondContact O-CG 3.46Å; K390-Q394 PolarHBondContact O-N 2.9Å; I391-Q394 CarbonylContact O-C 3.56Å; I391-Q394 WeakPolarHBondContact O-CA 3.24Å; I391-Q394 WeakPolarHBondContact O-CB 3.44Å; I391-Q394 PolarHBondContact O-N 2.86Å; Q394-K397 CarbonylContact O-C 3.57Å; Q394-K397 WeakPolarHBondContact O-CA 3.41Å; Q394-K397 WeakPolarHBondContact O-CB 3.46Å; Q394-K397 PolarHBondContact O-N 3.42Å; Q394-K397 VanDerWaalsContact O-N 3.09Å; Q394-M398 PolarHBondContact O-N 3.4Å
395	E	79	Confident	78.2	Confident	106 Å²	106	121 Å²	121	50%	0.495	54%	0.536	S	S	.	.	H	α-helix	trans	-60.2	-45.2	173.6	-72.8	176.3	162	0	0	111	I391 K397 M398 W399	I391-E395 HydrophobicContact CG2-CG 4.25Å; I391-E395 WeakPolarHBondContact O-CG 3.42Å; I391-E395 PolarHBondContact O-N 2.85Å; E395-K397 PolarHBondContact O-N 3.09Å; E395-M398 PolarHBondContact O-N 3.35Å; E395-W399 WeakPolarHBondContact O-CB 3.41Å; E395-W399 PolarHBondContact O-N 3.26Å
396	K	83.5	Confident	77.4	Confident	136 Å²	136	119.4 Å²	119.4	59%	0.591	54%	0.535	S	S	*	.	H	α-helix	trans	-58.8	-36.5	173.3	-77.2	172.4	-177.1	174.9	0	112.2	R392 R400	R392-K396 WeakPolarHBondContact O-CB 3.41Å; R392-K396 VanDerWaalsContact O-CG 3.26Å; R392-K396 WeakPolarHBondContact O-CG 3.33Å; R392-K396 PolarHBondContact O-N 3.29Å; K396-R400 VanDerWaalsContact O-CG 3.28Å; K396-R400 WeakPolarHBondContact O-CG 3.42Å; K396-R400 PolarHBondContact O-N 2.84Å; K396-R400 VanDerWaalsContact O-N 3.11Å
397	K	83.3	Confident	76.5	Confident	128 Å²	128	120.5 Å²	120.5	56%	0.557	54%	0.541	S	S	*	.	H	α-helix	trans	-71.3	-42.3	176.1	-73.1	169.4	-172.8	166.9	0	111.7	E393 Q394 E395 R400 Q401	E393-K397 WeakPolarHBondContact O-CG 3.39Å; E393-K397 PolarHBondContact O-N 2.84Å; E393-K397 VanDerWaalsContact O-N 3.08Å; Q394-K397 CarbonylContact O-C 3.57Å; Q394-K397 WeakPolarHBondContact O-CA 3.41Å; Q394-K397 WeakPolarHBondContact O-CB 3.46Å; Q394-K397 PolarHBondContact O-N 3.42Å; Q394-K397 VanDerWaalsContact O-N 3.09Å; E395-K397 PolarHBondContact O-N 3.09Å; K397-R400 PolarHBondContact O-N 2.97Å; K397-Q401 WeakPolarHBondContact O-CG 3.46Å; K397-Q401 PolarHBondContact O-N 3.43Å; K397-Q401 VanDerWaalsContact O-N 3.14Å
398	M	67.2	Low	75.3	Confident	107 Å²	107	119.6 Å²	119.6	53%	0.527	54%	0.536	S	S	.	.	H	α-helix	trans	-62	-46.7	173.9	-72.4	-153.6	-48.8	0	0	110.8	Q394 E395 R400 Q401 E402	Q394-M398 PolarHBondContact O-N 3.4Å; E395-M398 PolarHBondContact O-N 3.35Å; M398-R400 VanDerWaalsContact C-N 3.31Å; M398-R400 PolarHBondContact O-N 2.88Å; M398-Q401 CarbonylContact O-C 3.6Å; M398-Q401 WeakPolarHBondContact O-CA 3.39Å; M398-Q401 WeakPolarHBondContact O-CB 3.39Å; M398-Q401 PolarHBondContact O-N 2.91Å; M398-E402 PolarHBondContact O-N 3.47Å
399	W	75.6	Confident	74.4	Confident	156 Å²	156	120.1 Å²	120.1	59%	0.591	54%	0.539	S	S	*	.	H	α-helix	trans	-60.8	-41	179.8	-159.3	82.6	0	0	0	111.6	E395 Q401 E402 E403	E395-W399 WeakPolarHBondContact O-CB 3.41Å; E395-W399 PolarHBondContact O-N 3.26Å; W399-Q401 PolarHBondContact O-N 2.98Å; W399-E402 PolarHBondContact O-N 3.14Å; W399-E403 HydrophobicContact CZ3-CB 4.46Å; W399-E403 HydrophobicContact CZ3-CG 4.42Å; W399-E403 WeakPolarHBondContact CZ3-OE2 3.44Å; W399-E403 VanDerWaalsContact O-CB 3.29Å; W399-E403 WeakPolarHBondContact O-CB 3.35Å; W399-E403 PolarHBondContact O-N 3.43Å
400	R	75.4	Confident	73.6	Confident	164 Å²	164	121.1 Å²	121.1	62%	0.619	54%	0.541	S	S	*	.	H	α-helix	trans	-65.3	-23	171.4	-72	179.9	-162.4	-158.4	5.5	114	K396 K397 M398 K404	K396-R400 VanDerWaalsContact O-CG 3.28Å; K396-R400 WeakPolarHBondContact O-CG 3.42Å; K396-R400 PolarHBondContact O-N 2.84Å; K396-R400 VanDerWaalsContact O-N 3.11Å; K397-R400 PolarHBondContact O-N 2.97Å; M398-R400 VanDerWaalsContact C-N 3.31Å; M398-R400 PolarHBondContact O-N 2.88Å; R400-K404 WeakPolarHBondContact O-CD 3.48Å; R400-K404 VanDerWaalsContact O-CG 3.29Å; R400-K404 WeakPolarHBondContact O-CG 3.39Å
401	Q	66.9	Low	72.1	Confident	128 Å²	128	120.6 Å²	120.6	60%	0.598	54%	0.543	S	S	*	.	H	α-helix	trans	-82.7	-42.5	172.8	-73	-178.2	-1	0	0	111.1	K397 M398 W399 E403 K404 I405	K397-Q401 WeakPolarHBondContact O-CG 3.46Å; K397-Q401 PolarHBondContact O-N 3.43Å; K397-Q401 VanDerWaalsContact O-N 3.14Å; M398-Q401 CarbonylContact O-C 3.6Å; M398-Q401 WeakPolarHBondContact O-CA 3.39Å; M398-Q401 WeakPolarHBondContact O-CB 3.39Å; M398-Q401 PolarHBondContact O-N 2.91Å; W399-Q401 PolarHBondContact O-N 2.98Å; Q401-E403 VanDerWaalsContact C-N 3.35Å; Q401-K404 WeakPolarHBondContact O-CB 3.27Å; Q401-K404 PolarHBondContact O-N 3.47Å; Q401-I405 WeakPolarHBondContact O-CG1 3.41Å; Q401-I405 PolarHBondContact O-N 3.05Å
402	E	68	Low	70.3	Confident	108 Å²	108	123.3 Å²	123.3	51%	0.505	55%	0.548	S	S	.	.	H	α-helix	trans	-60.3	-43.4	173.6	-75.1	179.7	166.4	0	0	111.3	M398 W399 K404 I405 H406	M398-E402 PolarHBondContact O-N 3.47Å; W399-E402 PolarHBondContact O-N 3.14Å; E402-K404 VanDerWaalsContact C-N 3.28Å; E402-K404 PolarHBondContact O-N 2.86Å; E402-I405 CarbonylContact O-C 3.57Å; E402-I405 WeakPolarHBondContact O-CB 3.39Å; E402-I405 PolarHBondContact O-N 3.48Å; E402-I405 VanDerWaalsContact O-N 3.08Å; E402-H406 WeakPolarHBondContact O-CB 3.4Å; E402-H406 PolarHBondContact O-N 2.88Å
403	E	70.9	Confident	69.4	Low	93 Å²	93	122.2 Å²	122.2	44%	0.435	55%	0.549	S	S	.	.	H	α-helix	trans	-58	-41.8	175.5	-169.4	177.8	-158.1	0	0	111	W399 Q401 H406 E407	W399-E403 HydrophobicContact CZ3-CB 4.46Å; W399-E403 HydrophobicContact CZ3-CG 4.42Å; W399-E403 WeakPolarHBondContact CZ3-OE2 3.44Å; W399-E403 VanDerWaalsContact O-CB 3.29Å; W399-E403 WeakPolarHBondContact O-CB 3.35Å; W399-E403 PolarHBondContact O-N 3.43Å; Q401-E403 VanDerWaalsContact C-N 3.35Å; E403-H406 PolarHBondContact O-N 3.16Å; E403-E407 WeakPolarHBondContact O-CG 3.43Å; E403-E407 PolarHBondContact O-N 3.09Å
404	K	72.3	Confident	68.2	Low	137 Å²	137	122.4 Å²	122.4	60%	0.596	55%	0.55	S	S	*	.	H	α-helix	trans	-67.8	-36.9	174.5	-69.9	173.6	-175.4	-176.6	0	113.1	R400 Q401 E402 Q408	R400-K404 WeakPolarHBondContact O-CD 3.48Å; R400-K404 VanDerWaalsContact O-CG 3.29Å; R400-K404 WeakPolarHBondContact O-CG 3.39Å; Q401-K404 WeakPolarHBondContact O-CB 3.27Å; Q401-K404 PolarHBondContact O-N 3.47Å; E402-K404 VanDerWaalsContact C-N 3.28Å; E402-K404 PolarHBondContact O-N 2.86Å; K404-Q408 WeakPolarHBondContact O-CG 3.32Å; K404-Q408 PolarHBondContact O-N 3.18Å; K404-Q408 VanDerWaalsContact O-N 3.15Å
405	I	69.3	Low	66.8	Low	106 Å²	106	122 Å²	122	54%	0.544	55%	0.548	S	S	.	.	H	α-helix	trans	-66.1	-45.1	174.7	-69.2	167.7	0	0	0	109.1	Q401 E402 E407 Q408 E409	Q401-I405 WeakPolarHBondContact O-CG1 3.41Å; Q401-I405 PolarHBondContact O-N 3.05Å; E402-I405 CarbonylContact O-C 3.57Å; E402-I405 WeakPolarHBondContact O-CB 3.39Å; E402-I405 PolarHBondContact O-N 3.48Å; E402-I405 VanDerWaalsContact O-N 3.08Å; I405-E407 PolarHBondContact O-N 3.17Å; I405-Q408 CarbonylContact O-C 3.6Å; I405-Q408 WeakPolarHBondContact O-CB 3.36Å; I405-Q408 PolarHBondContact O-N 3.41Å; I405-Q408 VanDerWaalsContact O-N 3.13Å; I405-E409 WeakPolarHBondContact O-CB 3.42Å; I405-E409 PolarHBondContact O-N 3.48Å
406	H	66.2	Low	65.8	Low	126 Å²	126	123 Å²	123	58%	0.583	55%	0.55	S	S	*	*	H	α-helix	trans	-67.8	-36.7	-177.5	-157	45.2	0	0	0	111.3	E402 E403 E409 K410	E402-H406 WeakPolarHBondContact O-CB 3.4Å; E402-H406 PolarHBondContact O-N 2.88Å; E403-H406 PolarHBondContact O-N 3.16Å; H406-E409 IonicContact ND1-OE2 2.74Å; H406-E409 PolarHBondContact O-N 3.48Å; H406-K410 VanDerWaalsContact O-CB 3.27Å; H406-K410 WeakPolarHBondContact O-CB 3.43Å; H406-K410 PolarHBondContact O-N 3.28Å
407	E	64.4	Low	64.4	Low	122 Å²	122	123.8 Å²	123.8	57%	0.57	55%	0.55	S	S	*	.	H	α-helix	trans	-62.5	-41.9	169.4	-79.7	178.4	153.4	0	0	112.4	E403 I405 I411	E403-E407 WeakPolarHBondContact O-CG 3.43Å; E403-E407 PolarHBondContact O-N 3.09Å; I405-E407 PolarHBondContact O-N 3.17Å; E407-I411 WeakPolarHBondContact O-CG1 3.31Å; E407-I411 PolarHBondContact O-N 3.28Å
408	Q	57.7	Low	62.8	Low	111 Å²	111	124.1 Å²	124.1	52%	0.519	55%	0.553	S	S	.	*	H	α-helix	trans	-67.5	-37.3	174.5	-74.9	-168	24.5	0	0	112.8	K404 I405 I411 R412	K404-Q408 WeakPolarHBondContact O-CG 3.32Å; K404-Q408 PolarHBondContact O-N 3.18Å; K404-Q408 VanDerWaalsContact O-N 3.15Å; I405-Q408 CarbonylContact O-C 3.6Å; I405-Q408 WeakPolarHBondContact O-CB 3.36Å; I405-Q408 PolarHBondContact O-N 3.41Å; I405-Q408 VanDerWaalsContact O-N 3.13Å; Q408-I411 PolarHBondContact O-N 2.84Å; Q408-R412 PolarHBondContact O-N 3.05Å; Q408-R412 VanDerWaalsContact O-N 3.13Å
409	E	64.4	Low	62	Low	93 Å²	93	125.2 Å²	125.2	44%	0.435	56%	0.557	S	S	.	*	H	α-helix	trans	-68.8	-41.6	178.3	-170.9	167.7	-136.9	0	0	110.5	I405 H406 I411 R412 E413	I405-E409 WeakPolarHBondContact O-CB 3.42Å; I405-E409 PolarHBondContact O-N 3.48Å; H406-E409 IonicContact ND1-OE2 2.74Å; H406-E409 PolarHBondContact O-N 3.48Å; E409-I411 VanDerWaalsContact C-N 3.27Å; E409-I411 PolarHBondContact O-N 3.02Å; E409-R412 CarbonylContact O-C 3.57Å; E409-R412 PolarHBondContact O-N 3.4Å; E409-E413 HydrophobicContact CG-CG 4.22Å; E409-E413 WeakPolarHBondContact O-CB 3.27Å; E409-E413 PolarHBondContact O-N 2.9Å
410	K	66.2	Low	60.6	Low	142 Å²	142	124.2 Å²	124.2	62%	0.617	56%	0.559	S	S	*	*	H	α-helix	trans	-58.1	-40.7	174.7	-157.2	176.6	-171.4	-179.5	0	111.7	H406 E414	H406-K410 VanDerWaalsContact O-CB 3.27Å; H406-K410 WeakPolarHBondContact O-CB 3.43Å; H406-K410 PolarHBondContact O-N 3.28Å; K410-E414 WeakPolarHBondContact O-CB 3.38Å; K410-E414 PolarHBondContact O-N 3.1Å
411	I	57.8	Low	59.3	Low	112 Å²	112	121.7 Å²	121.7	57%	0.574	55%	0.554	S	S	*	*	H	α-helix	trans	-63.3	-43.4	173.9	-65.5	166.1	0	0	0	111.1	E407 Q408 E409 E415	E407-I411 WeakPolarHBondContact O-CG1 3.31Å; E407-I411 PolarHBondContact O-N 3.28Å; Q408-I411 PolarHBondContact O-N 2.84Å; E409-I411 VanDerWaalsContact C-N 3.27Å; E409-I411 PolarHBondContact O-N 3.02Å; I411-E415 PolarHBondContact O-N 3.44Å
412	R	49.9	Very low	58.5	Low	145 Å²	145	122.5 Å²	122.5	55%	0.547	56%	0.558	S	S	.	*	H	α-helix	trans	-72.6	-34.5	178.9	-71.3	-176.3	-155.5	160.1	9.6	113.8	Q408 E409 E414 E415 K416	Q408-R412 PolarHBondContact O-N 3.05Å; Q408-R412 VanDerWaalsContact O-N 3.13Å; E409-R412 CarbonylContact O-C 3.57Å; E409-R412 PolarHBondContact O-N 3.4Å; R412-E414 VanDerWaalsContact C-N 3.35Å; R412-E415 WeakPolarHBondContact O-CB 3.39Å; R412-E415 PolarHBondContact O-N 2.86Å; R412-K416 WeakPolarHBondContact O-CG 3.4Å; R412-K416 PolarHBondContact O-N 3.36Å
413	E	60.5	Low	56.5	Low	117 Å²	117	122.4 Å²	122.4	55%	0.547	56%	0.559	S	S	.	*	H	α-helix	trans	-70.1	-35.4	176.6	-75.6	-151.3	152.4	0	0	111.1	E409 E415 K416 R417	E409-E413 HydrophobicContact CG-CG 4.22Å; E409-E413 WeakPolarHBondContact O-CB 3.27Å; E409-E413 PolarHBondContact O-N 2.9Å; E413-E415 VanDerWaalsContact C-N 3.33Å; E413-K416 PolarHBondContact O-N 3Å; E413-R417 WeakPolarHBondContact O-CB 3.48Å; E413-R417 PolarHBondContact O-N 3.44Å
414	E	54.5	Low	54.9	Low	104 Å²	104	124.2 Å²	124.2	49%	0.486	56%	0.562	S	S	.	*	H	α-helix	trans	-61.9	-41.8	170.9	-147.3	83.4	-143.7	0	0	110.7	K410 R412 R417 Q418	K410-E414 WeakPolarHBondContact O-CB 3.38Å; K410-E414 PolarHBondContact O-N 3.1Å; R412-E414 VanDerWaalsContact C-N 3.35Å; E414-R417 PolarHBondContact O-N 2.95Å; E414-Q418 WeakPolarHBondContact O-CG 3.39Å; E414-Q418 PolarHBondContact O-N 3.33Å
415	E	50.4	Low	53.6	Low	122 Å²	122	127.4 Å²	127.4	57%	0.57	57%	0.57	S	S	*	*	H	α-helix	trans	-62.4	-47.6	172.1	-79.9	-177.3	150	0	0	112.1	I411 R412 E413 R417 Q418 E419	I411-E415 PolarHBondContact O-N 3.44Å; R412-E415 WeakPolarHBondContact O-CB 3.39Å; R412-E415 PolarHBondContact O-N 2.86Å; E413-E415 VanDerWaalsContact C-N 3.33Å; E415-R417 VanDerWaalsContact C-N 3.34Å; E415-R417 PolarHBondContact O-N 2.84Å; E415-Q418 WeakPolarHBondContact O-CB 3.47Å; E415-Q418 PolarHBondContact O-N 3.43Å; E415-Q418 VanDerWaalsContact O-N 3.14Å; E415-E419 PolarHBondContact O-N 3.43Å
416	K	57.5	Low	52.3	Low	126 Å²	126	129.1 Å²	129.1	55%	0.548	58%	0.575	S	S	.	*	H	α-helix	trans	-63.9	-35.5	178	-80.2	-178.9	178	176.5	0	112.9	R412 E413 Q418 E419 Q420	R412-K416 WeakPolarHBondContact O-CG 3.4Å; R412-K416 PolarHBondContact O-N 3.36Å; E413-K416 PolarHBondContact O-N 3Å; K416-Q418 VanDerWaalsContact C-N 3.31Å; K416-E419 PolarHBondContact O-N 3.36Å; K416-Q420 WeakPolarHBondContact O-CB 3.45Å; K416-Q420 WeakPolarHBondContact O-CG 3.48Å; K416-Q420 PolarHBondContact O-N 3.36Å
417	R	54.3	Low	50.8	Low	153 Å²	153	127.4 Å²	127.4	58%	0.577	57%	0.568	S	S	*	*	H	α-helix	trans	-63.8	-39.8	173.9	-93.5	-166.9	73.9	-153.9	-1.8	110.8	E413 E414 E415 Q420 E421	E413-R417 WeakPolarHBondContact O-CB 3.48Å; E413-R417 PolarHBondContact O-N 3.44Å; E414-R417 PolarHBondContact O-N 2.95Å; E415-R417 VanDerWaalsContact C-N 3.34Å; E415-R417 PolarHBondContact O-N 2.84Å; R417-Q420 PolarHBondContact O-N 3.27Å; R417-E421 IonicContact NH2-OE1 3.14Å; R417-E421 PolarHBondContact NH2-OE1 3.48Å; R417-E421 WeakPolarHBondContact O-CB 3.5Å; R417-E421 PolarHBondContact O-N 2.93Å
418	Q	49.2	Very low	49.6	Very low	135 Å²	135	128 Å²	128	63%	0.631	57%	0.571	S	S	*	*	H	α-helix	trans	-65.2	-40.6	175.4	-69.7	-172.6	7.7	0	0	111.9	E414 E415 K416 E422	E414-Q418 WeakPolarHBondContact O-CG 3.39Å; E414-Q418 PolarHBondContact O-N 3.33Å; E415-Q418 WeakPolarHBondContact O-CB 3.47Å; E415-Q418 PolarHBondContact O-N 3.43Å; E415-Q418 VanDerWaalsContact O-N 3.14Å; K416-Q418 VanDerWaalsContact C-N 3.31Å; Q418-E422 PolarHBondContact O-N 3.49Å
419	E	51.7	Low	48.7	Very low	130 Å²	130	131.1 Å²	131.1	61%	0.607	58%	0.583	S	S	*	*	H	α-helix	trans	-68.8	-40.9	175.1	-69.3	-179.1	166.8	0	0	112.9	E415 K416 E422 M423	E415-E419 PolarHBondContact O-N 3.43Å; K416-E419 PolarHBondContact O-N 3.36Å; E419-E422 PolarHBondContact O-N 2.87Å; E419-M423 PolarHBondContact O-N 3.21Å
420	Q	44.5	Very low	47.6	Very low	134 Å²	134	132.7 Å²	132.7	63%	0.626	59%	0.592	S	S	*	*	H	α-helix	trans	-67	-35.7	176.7	-78.1	-160.2	20.8	0	0	111.9	K416 R417 E422 M423 W424	K416-Q420 WeakPolarHBondContact O-CB 3.45Å; K416-Q420 WeakPolarHBondContact O-CG 3.48Å; K416-Q420 PolarHBondContact O-N 3.36Å; R417-Q420 PolarHBondContact O-N 3.27Å; Q420-E422 VanDerWaalsContact C-N 3.28Å; Q420-E422 PolarHBondContact O-N 2.91Å; Q420-M423 PolarHBondContact O-N 3.39Å; Q420-W424 WeakPolarHBondContact O-CB 3.33Å; Q420-W424 PolarHBondContact O-N 3.46Å
421	E	49.6	Very low	46	Very low	112 Å²	112	132.9 Å²	132.9	52%	0.523	59%	0.589	S	S	.	*	H	α-helix	trans	-63.9	-31.8	173.2	-83.2	-179.8	-173.5	0	0	112.3	R417	R417-E421 IonicContact NH2-OE1 3.14Å; R417-E421 PolarHBondContact NH2-OE1 3.48Å; R417-E421 WeakPolarHBondContact O-CB 3.5Å; R417-E421 PolarHBondContact O-N 2.93Å
422	E	48.3	Very low	45	Very low	145 Å²	145	135.8 Å²	135.8	68%	0.678	60%	0.601	S	S	*	*	H	α-helix	trans	-73.7	-39	171.9	-75.1	-164.7	151.6	0	0	113	Q418 E419 Q420	Q418-E422 PolarHBondContact O-N 3.49Å; E419-E422 PolarHBondContact O-N 2.87Å; Q420-E422 VanDerWaalsContact C-N 3.28Å; Q420-E422 PolarHBondContact O-N 2.91Å
423	M	26.9	Very low	44.1	Very low	105 Å²	105	137 Å²	137	52%	0.517	61%	0.612	S	S	.	*	H	α-helix	trans	-67.7	-38.5	175.3	-95.3	-89.6	-65.6	0	0	112.6	E419 Q420 R425 Q426 E427	E419-M423 PolarHBondContact O-N 3.21Å; Q420-M423 PolarHBondContact O-N 3.39Å; M423-R425 VanDerWaalsContact C-N 3.29Å; M423-R425 PolarHBondContact O-N 2.94Å; M423-Q426 WeakPolarHBondContact O-CA 3.44Å; M423-Q426 WeakPolarHBondContact O-CB 3.49Å; M423-Q426 PolarHBondContact O-N 3.31Å; M423-E427 PolarHBondContact O-N 3.07Å
424	W	38.3	Very low	42.7	Very low	131 Å²	131	138.2 Å²	138.2	50%	0.496	62%	0.618	S	S	.	*	H	α-helix	trans	-67.5	-31.1	-178.8	-137.7	84.6	0	0	0	112.1	Q420 Q426 E427 E428	Q420-W424 WeakPolarHBondContact O-CB 3.33Å; Q420-W424 PolarHBondContact O-N 3.46Å; W424-Q426 PolarHBondContact O-N 2.9Å; W424-E427 PolarHBondContact O-N 2.97Å; W424-E428 PolarHBondContact O-N 3.25Å
425	R	44.4	Very low	42	Very low	205 Å²	205	141.2 Å²	141.2	77%	0.774	63%	0.632	S	S	*	*	H	α-helix	trans	-63.8	-18.4	169.1	-73.2	-175.7	-174.6	-121.2	3.7	113.4	M423	M423-R425 VanDerWaalsContact C-N 3.29Å; M423-R425 PolarHBondContact O-N 2.94Å
426	Q	41.3	Very low	41.1	Very low	141 Å²	141	142.8 Å²	142.8	66%	0.659	64%	0.643	S	S	*	*	H	α-helix	trans	-97.6	-37.4	176.6	-61.6	-172.3	13.3	0	0	112.5	M423 W424 E428 K429	M423-Q426 WeakPolarHBondContact O-CA 3.44Å; M423-Q426 WeakPolarHBondContact O-CB 3.49Å; M423-Q426 PolarHBondContact O-N 3.31Å; W424-Q426 PolarHBondContact O-N 2.9Å; Q426-E428 VanDerWaalsContact C-N 3.33Å; Q426-E428 PolarHBondContact O-N 3.39Å; Q426-K429 PolarHBondContact O-N 3.03Å
427	E	36	Very low	39.9	Very low	90 Å²	90	145.6 Å²	145.6	42%	0.421	65%	0.65	S	S	.	*	H	α-helix	trans	-70.6	-24.5	179.2	-80.4	-173.7	158.9	0	0	114.1	M423 W424 K429 I430	M423-E427 PolarHBondContact O-N 3.07Å; W424-E427 PolarHBondContact O-N 2.97Å; E427-K429 PolarHBondContact O-N 3.46Å; E427-K429 VanDerWaalsContact O-N 3.11Å; E427-I430 PolarHBondContact O-N 3.28Å; E427-I430 VanDerWaalsContact O-N 3.09Å
428	E	39.2	Very low	39.2	Very low	135 Å²	135	147.1 Å²	147.1	63%	0.631	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.5	-23.1	175.2	-162.4	176.3	-162.2	0	0	112.4	W424 Q426	W424-E428 PolarHBondContact O-N 3.25Å; Q426-E428 VanDerWaalsContact C-N 3.33Å; Q426-E428 PolarHBondContact O-N 3.39Å
429	K	38.5	Very low	38.6	Very low	177 Å²	177	149 Å²	149	77%	0.77	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87	-4.8	178.1	-69.5	-176.9	-180	175.2	0	115.2	Q426 E427	Q426-K429 PolarHBondContact O-N 3.03Å; E427-K429 PolarHBondContact O-N 3.46Å; E427-K429 VanDerWaalsContact O-N 3.11Å
430	I	39.9	Very low	38.2	Very low	125 Å²	125	150.5 Å²	150.5	64%	0.641	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.9	-12.8	-176.9	-61.8	179	0	0	0	112.3	E427 E432 Q433	E427-I430 PolarHBondContact O-N 3.28Å; E427-I430 VanDerWaalsContact O-N 3.09Å; I430-E432 PolarHBondContact O-N 3.42Å; I430-Q433 PolarHBondContact O-N 3.01Å
431	R	33.3	Very low	38.2	Very low	147 Å²	147	149 Å²	149	56%	0.555	66%	0.662	S	S	*	*	G	3₁₀ helix	trans	-70.2	-7.9	178.5	-74	-173.5	-179.6	174.9	2.2	115.3	Q433 E434	R431-Q433 PolarHBondContact O-N 3.1Å; R431-Q433 VanDerWaalsContact O-N 3.12Å; R431-E434 VanDerWaalsContact O-CG 3.28Å; R431-E434 WeakPolarHBondContact O-CG 3.32Å; R431-E434 PolarHBondContact O-N 3.33Å
432	E	38	Very low	37.9	Very low	173 Å²	173	151.4 Å²	151.4	81%	0.808	67%	0.671	S	S	*	*	G	3₁₀ helix	trans	-68.9	-2.7	169.7	-68.6	-176.4	164.5	0	0	113.7	I430 E434	I430-E432 PolarHBondContact O-N 3.42Å; E432-E434 PolarHBondContact O-N 3.23Å
433	Q	29.2	Very low	37.3	Very low	170 Å²	170	150.3 Å²	150.3	79%	0.794	67%	0.667	S	S	*	*	G	3₁₀ helix	trans	-82.7	28.2	168.1	-62.7	-128.3	-7	0	0	113.6	I430 R431 E435	I430-Q433 PolarHBondContact O-N 3.01Å; R431-Q433 PolarHBondContact O-N 3.1Å; R431-Q433 VanDerWaalsContact O-N 3.12Å; Q433-E435 PolarHBondContact O-N 2.9Å
434	E	32.1	Very low	38.1	Very low	142 Å²	142	149.9 Å²	149.9	66%	0.664	66%	0.664	S	S	*	*	G	3₁₀ helix	trans	-58.2	1.1	169.5	-94.2	170.1	-179.8	0	0	115.1	R431 E432 I436 W437	R431-E434 VanDerWaalsContact O-CG 3.28Å; R431-E434 WeakPolarHBondContact O-CG 3.32Å; R431-E434 PolarHBondContact O-N 3.33Å; E432-E434 PolarHBondContact O-N 3.23Å; E434-I436 PolarHBondContact O-N 3.33Å; E434-W437 VanDerWaalsContact O-CB 3.32Å; E434-W437 WeakPolarHBondContact O-CB 3.34Å; E434-W437 PolarHBondContact O-N 3.5Å
435	E	39.8	Very low	38.6	Very low	168 Å²	168	149.3 Å²	149.3	79%	0.785	67%	0.666	S	S	*	*	G	3₁₀ helix	trans	-82.6	-6.2	-170.9	-113.7	177.5	172.9	0	0	115.9	Q433	Q433-E435 PolarHBondContact O-N 2.9Å
436	I	31.2	Very low	38.8	Very low	154 Å²	154	146.4 Å²	146.4	79%	0.79	66%	0.662	S	S	*	*	G	3₁₀ helix	trans	-90.3	-7.1	170.6	-65.7	175.8	0	0	0	111.6	E434	E434-I436 PolarHBondContact O-N 3.33Å
437	W	31.9	Very low	39.2	Very low	186 Å²	186	144.6 Å²	144.6	71%	0.705	65%	0.653	S	S	*	*	H	α-helix	trans	-78.3	-23	-174.2	-137.8	66	0	0	0	114.2	E434 Q439	E434-W437 VanDerWaalsContact O-CB 3.32Å; E434-W437 WeakPolarHBondContact O-CB 3.34Å; E434-W437 PolarHBondContact O-N 3.5Å; W437-Q439 PolarHBondContact O-N 2.99Å
438	R	40.2	Very low	40.3	Very low	185 Å²	185	142.3 Å²	142.3	70%	0.698	64%	0.642	S	S	*	*	H	α-helix	trans	-74.9	-22.9	-174.8	-69.9	-170.8	-161.8	-157	5.1	115.6
439	Q	36.6	Very low	41.5	Very low	174 Å²	174	142.9 Å²	142.9	81%	0.813	64%	0.643	S	S	*	*	H	α-helix	trans	-85.9	-27.9	177.5	-77.4	-164.6	-3.8	0	0	112.8	W437 E441	W437-Q439 PolarHBondContact O-N 2.99Å; Q439-E441 PolarHBondContact O-N 3.36Å
440	K	44	Very low	42.5	Very low	162 Å²	162	139.1 Å²	139.1	70%	0.704	63%	0.63	S	S	*	*	H	α-helix	trans	-68.2	-27.3	174	-147	171.9	-175.1	-178.8	0	111.6	K442 H444	K440-K442 PolarHBondContact O-N 2.74Å; K440-H444 WeakPolarHBondContact O-CB 3.48Å; K440-H444 PolarHBondContact O-N 3.32Å; K440-H444 VanDerWaalsContact O-N 3.15Å
441	E	44.5	Very low	43.4	Very low	103 Å²	103	138.9 Å²	138.9	48%	0.481	62%	0.621	S	S	.	*	H	α-helix	trans	-65	-37.8	-178	-155	172.3	-164.5	0	0	113.7	Q439 H444 E445	Q439-E441 PolarHBondContact O-N 3.36Å; E441-H444 PolarHBondContact O-N 3.2Å; E441-E445 PolarHBondContact O-N 2.84Å
442	K	42.8	Very low	44.8	Very low	161 Å²	161	137 Å²	137	70%	0.7	62%	0.617	S	S	*	*	H	α-helix	trans	-77.6	-30.1	-178.1	-68.8	-174.2	179.1	179.1	0	114.4	K440	K440-K442 PolarHBondContact O-N 2.74Å
443	M	34.4	Very low	46	Very low	123 Å²	123	135.6 Å²	135.6	61%	0.606	61%	0.611	S	S	*	*	H	α-helix	trans	-64.7	-45	167.5	-95	-94.3	-55.7	0	0	110	E445 Q446 E447	M443-E445 VanDerWaalsContact C-N 3.3Å; M443-E445 PolarHBondContact O-N 3.03Å; M443-Q446 PolarHBondContact O-N 3.01Å; M443-E447 PolarHBondContact O-N 3.42Å; M443-E447 VanDerWaalsContact O-N 3.07Å
444	H	45.3	Very low	47.5	Very low	95 Å²	95	133.3 Å²	133.3	44%	0.44	60%	0.6	S	S	.	*	H	α-helix	trans	-65.5	-30.5	-178.5	-153.6	-70.7	0	0	0	112.9	K440 E441 E448	K440-H444 WeakPolarHBondContact O-CB 3.48Å; K440-H444 PolarHBondContact O-N 3.32Å; K440-H444 VanDerWaalsContact O-N 3.15Å; E441-H444 PolarHBondContact O-N 3.2Å; H444-E448 IonicContact CE1-OE1 3.4Å; H444-E448 WeakPolarHBondContact O-CB 3.47Å; H444-E448 WeakPolarHBondContact O-CG 3.45Å; H444-E448 PolarHBondContact O-N 2.84Å
445	E	48.5	Very low	49.1	Very low	119 Å²	119	130 Å²	130	56%	0.556	59%	0.585	S	S	*	*	H	α-helix	trans	-70.9	-32.3	176	-83.7	-172.2	152.8	0	0	114.2	E441 M443 K449	E441-E445 PolarHBondContact O-N 2.84Å; M443-E445 VanDerWaalsContact C-N 3.3Å; M443-E445 PolarHBondContact O-N 3.03Å; E445-K449 WeakPolarHBondContact O-CG 3.3Å; E445-K449 PolarHBondContact O-N 3.12Å
446	Q	47.4	Very low	50.5	Low	145 Å²	145	129.2 Å²	129.2	68%	0.678	58%	0.578	S	S	*	*	H	α-helix	trans	-77.6	-40.1	172.9	-71.1	-150.8	-2.1	0	0	111.4	M443 E448 K449 I450	M443-Q446 PolarHBondContact O-N 3.01Å; Q446-E448 VanDerWaalsContact C-N 3.32Å; Q446-E448 PolarHBondContact O-N 2.83Å; Q446-K449 PolarHBondContact O-N 2.93Å; Q446-K449 VanDerWaalsContact O-N 3.16Å; Q446-I450 PolarHBondContact O-N 3.11Å; Q446-I450 VanDerWaalsContact O-N 3.11Å
447	E	51.2	Low	51.9	Low	102 Å²	102	125.4 Å²	125.4	48%	0.477	56%	0.562	S	S	.	*	H	α-helix	trans	-60.5	-40.3	172	-75	176.1	167	0	0	111.5	M443 K449 I450 R451	M443-E447 PolarHBondContact O-N 3.42Å; M443-E447 VanDerWaalsContact O-N 3.07Å; E447-K449 VanDerWaalsContact C-N 3.31Å; E447-K449 PolarHBondContact O-N 3.45Å; E447-I450 PolarHBondContact O-N 2.93Å; E447-R451 VanDerWaalsContact O-CB 3.23Å; E447-R451 WeakPolarHBondContact O-CB 3.42Å; E447-R451 PolarHBondContact O-N 3.06Å
448	E	57.9	Low	53.4	Low	42 Å²	42	124 Å²	124	20%	0.196	56%	0.557	C	S	.	*	H	α-helix	trans	-62	-35.2	174.1	-88.6	-93.2	148.2	0	0	112.9	H444 Q446 R451 K452	H444-E448 IonicContact CE1-OE1 3.4Å; H444-E448 WeakPolarHBondContact O-CB 3.47Å; H444-E448 WeakPolarHBondContact O-CG 3.45Å; H444-E448 PolarHBondContact O-N 2.84Å; Q446-E448 VanDerWaalsContact C-N 3.32Å; Q446-E448 PolarHBondContact O-N 2.83Å; E448-R451 IonicContact OE1-CZ 3.78Å; E448-R451 IonicContact OE1-NH1 3.43Å; E448-R451 PolarHBondContact OE1-NH1 3.49Å; E448-R451 IonicContact OE1-NH2 2.74Å; E448-R451 PolarHBondContact OE1-NH2 3.44Å; E448-R451 IonicContact OE2-NH2 3.75Å; E448-K452 VanDerWaalsContact O-CB 3.27Å; E448-K452 WeakPolarHBondContact O-CB 3.47Å; E448-K452 VanDerWaalsContact O-CG 3.22Å; E448-K452 WeakPolarHBondContact O-CG 3.44Å; E448-K452 PolarHBondContact O-N 2.9Å; E448-K452 WeakPolarHBondContact OE2-CE 3.28Å; E448-K452 IonicContact OE2-NZ 2.89Å; E448-K452 PolarHBondContact OE2-NZ 3.25Å
449	K	64.6	Low	54.8	Low	147 Å²	147	121.6 Å²	121.6	64%	0.639	55%	0.548	S	S	*	.	H	α-helix	trans	-71.3	-40	177.9	-75.6	173.8	-175.5	173.6	0	111.6	E445 Q446 E447 Q453	E445-K449 WeakPolarHBondContact O-CG 3.3Å; E445-K449 PolarHBondContact O-N 3.12Å; Q446-K449 PolarHBondContact O-N 2.93Å; Q446-K449 VanDerWaalsContact O-N 3.16Å; E447-K449 VanDerWaalsContact C-N 3.31Å; E447-K449 PolarHBondContact O-N 3.45Å; K449-Q453 PolarHBondContact O-N 3.4Å
450	I	59.4	Low	56.2	Low	99 Å²	99	119.7 Å²	119.7	51%	0.508	54%	0.539	S	S	.	.	H	α-helix	trans	-65.5	-49.3	172.8	-65.7	172.8	0	0	0	109.4	Q446 E447 K452 Q453 E454	Q446-I450 PolarHBondContact O-N 3.11Å; Q446-I450 VanDerWaalsContact O-N 3.11Å; E447-I450 PolarHBondContact O-N 2.93Å; I450-K452 VanDerWaalsContact C-N 3.31Å; I450-K452 PolarHBondContact O-N 3.48Å; I450-Q453 CarbonylContact O-C 3.56Å; I450-Q453 WeakPolarHBondContact O-CA 3.43Å; I450-Q453 WeakPolarHBondContact O-CB 3.47Å; I450-Q453 PolarHBondContact O-N 2.93Å; I450-E454 HydrophobicContact CG2-CG 4.22Å; I450-E454 PolarHBondContact O-N 3.3Å
451	R	59.5	Low	57	Low	119 Å²	119	117.5 Å²	117.5	45%	0.449	53%	0.531	S	S	.	.	H	α-helix	trans	-58.4	-39.8	178.6	-160.6	-177.5	84.7	-142.2	-3.7	112.3	E447 E448 Q453 E454 E455	E447-R451 VanDerWaalsContact O-CB 3.23Å; E447-R451 WeakPolarHBondContact O-CB 3.42Å; E447-R451 PolarHBondContact O-N 3.06Å; E448-R451 IonicContact OE1-CZ 3.78Å; E448-R451 IonicContact OE1-NH1 3.43Å; E448-R451 PolarHBondContact OE1-NH1 3.49Å; E448-R451 IonicContact OE1-NH2 2.74Å; E448-R451 PolarHBondContact OE1-NH2 3.44Å; E448-R451 IonicContact OE2-NH2 3.75Å; R451-Q453 VanDerWaalsContact C-N 3.33Å; R451-Q453 PolarHBondContact O-N 2.93Å; R451-E454 PolarHBondContact O-N 2.86Å; R451-E455 WeakPolarHBondContact O-CB 3.4Å; R451-E455 PolarHBondContact O-N 3.43Å
452	K	61.3	Low	57.9	Low	108 Å²	108	116.8 Å²	116.8	47%	0.47	53%	0.528	S	S	.	.	H	α-helix	trans	-69.2	-28.1	175.3	-78.5	170.6	-178.3	151.8	0	113.3	E448 I450 K456	E448-K452 VanDerWaalsContact O-CB 3.27Å; E448-K452 WeakPolarHBondContact O-CB 3.47Å; E448-K452 VanDerWaalsContact O-CG 3.22Å; E448-K452 WeakPolarHBondContact O-CG 3.44Å; E448-K452 PolarHBondContact O-N 2.9Å; E448-K452 WeakPolarHBondContact OE2-CE 3.28Å; E448-K452 IonicContact OE2-NZ 2.89Å; E448-K452 PolarHBondContact OE2-NZ 3.25Å; I450-K452 VanDerWaalsContact C-N 3.31Å; I450-K452 PolarHBondContact O-N 3.48Å; K452-K456 VanDerWaalsContact O-CG 3.3Å; K452-K456 WeakPolarHBondContact O-CG 3.45Å; K452-K456 PolarHBondContact O-N 3.25Å
453	Q	63.5	Low	59.5	Low	144 Å²	144	115.7 Å²	115.7	67%	0.673	52%	0.523	S	S	*	.	H	α-helix	trans	-76.1	-45.6	171	-79.6	-162.2	-16.9	0	0	111	K449 I450 R451 E455 K456 V457	K449-Q453 PolarHBondContact O-N 3.4Å; I450-Q453 CarbonylContact O-C 3.56Å; I450-Q453 WeakPolarHBondContact O-CA 3.43Å; I450-Q453 WeakPolarHBondContact O-CB 3.47Å; I450-Q453 PolarHBondContact O-N 2.93Å; R451-Q453 VanDerWaalsContact C-N 3.33Å; R451-Q453 PolarHBondContact O-N 2.93Å; Q453-E455 VanDerWaalsContact C-N 3.3Å; Q453-E455 PolarHBondContact O-N 2.87Å; Q453-K456 WeakPolarHBondContact O-CB 3.43Å; Q453-K456 PolarHBondContact O-N 2.97Å; Q453-V457 WeakPolarHBondContact O-CG2 3.36Å; Q453-V457 PolarHBondContact O-N 3.11Å
454	E	60.8	Low	60.5	Low	122 Å²	122	114.8 Å²	114.8	57%	0.57	52%	0.519	S	S	*	.	H	α-helix	trans	-58.2	-41.9	174.4	-71.7	175.8	164.8	0	0	111.5	I450 R451 K456 V457 W458	I450-E454 HydrophobicContact CG2-CG 4.22Å; I450-E454 PolarHBondContact O-N 3.3Å; R451-E454 PolarHBondContact O-N 2.86Å; E454-K456 VanDerWaalsContact C-N 3.29Å; E454-K456 PolarHBondContact O-N 3.34Å; E454-V457 PolarHBondContact O-N 3.14Å; E454-W458 VanDerWaalsContact O-CB 3.29Å; E454-W458 WeakPolarHBondContact O-CB 3.48Å; E454-W458 PolarHBondContact O-N 2.89Å
455	E	65.3	Low	61.3	Low	73 Å²	73	115.1 Å²	115.1	34%	0.341	52%	0.52	S	S	.	.	H	α-helix	trans	-65.8	-31.1	176.4	-168.8	-177.8	-179.8	0	0	112.1	R451 Q453 R459	R451-E455 WeakPolarHBondContact O-CB 3.4Å; R451-E455 PolarHBondContact O-N 3.43Å; Q453-E455 VanDerWaalsContact C-N 3.3Å; Q453-E455 PolarHBondContact O-N 2.87Å; E455-R459 WeakPolarHBondContact O-CB 3.48Å; E455-R459 VanDerWaalsContact O-CG 3.24Å; E455-R459 WeakPolarHBondContact O-CG 3.41Å; E455-R459 PolarHBondContact O-N 3.33Å; E455-R459 IonicContact OE1-CZ 3.52Å; E455-R459 IonicContact OE1-NE 3.97Å; E455-R459 IonicContact OE1-NH2 2.92Å; E455-R459 PolarHBondContact OE1-NH2 3.32Å
456	K	70.8	Confident	62.4	Low	150 Å²	150	113.5 Å²	113.5	65%	0.652	52%	0.515	S	S	*	.	H	α-helix	trans	-71.9	-41.2	172.2	-77.1	175.2	-177.4	-176.9	0	112	K452 Q453 E454 W458 Q460	K452-K456 VanDerWaalsContact O-CG 3.3Å; K452-K456 WeakPolarHBondContact O-CG 3.45Å; K452-K456 PolarHBondContact O-N 3.25Å; Q453-K456 WeakPolarHBondContact O-CB 3.43Å; Q453-K456 PolarHBondContact O-N 2.97Å; E454-K456 VanDerWaalsContact C-N 3.29Å; E454-K456 PolarHBondContact O-N 3.34Å; K456-W458 VanDerWaalsContact C-N 3.33Å; K456-Q460 PolarHBondContact O-N 3.29Å; K456-Q460 VanDerWaalsContact O-N 3.1Å
457	V	59.9	Low	63.7	Low	75 Å²	75	112.3 Å²	112.3	46%	0.455	51%	0.51	S	S	.	.	H	α-helix	trans	-62.1	-45.6	173.5	177.4	0	0	0	0	109.5	Q453 E454 R459 Q460 E461	Q453-V457 WeakPolarHBondContact O-CG2 3.36Å; Q453-V457 PolarHBondContact O-N 3.11Å; E454-V457 PolarHBondContact O-N 3.14Å; V457-R459 PolarHBondContact O-N 2.87Å; V457-Q460 CarbonylContact O-C 3.54Å; V457-Q460 WeakPolarHBondContact O-CA 3.47Å; V457-Q460 VanDerWaalsContact O-CB 3.28Å; V457-Q460 WeakPolarHBondContact O-CB 3.4Å; V457-Q460 PolarHBondContact O-N 3.44Å; V457-E461 HydrophobicContact CG1-CG 4.29Å; V457-E461 PolarHBondContact O-N 2.95Å
458	W	63.3	Low	64.5	Low	156 Å²	156	112 Å²	112	59%	0.591	51%	0.509	S	S	*	.	H	α-helix	trans	-62.9	-44.5	179.8	-160.4	83.2	0	0	0	112.2	E454 K456 Q460 E461 E462	E454-W458 VanDerWaalsContact O-CB 3.29Å; E454-W458 WeakPolarHBondContact O-CB 3.48Å; E454-W458 PolarHBondContact O-N 2.89Å; K456-W458 VanDerWaalsContact C-N 3.33Å; W458-Q460 PolarHBondContact O-N 3Å; W458-E461 PolarHBondContact O-N 3.43Å; W458-E462 HydrophobicContact CE3-CB 4.49Å; W458-E462 HydrophobicContact CZ3-CB 4.41Å; W458-E462 HydrophobicContact CZ3-CG 4.38Å; W458-E462 WeakPolarHBondContact CZ3-OE2 3.37Å; W458-E462 VanDerWaalsContact O-CB 3.3Å; W458-E462 WeakPolarHBondContact O-CB 3.36Å; W458-E462 PolarHBondContact O-N 2.93Å
459	R	69.1	Low	65.1	Low	134 Å²	134	114.5 Å²	114.5	51%	0.506	52%	0.52	S	S	.	.	H	α-helix	trans	-64.4	-23	172.2	-72	175.8	-159.4	-89.3	6.8	113.1	E455 V457 K463	E455-R459 WeakPolarHBondContact O-CB 3.48Å; E455-R459 VanDerWaalsContact O-CG 3.24Å; E455-R459 WeakPolarHBondContact O-CG 3.41Å; E455-R459 PolarHBondContact O-N 3.33Å; E455-R459 IonicContact OE1-CZ 3.52Å; E455-R459 IonicContact OE1-NE 3.97Å; E455-R459 IonicContact OE1-NH2 2.92Å; E455-R459 PolarHBondContact OE1-NH2 3.32Å; V457-R459 PolarHBondContact O-N 2.87Å; R459-K463 WeakPolarHBondContact O-CD 3.41Å; R459-K463 VanDerWaalsContact O-CG 3.25Å; R459-K463 WeakPolarHBondContact O-CG 3.41Å; R459-K463 PolarHBondContact O-N 3.18Å
460	Q	67.1	Low	66	Low	135 Å²	135	113.9 Å²	113.9	63%	0.631	52%	0.517	S	S	*	.	H	α-helix	trans	-80.5	-41.7	173.5	-120.9	176	-12.4	0	0	111.1	K456 V457 W458 K463 M464	K456-Q460 PolarHBondContact O-N 3.29Å; K456-Q460 VanDerWaalsContact O-N 3.1Å; V457-Q460 CarbonylContact O-C 3.54Å; V457-Q460 WeakPolarHBondContact O-CA 3.47Å; V457-Q460 VanDerWaalsContact O-CB 3.28Å; V457-Q460 WeakPolarHBondContact O-CB 3.4Å; V457-Q460 PolarHBondContact O-N 3.44Å; W458-Q460 PolarHBondContact O-N 3Å; Q460-K463 PolarHBondContact O-N 3.41Å; Q460-M464 VanDerWaalsContact O-CG 3.31Å; Q460-M464 WeakPolarHBondContact O-CG 3.45Å; Q460-M464 PolarHBondContact O-N 3.49Å
461	E	60.8	Low	66.8	Low	116 Å²	116	113.8 Å²	113.8	54%	0.542	52%	0.517	S	S	.	.	H	α-helix	trans	-63.7	-39.4	173.1	-74.8	178.8	165	0	0	111.7	V457 W458 K463 M464 H465	V457-E461 HydrophobicContact CG1-CG 4.29Å; V457-E461 PolarHBondContact O-N 2.95Å; W458-E461 PolarHBondContact O-N 3.43Å; E461-K463 VanDerWaalsContact C-N 3.34Å; E461-K463 PolarHBondContact O-N 2.92Å; E461-M464 CarbonylContact O-C 3.52Å; E461-M464 WeakPolarHBondContact O-CB 3.47Å; E461-M464 PolarHBondContact O-N 2.89Å; E461-H465 WeakPolarHBondContact O-CB 3.06Å; E461-H465 PolarHBondContact O-N 3.19Å
462	E	63.4	Low	67.4	Low	88 Å²	88	115 Å²	115	41%	0.411	52%	0.522	S	S	.	.	H	α-helix	trans	-61.3	-43	173.8	-171.9	179.4	-155.1	0	0	110.7	W458 M464 H465 D466	W458-E462 HydrophobicContact CE3-CB 4.49Å; W458-E462 HydrophobicContact CZ3-CB 4.41Å; W458-E462 HydrophobicContact CZ3-CG 4.38Å; W458-E462 WeakPolarHBondContact CZ3-OE2 3.37Å; W458-E462 VanDerWaalsContact O-CB 3.3Å; W458-E462 WeakPolarHBondContact O-CB 3.36Å; W458-E462 PolarHBondContact O-N 2.93Å; E462-M464 PolarHBondContact O-N 3.39Å; E462-H465 PolarHBondContact O-N 2.89Å; E462-D466 PolarHBondContact O-N 3.32Å
463	K	75.9	Confident	67.9	Low	138 Å²	138	114.5 Å²	114.5	60%	0.6	52%	0.521	S	S	*	.	H	α-helix	trans	-67.3	-34.4	174.2	-72.9	174	-175.5	-177.5	0	113.2	R459 Q460 E461 Q467	R459-K463 WeakPolarHBondContact O-CD 3.41Å; R459-K463 VanDerWaalsContact O-CG 3.25Å; R459-K463 WeakPolarHBondContact O-CG 3.41Å; R459-K463 PolarHBondContact O-N 3.18Å; Q460-K463 PolarHBondContact O-N 3.41Å; E461-K463 VanDerWaalsContact C-N 3.34Å; E461-K463 PolarHBondContact O-N 2.92Å; K463-Q467 WeakPolarHBondContact O-CB 3.46Å; K463-Q467 VanDerWaalsContact O-CG 3.31Å; K463-Q467 WeakPolarHBondContact O-CG 3.49Å; K463-Q467 PolarHBondContact O-N 2.9Å; K463-Q467 VanDerWaalsContact O-N 3.1Å
464	M	56.1	Low	68.5	Low	104 Å²	104	114 Å²	114	51%	0.512	52%	0.518	S	S	.	.	H	α-helix	trans	-66.2	-43.1	173	-74.1	-76.9	-58	0	0	110.3	Q460 E461 E462 Q467 E468	Q460-M464 VanDerWaalsContact O-CG 3.31Å; Q460-M464 WeakPolarHBondContact O-CG 3.45Å; Q460-M464 PolarHBondContact O-N 3.49Å; E461-M464 CarbonylContact O-C 3.52Å; E461-M464 WeakPolarHBondContact O-CB 3.47Å; E461-M464 PolarHBondContact O-N 2.89Å; E462-M464 PolarHBondContact O-N 3.39Å; M464-Q467 PolarHBondContact O-N 3.01Å; M464-Q467 VanDerWaalsContact O-N 3.17Å; M464-E468 WeakPolarHBondContact O-CG 3.41Å; M464-E468 PolarHBondContact O-N 2.84Å
465	H	62.3	Low	69.2	Low	101 Å²	101	114 Å²	114	47%	0.468	52%	0.519	S	S	.	.	H	α-helix	trans	-64.7	-42.7	178	-165	-74.4	0	0	0	111.5	E461 E462 Q467 E468 E469	E461-H465 WeakPolarHBondContact O-CB 3.06Å; E461-H465 PolarHBondContact O-N 3.19Å; E462-H465 PolarHBondContact O-N 2.89Å; H465-Q467 VanDerWaalsContact C-N 3.27Å; H465-Q467 PolarHBondContact O-N 3.14Å; H465-E468 PolarHBondContact O-N 2.71Å; H465-E469 WeakPolarHBondContact O-CB 3.44Å; H465-E469 PolarHBondContact O-N 3.49Å
466	D	71.1	Confident	69.7	Low	85 Å²	85	115.2 Å²	115.2	46%	0.455	52%	0.524	S	S	.	.	H	α-helix	trans	-63.1	-32.8	173.5	-77.4	-9.9	0	0	0	112.6	E462 K470	E462-D466 PolarHBondContact O-N 3.32Å; D466-K470 WeakPolarHBondContact O-CD 3.34Å; D466-K470 VanDerWaalsContact O-CG 3.27Å; D466-K470 WeakPolarHBondContact O-CG 3.49Å; D466-K470 PolarHBondContact O-N 3.04Å
467	Q	73.7	Confident	70.3	Confident	120 Å²	120	113.7 Å²	113.7	56%	0.561	52%	0.518	S	S	*	.	H	α-helix	trans	-74.6	-39.6	174.5	-76.4	-178.1	1.4	0	0	111.9	K463 M464 H465 K470 I471	K463-Q467 WeakPolarHBondContact O-CB 3.46Å; K463-Q467 VanDerWaalsContact O-CG 3.31Å; K463-Q467 WeakPolarHBondContact O-CG 3.49Å; K463-Q467 PolarHBondContact O-N 2.9Å; K463-Q467 VanDerWaalsContact O-N 3.1Å; M464-Q467 PolarHBondContact O-N 3.01Å; M464-Q467 VanDerWaalsContact O-N 3.17Å; H465-Q467 VanDerWaalsContact C-N 3.27Å; H465-Q467 PolarHBondContact O-N 3.14Å; Q467-K470 PolarHBondContact O-N 3.41Å; Q467-I471 WeakPolarHBondContact O-CG1 3.27Å; Q467-I471 PolarHBondContact O-N 3.39Å
468	E	69.1	Low	71	Confident	97 Å²	97	113.6 Å²	113.6	45%	0.453	52%	0.517	S	S	.	.	H	α-helix	trans	-65.1	-40.1	174.4	-78.6	-178.2	174.8	0	0	112.1	M464 H465 I471 R472	M464-E468 WeakPolarHBondContact O-CG 3.41Å; M464-E468 PolarHBondContact O-N 2.84Å; H465-E468 PolarHBondContact O-N 2.71Å; E468-I471 PolarHBondContact O-N 3.33Å; E468-R472 PolarHBondContact O-N 3.1Å
469	E	70.7	Confident	72	Confident	93 Å²	93	112.7 Å²	112.7	44%	0.435	51%	0.513	S	S	.	.	H	α-helix	trans	-59.1	-45.9	172.1	-88.7	-100.5	129.1	0	0	111.2	H465 I471 R472 E473	H465-E469 WeakPolarHBondContact O-CB 3.44Å; H465-E469 PolarHBondContact O-N 3.49Å; E469-I471 VanDerWaalsContact C-N 3.3Å; E469-I471 PolarHBondContact O-N 2.92Å; E469-R472 PolarHBondContact O-N 3.3Å; E469-E473 WeakPolarHBondContact O-CG 3.38Å; E469-E473 PolarHBondContact O-N 3.31Å
470	K	82.4	Confident	72.5	Confident	134 Å²	134	112.3 Å²	112.3	58%	0.583	51%	0.512	S	S	*	.	H	α-helix	trans	-63	-36.3	176.6	-74.3	170.6	-173	172.9	0	112.8	D466 Q467 Q474	D466-K470 WeakPolarHBondContact O-CD 3.34Å; D466-K470 VanDerWaalsContact O-CG 3.27Å; D466-K470 WeakPolarHBondContact O-CG 3.49Å; D466-K470 PolarHBondContact O-N 3.04Å; Q467-K470 PolarHBondContact O-N 3.41Å; K470-Q474 WeakPolarHBondContact O-CG 3.48Å; K470-Q474 PolarHBondContact O-N 3.32Å; K470-Q474 VanDerWaalsContact O-N 3.1Å
471	I	76.2	Confident	73	Confident	97 Å²	97	112.1 Å²	112.1	50%	0.497	51%	0.511	S	S	.	.	H	α-helix	trans	-66.6	-45.9	174.3	-68.5	167.6	0	0	0	109.8	Q467 E468 E469 E473 Q474 E475	Q467-I471 WeakPolarHBondContact O-CG1 3.27Å; Q467-I471 PolarHBondContact O-N 3.39Å; E468-I471 PolarHBondContact O-N 3.33Å; E469-I471 VanDerWaalsContact C-N 3.3Å; E469-I471 PolarHBondContact O-N 2.92Å; I471-E473 PolarHBondContact O-N 2.98Å; I471-Q474 CarbonylContact O-C 3.55Å; I471-Q474 WeakPolarHBondContact O-CB 3.29Å; I471-Q474 PolarHBondContact O-N 3.47Å; I471-Q474 VanDerWaalsContact O-N 3.09Å; I471-E475 HydrophobicContact CG2-CG 4.32Å; I471-E475 WeakPolarHBondContact O-CG 3.45Å; I471-E475 PolarHBondContact O-N 2.98Å
472	R	71.7	Confident	73.5	Confident	146 Å²	146	111.1 Å²	111.1	55%	0.551	51%	0.506	S	S	*	.	H	α-helix	trans	-60.4	-42	175.9	-79.2	-174.1	-170.3	154.9	8.4	112.8	E468 E469 Q474 E475 E476	E468-R472 PolarHBondContact O-N 3.1Å; E469-R472 PolarHBondContact O-N 3.3Å; R472-Q474 VanDerWaalsContact C-N 3.28Å; R472-Q474 PolarHBondContact O-N 3.22Å; R472-E475 PolarHBondContact O-N 3.28Å; R472-E476 WeakPolarHBondContact O-CB 3.41Å; R472-E476 PolarHBondContact O-N 3.18Å
473	E	72.7	Confident	74.2	Confident	97 Å²	97	110.9 Å²	110.9	45%	0.453	51%	0.505	S	S	.	.	H	α-helix	trans	-62.8	-36.2	174.8	-74.8	-173.9	175.2	0	0	112.1	E469 I471 K477	E469-E473 WeakPolarHBondContact O-CG 3.38Å; E469-E473 PolarHBondContact O-N 3.31Å; I471-E473 PolarHBondContact O-N 2.98Å; E473-K477 WeakPolarHBondContact O-CB 3.32Å; E473-K477 WeakPolarHBondContact O-CD 3.26Å; E473-K477 VanDerWaalsContact O-CG 3.23Å; E473-K477 WeakPolarHBondContact O-CG 3.44Å; E473-K477 PolarHBondContact O-N 2.81Å
474	Q	76.4	Confident	74.6	Confident	133 Å²	133	110.9 Å²	110.9	62%	0.621	51%	0.505	S	S	*	.	H	α-helix	trans	-69	-44.5	174.4	-69.1	-115.4	-19.9	0	0	111.2	K470 I471 R472 E476 K477 V478	K470-Q474 WeakPolarHBondContact O-CG 3.48Å; K470-Q474 PolarHBondContact O-N 3.32Å; K470-Q474 VanDerWaalsContact O-N 3.1Å; I471-Q474 CarbonylContact O-C 3.55Å; I471-Q474 WeakPolarHBondContact O-CB 3.29Å; I471-Q474 PolarHBondContact O-N 3.47Å; I471-Q474 VanDerWaalsContact O-N 3.09Å; R472-Q474 VanDerWaalsContact C-N 3.28Å; R472-Q474 PolarHBondContact O-N 3.22Å; Q474-E476 VanDerWaalsContact C-N 3.33Å; Q474-E476 PolarHBondContact O-N 3.27Å; Q474-K477 WeakPolarHBondContact O-CB 3.3Å; Q474-K477 PolarHBondContact O-N 3.14Å; Q474-V478 WeakPolarHBondContact O-CG2 3.43Å; Q474-V478 PolarHBondContact O-N 3.22Å
475	E	74.9	Confident	75.8	Confident	123 Å²	123	110.5 Å²	110.5	58%	0.575	50%	0.504	S	S	*	.	H	α-helix	trans	-60.7	-41.2	175.3	-73.4	177.7	166.3	0	0	111.5	I471 R472 K477 V478 W479	I471-E475 HydrophobicContact CG2-CG 4.32Å; I471-E475 WeakPolarHBondContact O-CG 3.45Å; I471-E475 PolarHBondContact O-N 2.98Å; R472-E475 PolarHBondContact O-N 3.28Å; E475-K477 PolarHBondContact O-N 2.85Å; E475-V478 PolarHBondContact O-N 3.38Å; E475-W479 WeakPolarHBondContact O-CB 3.45Å; E475-W479 PolarHBondContact O-N 3.22Å
476	E	76.3	Confident	76.3	Confident	98 Å²	98	112.8 Å²	112.8	46%	0.458	51%	0.509	S	S	.	.	H	α-helix	trans	-67.1	-36.7	176.6	-157.5	-165.2	-162	0	0	111.5	R472 Q474 W479 R480	R472-E476 WeakPolarHBondContact O-CB 3.41Å; R472-E476 PolarHBondContact O-N 3.18Å; Q474-E476 VanDerWaalsContact C-N 3.33Å; Q474-E476 PolarHBondContact O-N 3.27Å; E476-W479 PolarHBondContact O-N 3.02Å; E476-R480 WeakPolarHBondContact O-CG 3.46Å; E476-R480 PolarHBondContact O-N 2.92Å; E476-R480 IonicContact OE1-CZ 3.38Å; E476-R480 IonicContact OE1-NH2 3.24Å; E476-R480 PolarHBondContact OE1-NH2 2.86Å; E476-R480 IonicContact OE2-CZ 2.67Å; E476-R480 IonicContact OE2-NH2 2.85Å; E476-R480 PolarHBondContact OE2-NH2 3.17Å
477	K	82.7	Confident	76.5	Confident	118 Å²	118	113.4 Å²	113.4	51%	0.513	51%	0.509	S	S	.	.	H	α-helix	trans	-65.3	-41.2	172.6	-75.8	166.2	-173.5	162.2	0	112	E473 Q474 E475 R480 Q481	E473-K477 WeakPolarHBondContact O-CB 3.32Å; E473-K477 WeakPolarHBondContact O-CD 3.26Å; E473-K477 VanDerWaalsContact O-CG 3.23Å; E473-K477 WeakPolarHBondContact O-CG 3.44Å; E473-K477 PolarHBondContact O-N 2.81Å; Q474-K477 WeakPolarHBondContact O-CB 3.3Å; Q474-K477 PolarHBondContact O-N 3.14Å; E475-K477 PolarHBondContact O-N 2.85Å; K477-R480 PolarHBondContact O-N 3.31Å; K477-Q481 WeakPolarHBondContact O-CG 3.34Å; K477-Q481 PolarHBondContact O-N 2.97Å; K477-Q481 VanDerWaalsContact O-N 3.09Å
478	V	76	Confident	76.7	Confident	72 Å²	72	113.4 Å²	113.4	44%	0.436	51%	0.509	S	S	.	.	H	α-helix	trans	-63.7	-43.9	174.6	171.8	0	0	0	0	110.1	Q474 E475 R480 Q481 E482	Q474-V478 WeakPolarHBondContact O-CG2 3.43Å; Q474-V478 PolarHBondContact O-N 3.22Å; E475-V478 PolarHBondContact O-N 3.38Å; V478-R480 PolarHBondContact O-N 3.39Å; V478-Q481 CarbonylContact O-C 3.56Å; V478-Q481 WeakPolarHBondContact O-CA 3.49Å; V478-Q481 WeakPolarHBondContact O-CB 3.36Å; V478-Q481 PolarHBondContact O-N 3.49Å; V478-E482 HydrophobicContact CG1-CG 4.47Å; V478-E482 PolarHBondContact O-N 3.37Å
479	W	83.3	Confident	76.9	Confident	138 Å²	138	114.1 Å²	114.1	52%	0.523	51%	0.512	S	S	.	.	H	α-helix	trans	-61.2	-43.7	177.6	-168.5	85.2	0	0	0	112.3	E475 E476 Q481 E482 E483	E475-W479 WeakPolarHBondContact O-CB 3.45Å; E475-W479 PolarHBondContact O-N 3.22Å; E476-W479 PolarHBondContact O-N 3.02Å; W479-Q481 PolarHBondContact O-N 3.46Å; W479-E482 PolarHBondContact O-N 3.2Å; W479-E483 WeakPolarHBondContact CZ3-OE2 3.42Å; W479-E483 WeakPolarHBondContact O-CB 3.33Å; W479-E483 PolarHBondContact O-N 3.42Å
480	R	80.6	Confident	77.4	Confident	125 Å²	125	114.4 Å²	114.4	47%	0.472	51%	0.514	S	S	.	.	H	α-helix	trans	-63.2	-29	172.9	-69.6	-179.4	-144.5	-109.4	6.9	112.9	E476 K477 V478 K484	E476-R480 WeakPolarHBondContact O-CG 3.46Å; E476-R480 PolarHBondContact O-N 2.92Å; E476-R480 IonicContact OE1-CZ 3.38Å; E476-R480 IonicContact OE1-NH2 3.24Å; E476-R480 PolarHBondContact OE1-NH2 2.86Å; E476-R480 IonicContact OE2-CZ 2.67Å; E476-R480 IonicContact OE2-NH2 2.85Å; E476-R480 PolarHBondContact OE2-NH2 3.17Å; K477-R480 PolarHBondContact O-N 3.31Å; V478-R480 PolarHBondContact O-N 3.39Å; R480-K484 WeakPolarHBondContact O-CG 3.47Å; R480-K484 PolarHBondContact O-N 2.93Å
481	Q	76.7	Confident	77.4	Confident	132 Å²	132	113.5 Å²	113.5	62%	0.617	51%	0.51	S	S	*	.	H	α-helix	trans	-75.3	-43.1	173.5	-75.4	-173	-5.4	0	0	111.6	K477 V478 W479 E483 K484 I485	K477-Q481 WeakPolarHBondContact O-CG 3.34Å; K477-Q481 PolarHBondContact O-N 2.97Å; K477-Q481 VanDerWaalsContact O-N 3.09Å; V478-Q481 CarbonylContact O-C 3.56Å; V478-Q481 WeakPolarHBondContact O-CA 3.49Å; V478-Q481 WeakPolarHBondContact O-CB 3.36Å; V478-Q481 PolarHBondContact O-N 3.49Å; W479-Q481 PolarHBondContact O-N 3.46Å; Q481-E483 VanDerWaalsContact C-N 3.32Å; Q481-E483 PolarHBondContact O-N 2.92Å; Q481-K484 PolarHBondContact O-N 3.26Å; Q481-I485 WeakPolarHBondContact O-CG1 3.41Å; Q481-I485 PolarHBondContact O-N 2.92Å
482	E	72.1	Confident	76	Confident	94 Å²	94	114.6 Å²	114.6	44%	0.439	51%	0.514	S	S	.	.	H	α-helix	trans	-61.3	-38.8	174.4	-75.8	-174.8	171.4	0	0	112.3	V478 W479 I485 R486	V478-E482 HydrophobicContact CG1-CG 4.47Å; V478-E482 PolarHBondContact O-N 3.37Å; W479-E482 PolarHBondContact O-N 3.2Å; E482-I485 PolarHBondContact O-N 3.34Å; E482-R486 PolarHBondContact O-N 3.41Å
483	E	77.5	Confident	76.4	Confident	83 Å²	83	114.2 Å²	114.2	39%	0.388	51%	0.513	S	S	.	.	H	α-helix	trans	-61.9	-45.1	175.9	-171.8	175.5	-144.7	0	0	111.2	W479 Q481 I485 R486 E487	W479-E483 WeakPolarHBondContact CZ3-OE2 3.42Å; W479-E483 WeakPolarHBondContact O-CB 3.33Å; W479-E483 PolarHBondContact O-N 3.42Å; Q481-E483 VanDerWaalsContact C-N 3.32Å; Q481-E483 PolarHBondContact O-N 2.92Å; E483-I485 VanDerWaalsContact C-N 3.32Å; E483-I485 PolarHBondContact O-N 3.44Å; E483-R486 WeakPolarHBondContact O-CB 3.48Å; E483-R486 PolarHBondContact O-N 3.43Å; E483-E487 PolarHBondContact O-N 2.91Å
484	K	84.1	Confident	76.7	Confident	139 Å²	139	116.2 Å²	116.2	60%	0.604	52%	0.516	S	S	*	.	H	α-helix	trans	-63.1	-36.6	174.9	-72.6	175.7	-177.9	-176.6	0	113	R480 Q481 Q488	R480-K484 WeakPolarHBondContact O-CG 3.47Å; R480-K484 PolarHBondContact O-N 2.93Å; Q481-K484 PolarHBondContact O-N 3.26Å; K484-Q488 WeakPolarHBondContact O-CG 3.45Å; K484-Q488 PolarHBondContact O-N 3.47Å; K484-Q488 VanDerWaalsContact O-N 3.1Å
485	I	81.3	Confident	76.6	Confident	96 Å²	96	116.2 Å²	116.2	49%	0.492	52%	0.516	S	S	.	.	H	α-helix	trans	-65.7	-44.7	174.7	-67.9	167.6	0	0	0	109.6	Q481 E482 E483 E487 Q488 E489	Q481-I485 WeakPolarHBondContact O-CG1 3.41Å; Q481-I485 PolarHBondContact O-N 2.92Å; E482-I485 PolarHBondContact O-N 3.34Å; E483-I485 VanDerWaalsContact C-N 3.32Å; E483-I485 PolarHBondContact O-N 3.44Å; I485-E487 PolarHBondContact O-N 3.49Å; I485-Q488 WeakPolarHBondContact O-CB 3.48Å; I485-Q488 PolarHBondContact O-N 3.44Å; I485-Q488 VanDerWaalsContact O-N 3.09Å; I485-E489 HydrophobicContact CG2-CG 4.4Å; I485-E489 WeakPolarHBondContact O-CG 3.49Å; I485-E489 PolarHBondContact O-N 2.85Å
486	R	72.9	Confident	76.5	Confident	149 Å²	149	115.6 Å²	115.6	56%	0.562	51%	0.513	S	S	*	.	H	α-helix	trans	-60.5	-42	176.8	-116.2	-178.4	-84.6	177.4	-6.3	112.6	E482 E483 Q488 E489 E490	E482-R486 PolarHBondContact O-N 3.41Å; E483-R486 WeakPolarHBondContact O-CB 3.48Å; E483-R486 PolarHBondContact O-N 3.43Å; R486-Q488 VanDerWaalsContact C-N 3.31Å; R486-Q488 PolarHBondContact O-N 2.88Å; R486-E489 PolarHBondContact O-N 3.21Å; R486-E490 WeakPolarHBondContact O-CB 3.38Å; R486-E490 PolarHBondContact O-N 3.44Å
487	E	75.1	Confident	76.4	Confident	97 Å²	97	114.8 Å²	114.8	45%	0.453	51%	0.509	S	S	.	.	H	α-helix	trans	-63.8	-35.6	174	-73.3	-176.8	176.7	0	0	112.7	E483 I485 K491	E483-E487 PolarHBondContact O-N 2.91Å; I485-E487 PolarHBondContact O-N 3.49Å; E487-K491 WeakPolarHBondContact O-CB 3.41Å; E487-K491 VanDerWaalsContact O-CG 3.25Å; E487-K491 WeakPolarHBondContact O-CG 3.15Å; E487-K491 PolarHBondContact O-N 2.92Å
488	Q	77.9	Confident	76.1	Confident	121 Å²	121	115.5 Å²	115.5	57%	0.565	51%	0.513	S	S	*	.	H	α-helix	trans	-70	-42.1	175.3	-71.5	-79.9	-17.4	0	0	111.4	K484 I485 R486 K491 M492	K484-Q488 WeakPolarHBondContact O-CG 3.45Å; K484-Q488 PolarHBondContact O-N 3.47Å; K484-Q488 VanDerWaalsContact O-N 3.1Å; I485-Q488 WeakPolarHBondContact O-CB 3.48Å; I485-Q488 PolarHBondContact O-N 3.44Å; I485-Q488 VanDerWaalsContact O-N 3.09Å; R486-Q488 VanDerWaalsContact C-N 3.31Å; R486-Q488 PolarHBondContact O-N 2.88Å; Q488-K491 PolarHBondContact O-N 3.11Å; Q488-M492 PolarHBondContact O-N 3.42Å
489	E	74.2	Confident	76.1	Confident	112 Å²	112	116.5 Å²	116.5	52%	0.523	52%	0.515	S	S	.	.	H	α-helix	trans	-61.7	-41.9	173.9	-72.8	177.6	167.1	0	0	111.5	I485 R486 M492 W493	I485-E489 HydrophobicContact CG2-CG 4.4Å; I485-E489 WeakPolarHBondContact O-CG 3.49Å; I485-E489 PolarHBondContact O-N 2.85Å; R486-E489 PolarHBondContact O-N 3.21Å; E489-M492 PolarHBondContact O-N 3.02Å; E489-W493 WeakPolarHBondContact O-CB 3.31Å; E489-W493 PolarHBondContact O-N 3.43Å
490	E	79.9	Confident	75.5	Confident	99 Å²	99	116.6 Å²	116.6	46%	0.463	52%	0.515	S	S	.	.	H	α-helix	trans	-67.1	-36.6	176.7	-162.3	-176.7	162.2	0	0	112	R486 W493 R494	R486-E490 WeakPolarHBondContact O-CB 3.38Å; R486-E490 PolarHBondContact O-N 3.44Å; E490-W493 PolarHBondContact O-N 2.91Å; E490-R494 WeakPolarHBondContact O-CG 3.42Å; E490-R494 PolarHBondContact O-N 2.95Å; E490-R494 IonicContact OE1-CZ 3.67Å; E490-R494 IonicContact OE1-NE 3.78Å; E490-R494 IonicContact OE1-NH2 3.35Å; E490-R494 PolarHBondContact OE1-NH2 2.97Å
491	K	83.3	Confident	75	Confident	115 Å²	115	116.2 Å²	116.2	50%	0.5	52%	0.519	S	S	.	.	H	α-helix	trans	-65.1	-42.8	172.4	-77	169.7	-175.2	168.4	0	112	E487 Q488 W493 R494 Q495	E487-K491 WeakPolarHBondContact O-CB 3.41Å; E487-K491 VanDerWaalsContact O-CG 3.25Å; E487-K491 WeakPolarHBondContact O-CG 3.15Å; E487-K491 PolarHBondContact O-N 2.92Å; Q488-K491 PolarHBondContact O-N 3.11Å; K491-W493 VanDerWaalsContact C-N 3.34Å; K491-R494 PolarHBondContact O-N 3.16Å; K491-Q495 WeakPolarHBondContact O-CG 3.38Å; K491-Q495 PolarHBondContact O-N 2.95Å
492	M	45.9	Very low	74.7	Confident	119 Å²	119	115.4 Å²	115.4	59%	0.586	52%	0.515	S	S	*	.	H	α-helix	trans	-61.9	-43.5	173.5	-75.2	-157	-47.2	0	0	111.1	Q488 E489 R494 Q495 E496	Q488-M492 PolarHBondContact O-N 3.42Å; E489-M492 PolarHBondContact O-N 3.02Å; M492-R494 PolarHBondContact O-N 2.75Å; M492-Q495 CarbonylContact O-C 3.59Å; M492-Q495 WeakPolarHBondContact O-CB 3.49Å; M492-Q495 PolarHBondContact O-N 3.47Å; M492-Q495 VanDerWaalsContact O-N 3.09Å; M492-E496 PolarHBondContact O-N 3.38Å
493	W	80.8	Confident	74.9	Confident	138 Å²	138	116 Å²	116	52%	0.523	52%	0.517	S	S	.	.	H	α-helix	trans	-63.1	-42.6	179.7	-165.5	84.6	0	0	0	112.1	E489 E490 K491 Q495 E496 E497	E489-W493 WeakPolarHBondContact O-CB 3.31Å; E489-W493 PolarHBondContact O-N 3.43Å; E490-W493 PolarHBondContact O-N 2.91Å; K491-W493 VanDerWaalsContact C-N 3.34Å; W493-Q495 VanDerWaalsContact C-N 3.28Å; W493-Q495 PolarHBondContact O-N 3.49Å; W493-E496 PolarHBondContact O-N 3.39Å; W493-E497 VanDerWaalsContact CZ3-OE2 3.27Å; W493-E497 WeakPolarHBondContact CZ3-OE2 3.43Å; W493-E497 WeakPolarHBondContact O-CB 3.46Å; W493-E497 PolarHBondContact O-N 3.09Å
494	R	78.9	Confident	74.4	Confident	139 Å²	139	118.2 Å²	118.2	53%	0.525	53%	0.528	S	S	.	.	H	α-helix	trans	-64.5	-31.1	173	-70.3	175.9	-165.4	-107.4	7.5	112.8	E490 K491 M492 K498	E490-R494 WeakPolarHBondContact O-CG 3.42Å; E490-R494 PolarHBondContact O-N 2.95Å; E490-R494 IonicContact OE1-CZ 3.67Å; E490-R494 IonicContact OE1-NE 3.78Å; E490-R494 IonicContact OE1-NH2 3.35Å; E490-R494 PolarHBondContact OE1-NH2 2.97Å; K491-R494 PolarHBondContact O-N 3.16Å; M492-R494 PolarHBondContact O-N 2.75Å; R494-K498 WeakPolarHBondContact O-CG 3.49Å; R494-K498 PolarHBondContact O-N 2.69Å
495	Q	74.3	Confident	73	Confident	133 Å²	133	116.4 Å²	116.4	62%	0.621	52%	0.523	S	S	*	.	H	α-helix	trans	-72.8	-43	173.1	-77.4	-172.8	-8.1	0	0	111.5	K491 M492 W493 E497 K498 I499	K491-Q495 WeakPolarHBondContact O-CG 3.38Å; K491-Q495 PolarHBondContact O-N 2.95Å; M492-Q495 CarbonylContact O-C 3.59Å; M492-Q495 WeakPolarHBondContact O-CB 3.49Å; M492-Q495 PolarHBondContact O-N 3.47Å; M492-Q495 VanDerWaalsContact O-N 3.09Å; W493-Q495 VanDerWaalsContact C-N 3.28Å; W493-Q495 PolarHBondContact O-N 3.49Å; Q495-E497 VanDerWaalsContact C-N 3.33Å; Q495-E497 PolarHBondContact O-N 3.04Å; Q495-K498 PolarHBondContact O-N 3.06Å; Q495-I499 VanDerWaalsContact O-CG1 3.29Å; Q495-I499 WeakPolarHBondContact O-CG1 3.27Å; Q495-I499 PolarHBondContact O-N 3.02Å
496	E	72.4	Confident	71.9	Confident	110 Å²	110	120.4 Å²	120.4	51%	0.514	53%	0.532	S	S	.	.	H	α-helix	trans	-60.1	-40.9	173.5	-90.5	-173.6	162.7	0	0	112.2	M492 W493 I499 R500	M492-E496 PolarHBondContact O-N 3.38Å; W493-E496 PolarHBondContact O-N 3.39Å; E496-I499 PolarHBondContact O-N 3.35Å; E496-R500 WeakPolarHBondContact O-CB 3.25Å; E496-R500 PolarHBondContact O-N 3.43Å
497	E	73.4	Confident	71.6	Confident	81 Å²	81	120.7 Å²	120.7	38%	0.379	53%	0.533	S	S	.	.	H	α-helix	trans	-61.8	-45.6	176.8	-170.5	173.5	-140.6	0	0	111.1	W493 Q495 I499 R500 E501	W493-E497 VanDerWaalsContact CZ3-OE2 3.27Å; W493-E497 WeakPolarHBondContact CZ3-OE2 3.43Å; W493-E497 WeakPolarHBondContact O-CB 3.46Å; W493-E497 PolarHBondContact O-N 3.09Å; Q495-E497 VanDerWaalsContact C-N 3.33Å; Q495-E497 PolarHBondContact O-N 3.04Å; E497-I499 VanDerWaalsContact C-N 3.35Å; E497-I499 PolarHBondContact O-N 2.86Å; E497-R500 PolarHBondContact O-N 3.48Å; E497-R500 VanDerWaalsContact O-N 3.14Å; E497-E501 WeakPolarHBondContact O-CG 3.43Å; E497-E501 PolarHBondContact O-N 2.82Å
498	K	77.4	Confident	71.3	Confident	133 Å²	133	122.3 Å²	122.3	58%	0.578	54%	0.54	S	S	*	.	H	α-helix	trans	-62.9	-38.7	175	-72.8	177.6	-178.7	-170.8	0	113.2	R494 Q495 R500 Q502	R494-K498 WeakPolarHBondContact O-CG 3.49Å; R494-K498 PolarHBondContact O-N 2.69Å; Q495-K498 PolarHBondContact O-N 3.06Å; K498-R500 VanDerWaalsContact C-N 3.31Å; K498-Q502 WeakPolarHBondContact O-CB 3.2Å; K498-Q502 VanDerWaalsContact O-CG 3.28Å; K498-Q502 WeakPolarHBondContact O-CG 3.36Å; K498-Q502 PolarHBondContact O-N 3.47Å
499	I	76.4	Confident	70.7	Confident	93 Å²	93	121.3 Å²	121.3	48%	0.477	54%	0.536	S	S	.	.	H	α-helix	trans	-64.4	-41.5	175.2	-68.3	165.1	0	0	0	109.7	Q495 E496 E497 Q502 E503	Q495-I499 VanDerWaalsContact O-CG1 3.29Å; Q495-I499 WeakPolarHBondContact O-CG1 3.27Å; Q495-I499 PolarHBondContact O-N 3.02Å; E496-I499 PolarHBondContact O-N 3.35Å; E497-I499 VanDerWaalsContact C-N 3.35Å; E497-I499 PolarHBondContact O-N 2.86Å; I499-Q502 PolarHBondContact O-N 3.3Å; I499-E503 PolarHBondContact O-N 2.84Å
500	R	70.9	Confident	70.3	Confident	141 Å²	141	121.8 Å²	121.8	53%	0.532	54%	0.538	S	S	.	.	H	α-helix	trans	-68	-40	180	-150.7	-179.4	-75.1	154.1	-1	112.1	E496 E497 K498 E503 E504	E496-R500 WeakPolarHBondContact O-CB 3.25Å; E496-R500 PolarHBondContact O-N 3.43Å; E497-R500 PolarHBondContact O-N 3.48Å; E497-R500 VanDerWaalsContact O-N 3.14Å; K498-R500 VanDerWaalsContact C-N 3.31Å; R500-E503 PolarHBondContact O-N 2.98Å; R500-E504 PolarHBondContact O-N 3.37Å
501	E	70.7	Confident	69.7	Low	117 Å²	117	123.3 Å²	123.3	55%	0.547	54%	0.543	S	S	.	.	H	α-helix	trans	-63.6	-40.6	171.7	-72.8	178.2	167.3	0	0	111.9	E497 E504 M505	E497-E501 WeakPolarHBondContact O-CG 3.43Å; E497-E501 PolarHBondContact O-N 2.82Å; E501-E504 PolarHBondContact O-N 3.17Å; E501-M505 PolarHBondContact O-N 2.69Å
502	Q	69.9	Low	67.8	Low	115 Å²	115	123.9 Å²	123.9	54%	0.537	55%	0.549	S	S	.	.	H	α-helix	trans	-63.9	-43.3	173.6	-75.2	179.9	9.9	0	0	111.4	K498 I499 E504 M505 W506	K498-Q502 WeakPolarHBondContact O-CB 3.2Å; K498-Q502 VanDerWaalsContact O-CG 3.28Å; K498-Q502 WeakPolarHBondContact O-CG 3.36Å; K498-Q502 PolarHBondContact O-N 3.47Å; I499-Q502 PolarHBondContact O-N 3.3Å; Q502-E504 VanDerWaalsContact C-N 3.33Å; Q502-E504 PolarHBondContact O-N 3.05Å; Q502-M505 PolarHBondContact O-N 3.49Å; Q502-W506 PolarHBondContact O-N 2.86Å
503	E	74.7	Confident	68.6	Low	106 Å²	106	123.8 Å²	123.8	50%	0.495	55%	0.547	S	S	.	.	H	α-helix	trans	-62.3	-36.8	175.7	-78	-173.7	175.9	0	0	113.1	I499 R500 R507	I499-E503 PolarHBondContact O-N 2.84Å; R500-E503 PolarHBondContact O-N 2.98Å; E503-R507 WeakPolarHBondContact O-CG 3.47Å; E503-R507 PolarHBondContact O-N 2.85Å; E503-R507 VanDerWaalsContact O-N 3.09Å
504	E	68.7	Low	68.1	Low	130 Å²	130	122.5 Å²	122.5	61%	0.607	55%	0.547	S	S	*	.	H	α-helix	trans	-67	-42.6	174.6	-77.1	-171.3	164.6	0	0	111.8	R500 E501 Q502 W506 R507 E508	R500-E504 PolarHBondContact O-N 3.37Å; E501-E504 PolarHBondContact O-N 3.17Å; Q502-E504 VanDerWaalsContact C-N 3.33Å; Q502-E504 PolarHBondContact O-N 3.05Å; E504-W506 PolarHBondContact O-N 3.38Å; E504-R507 PolarHBondContact O-N 3.41Å; E504-E508 PolarHBondContact O-N 3.37Å
505	M	54.9	Low	67.5	Low	100 Å²	100	122.2 Å²	122.2	49%	0.493	55%	0.551	S	S	.	*	H	α-helix	trans	-60.2	-44.5	175.6	-159.9	-149.7	-45.2	0	0	111.7	E501 Q502 R507 E508 E509	E501-M505 PolarHBondContact O-N 2.69Å; Q502-M505 PolarHBondContact O-N 3.49Å; M505-R507 PolarHBondContact O-N 2.83Å; M505-E508 PolarHBondContact O-N 3.17Å; M505-E508 VanDerWaalsContact O-N 3.16Å; M505-E509 PolarHBondContact O-N 3.44Å
506	W	56.9	Low	67.4	Low	180 Å²	180	120 Å²	120	68%	0.682	54%	0.541	S	S	*	.	H	α-helix	trans	-65.4	-37.1	178.4	-83.4	65.8	0	0	0	112.5	Q502 E504 E508 E509 E510	Q502-W506 PolarHBondContact O-N 2.86Å; E504-W506 PolarHBondContact O-N 3.38Å; W506-E508 VanDerWaalsContact C-N 3.3Å; W506-E508 PolarHBondContact O-N 3Å; W506-E509 PolarHBondContact O-N 2.94Å; W506-E510 WeakPolarHBondContact O-CB 3.46Å; W506-E510 PolarHBondContact O-N 3.03Å
507	R	66.1	Low	67.3	Low	156 Å²	156	121.8 Å²	121.8	59%	0.589	55%	0.547	S	S	*	.	H	α-helix	trans	-67.2	-31.4	173.5	-75.8	-178.5	-156.9	-116.8	4.4	112.6	E503 E504 M505 K511	E503-R507 WeakPolarHBondContact O-CG 3.47Å; E503-R507 PolarHBondContact O-N 2.85Å; E503-R507 VanDerWaalsContact O-N 3.09Å; E504-R507 PolarHBondContact O-N 3.41Å; M505-R507 PolarHBondContact O-N 2.83Å; R507-K511 WeakPolarHBondContact O-CG 3.42Å; R507-K511 PolarHBondContact O-N 3.47Å
508	E	69.5	Low	67.2	Low	130 Å²	130	123.5 Å²	123.5	61%	0.607	56%	0.557	S	S	*	*	H	α-helix	trans	-74	-40.7	174.6	-74.8	-178.8	165.7	0	0	111.6	E504 M505 W506 E510 K511 M512	E504-E508 PolarHBondContact O-N 3.37Å; M505-E508 PolarHBondContact O-N 3.17Å; M505-E508 VanDerWaalsContact O-N 3.16Å; W506-E508 VanDerWaalsContact C-N 3.3Å; W506-E508 PolarHBondContact O-N 3Å; E508-E510 VanDerWaalsContact C-N 3.35Å; E508-K511 PolarHBondContact O-N 3Å; E508-M512 WeakPolarHBondContact O-CG 3.44Å; E508-M512 PolarHBondContact O-N 3.12Å
509	E	64.6	Low	67.1	Low	100 Å²	100	123.9 Å²	123.9	47%	0.467	56%	0.555	S	S	.	*	H	α-helix	trans	-60.6	-42	170.5	-80.1	-174.3	157.2	0	0	111.9	M505 W506 K511 M512 H513	M505-E509 PolarHBondContact O-N 3.44Å; W506-E509 PolarHBondContact O-N 2.94Å; E509-K511 VanDerWaalsContact C-N 3.35Å; E509-K511 PolarHBondContact O-N 3.31Å; E509-M512 PolarHBondContact O-N 3.24Å; E509-H513 PolarHBondContact O-N 2.87Å
510	E	66.3	Low	66.7	Low	123 Å²	123	124.8 Å²	124.8	58%	0.575	56%	0.557	S	S	*	*	H	α-helix	trans	-61.4	-42.6	176.3	-170.1	176	-158.1	0	0	111.3	W506 E508 H513 E514	W506-E510 WeakPolarHBondContact O-CB 3.46Å; W506-E510 PolarHBondContact O-N 3.03Å; E508-E510 VanDerWaalsContact C-N 3.35Å; E510-H513 PolarHBondContact O-N 2.79Å; E510-E514 WeakPolarHBondContact O-CB 3.48Å; E510-E514 WeakPolarHBondContact O-CG 3.29Å; E510-E514 PolarHBondContact O-N 2.86Å
511	K	67	Low	66.5	Low	130 Å²	130	122.3 Å²	122.3	57%	0.565	55%	0.552	S	S	*	*	H	α-helix	trans	-66.1	-36.7	174.6	-74.8	173.6	-176.4	172	0	113	R507 E508 E509 Q515	R507-K511 WeakPolarHBondContact O-CG 3.42Å; R507-K511 PolarHBondContact O-N 3.47Å; E508-K511 PolarHBondContact O-N 3Å; E509-K511 VanDerWaalsContact C-N 3.35Å; E509-K511 PolarHBondContact O-N 3.31Å; K511-Q515 WeakPolarHBondContact O-CG 3.4Å; K511-Q515 PolarHBondContact O-N 3.03Å
512	M	44.6	Very low	66.6	Low	127 Å²	127	122.5 Å²	122.5	63%	0.626	55%	0.553	S	S	*	*	H	α-helix	trans	-65.9	-45.6	175.4	-78.2	-65.3	-62.5	0	0	110.8	E508 E509 E514 Q515 E516	E508-M512 WeakPolarHBondContact O-CG 3.44Å; E508-M512 PolarHBondContact O-N 3.12Å; E509-M512 PolarHBondContact O-N 3.24Å; M512-E514 PolarHBondContact O-N 3.48Å; M512-Q515 PolarHBondContact O-N 3.29Å; M512-E516 WeakPolarHBondContact O-CB 3.48Å; M512-E516 PolarHBondContact O-N 2.89Å
513	H	62.2	Low	67	Low	117 Å²	117	122 Å²	122	54%	0.542	55%	0.549	S	S	.	.	H	α-helix	trans	-67.1	-33.4	176	-90.8	-31.4	0	0	0	113.2	E509 E510 E516 K517	E509-H513 PolarHBondContact O-N 2.87Å; E510-H513 PolarHBondContact O-N 2.79Å; H513-E516 IonicContact CE1-OE2 2.64Å; H513-E516 IonicContact ND1-OE2 3.87Å; H513-E516 PolarHBondContact ND1-OE2 2.91Å; H513-E516 PolarHBondContact O-N 3.45Å; H513-K517 WeakPolarHBondContact O-CB 3.41Å; H513-K517 WeakPolarHBondContact O-CG 3.42Å; H513-K517 PolarHBondContact O-N 3.31Å
514	E	69.7	Low	66.9	Low	112 Å²	112	122.6 Å²	122.6	52%	0.523	55%	0.547	S	S	.	.	H	α-helix	trans	-65.8	-41.5	171.8	-79	-176.8	162.9	0	0	111.9	E510 M512 K517 I518	E510-E514 WeakPolarHBondContact O-CB 3.48Å; E510-E514 WeakPolarHBondContact O-CG 3.29Å; E510-E514 PolarHBondContact O-N 2.86Å; M512-E514 PolarHBondContact O-N 3.48Å; E514-K517 PolarHBondContact O-N 2.86Å; E514-I518 VanDerWaalsContact O-CG1 3.26Å; E514-I518 WeakPolarHBondContact O-CG1 3.49Å; E514-I518 PolarHBondContact O-N 2.94Å
515	Q	67.7	Low	67	Low	133 Å²	133	121.7 Å²	121.7	62%	0.621	54%	0.543	S	S	*	.	H	α-helix	trans	-66.6	-37.6	174.2	-74.1	-171.1	33.3	0	0	112.4	K511 M512 I518 W519	K511-Q515 WeakPolarHBondContact O-CG 3.4Å; K511-Q515 PolarHBondContact O-N 3.03Å; M512-Q515 PolarHBondContact O-N 3.29Å; Q515-I518 PolarHBondContact O-N 3.27Å; Q515-W519 PolarHBondContact O-N 3.12Å
516	E	71.7	Confident	68.1	Low	87 Å²	87	121.9 Å²	121.9	41%	0.407	54%	0.542	S	S	.	.	H	α-helix	trans	-64.3	-44.7	175.3	-169.2	170.9	-147.1	0	0	111.2	M512 H513 I518 W519 E520	M512-E516 WeakPolarHBondContact O-CB 3.48Å; M512-E516 PolarHBondContact O-N 2.89Å; H513-E516 IonicContact CE1-OE2 2.64Å; H513-E516 IonicContact ND1-OE2 3.87Å; H513-E516 PolarHBondContact ND1-OE2 2.91Å; H513-E516 PolarHBondContact O-N 3.45Å; E516-I518 VanDerWaalsContact C-N 3.34Å; E516-I518 PolarHBondContact O-N 3.18Å; E516-W519 PolarHBondContact O-N 3.47Å; E516-W519 VanDerWaalsContact O-N 3.15Å; E516-E520 WeakPolarHBondContact O-CG 3.36Å; E516-E520 PolarHBondContact O-N 3.35Å
517	K	70	Confident	68.8	Low	147 Å²	147	119 Å²	119	64%	0.639	54%	0.536	S	S	*	.	H	α-helix	trans	-59.1	-42.9	172.5	-80.4	-179.1	179.4	175.7	0	112.5	H513 E514 W519 E520 E521	H513-K517 WeakPolarHBondContact O-CB 3.41Å; H513-K517 WeakPolarHBondContact O-CG 3.42Å; H513-K517 PolarHBondContact O-N 3.31Å; E514-K517 PolarHBondContact O-N 2.86Å; K517-W519 VanDerWaalsContact C-N 3.29Å; K517-W519 PolarHBondContact O-N 3.41Å; K517-E520 PolarHBondContact O-N 3.44Å; K517-E521 WeakPolarHBondContact O-CB 3.33Å; K517-E521 PolarHBondContact O-N 3Å
518	I	71.3	Confident	69.4	Low	116 Å²	116	115.8 Å²	115.8	60%	0.595	53%	0.528	S	S	*	.	H	α-helix	trans	-61	-42.1	176.9	-70.1	165.6	0	0	0	110.4	E514 Q515 E516 E522	E514-I518 VanDerWaalsContact O-CG1 3.26Å; E514-I518 WeakPolarHBondContact O-CG1 3.49Å; E514-I518 PolarHBondContact O-N 2.94Å; Q515-I518 PolarHBondContact O-N 3.27Å; E516-I518 VanDerWaalsContact C-N 3.34Å; E516-I518 PolarHBondContact O-N 3.18Å; I518-E522 WeakPolarHBondContact O-CB 3.45Å; I518-E522 PolarHBondContact O-N 2.9Å
519	W	75.4	Confident	70	Confident	141 Å²	141	113.8 Å²	113.8	53%	0.534	52%	0.522	S	S	.	.	H	α-helix	trans	-71.4	-38.4	179.8	-173.2	53.5	0	0	0	113.4	Q515 E516 K517 E522 K523	Q515-W519 PolarHBondContact O-N 3.12Å; E516-W519 PolarHBondContact O-N 3.47Å; E516-W519 VanDerWaalsContact O-N 3.15Å; K517-W519 VanDerWaalsContact C-N 3.29Å; K517-W519 PolarHBondContact O-N 3.41Å; W519-E522 PolarHBondContact O-N 2.96Å; W519-K523 VanDerWaalsContact CZ2-CE 3.47Å; W519-K523 VanDerWaalsContact CZ2-NZ 3.34Å; W519-K523 PolarHBondContact O-N 2.97Å
520	E	67.2	Low	70.9	Confident	112 Å²	112	113.4 Å²	113.4	52%	0.523	52%	0.518	S	S	.	.	H	α-helix	trans	-66.4	-41.7	173.6	-73.6	-173.4	162.2	0	0	111.8	E516 K517 E522 K523 R524	E516-E520 WeakPolarHBondContact O-CG 3.36Å; E516-E520 PolarHBondContact O-N 3.35Å; K517-E520 PolarHBondContact O-N 3.44Å; E520-E522 VanDerWaalsContact C-N 3.33Å; E520-K523 PolarHBondContact O-N 3.37Å; E520-R524 WeakPolarHBondContact O-CB 3.42Å; E520-R524 PolarHBondContact O-N 2.85Å
521	E	68.5	Low	70	Confident	89 Å²	89	113 Å²	113	42%	0.416	52%	0.518	S	S	.	.	H	α-helix	trans	-62.9	-40.6	175.4	-162.8	86.6	-171.4	0	0	110.8	K517 R524 Q525	K517-E521 WeakPolarHBondContact O-CB 3.33Å; K517-E521 PolarHBondContact O-N 3Å; E521-R524 PolarHBondContact O-N 2.85Å; E521-R524 IonicContact OE1-CZ 3.53Å; E521-R524 IonicContact OE1-NH1 2.75Å; E521-R524 PolarHBondContact OE1-NH1 3.24Å; E521-R524 IonicContact OE1-NH2 2.8Å; E521-R524 PolarHBondContact OE1-NH2 2.97Å; E521-R524 IonicContact OE2-CZ 3.12Å; E521-R524 IonicContact OE2-NH1 3.39Å; E521-R524 PolarHBondContact OE2-NH1 2.75Å; E521-R524 IonicContact OE2-NH2 3.49Å; E521-Q525 WeakPolarHBondContact O-CB 3.25Å; E521-Q525 PolarHBondContact O-N 3.34Å
522	E	72.8	Confident	70.6	Confident	122 Å²	122	113.7 Å²	113.7	57%	0.57	52%	0.517	S	S	*	.	H	α-helix	trans	-63.5	-43.6	174.2	-173.1	178.3	-166.1	0	0	111.6	I518 W519 E520 R524 Q525 E526	I518-E522 WeakPolarHBondContact O-CB 3.45Å; I518-E522 PolarHBondContact O-N 2.9Å; W519-E522 PolarHBondContact O-N 2.96Å; E520-E522 VanDerWaalsContact C-N 3.33Å; E522-R524 PolarHBondContact O-N 2.81Å; E522-Q525 PolarHBondContact O-N 3.13Å; E522-E526 PolarHBondContact O-N 2.82Å
523	K	76.7	Confident	72.4	Confident	103 Å²	103	115 Å²	115	45%	0.448	52%	0.515	S	S	.	.	H	α-helix	trans	-63.2	-40	173.7	-88.3	-174.2	176.7	171.9	0	112.5	W519 E520 E526 Q527	W519-K523 VanDerWaalsContact CZ2-CE 3.47Å; W519-K523 VanDerWaalsContact CZ2-NZ 3.34Å; W519-K523 PolarHBondContact O-N 2.97Å; E520-K523 PolarHBondContact O-N 3.37Å; K523-E526 PolarHBondContact O-N 3.37Å; K523-Q527 WeakPolarHBondContact O-CG 3.43Å; K523-Q527 PolarHBondContact O-N 2.75Å
524	R	72.3	Confident	72.9	Confident	119 Å²	119	115.6 Å²	115.6	45%	0.449	52%	0.518	S	S	.	.	H	α-helix	trans	-64.3	-45.6	177	-162.2	-174.8	77.3	-129.6	-6.2	110.3	E520 E521 E522 E526 Q527 E528	E520-R524 WeakPolarHBondContact O-CB 3.42Å; E520-R524 PolarHBondContact O-N 2.85Å; E521-R524 PolarHBondContact O-N 2.85Å; E521-R524 IonicContact OE1-CZ 3.53Å; E521-R524 IonicContact OE1-NH1 2.75Å; E521-R524 PolarHBondContact OE1-NH1 3.24Å; E521-R524 IonicContact OE1-NH2 2.8Å; E521-R524 PolarHBondContact OE1-NH2 2.97Å; E521-R524 IonicContact OE2-CZ 3.12Å; E521-R524 IonicContact OE2-NH1 3.39Å; E521-R524 PolarHBondContact OE2-NH1 2.75Å; E521-R524 IonicContact OE2-NH2 3.49Å; E522-R524 PolarHBondContact O-N 2.81Å; R524-E526 VanDerWaalsContact C-N 3.32Å; R524-E526 PolarHBondContact O-N 2.71Å; R524-Q527 PolarHBondContact O-N 3.36Å; R524-Q527 VanDerWaalsContact O-N 3.17Å; R524-E528 IonicContact CZ-OE1 3.05Å; R524-E528 IonicContact NE-OE1 3.16Å; R524-E528 PolarHBondContact NE-OE1 2.91Å; R524-E528 WeakPolarHBondContact O-CG 3.25Å; R524-E528 PolarHBondContact O-N 3.27Å
525	Q	71.1	Confident	72.7	Confident	112 Å²	112	115.9 Å²	115.9	52%	0.523	52%	0.519	S	S	.	.	H	α-helix	trans	-59.4	-40.2	173.5	-96.8	177.3	-12.3	0	0	112.6	E521 E522 Q527 E528 D529	E521-Q525 WeakPolarHBondContact O-CB 3.25Å; E521-Q525 PolarHBondContact O-N 3.34Å; E522-Q525 PolarHBondContact O-N 3.13Å; Q525-Q527 VanDerWaalsContact C-N 3.3Å; Q525-Q527 PolarHBondContact O-N 2.86Å; Q525-E528 PolarHBondContact O-N 3Å; Q525-D529 WeakPolarHBondContact O-CB 3.22Å; Q525-D529 PolarHBondContact O-N 3Å
526	E	78	Confident	72.9	Confident	104 Å²	104	113.7 Å²	113.7	49%	0.486	51%	0.509	S	S	.	.	H	α-helix	trans	-66	-33.7	177.4	-153.4	-160.7	150	0	0	112.4	E522 K523 R524 K530	E522-E526 PolarHBondContact O-N 2.82Å; K523-E526 PolarHBondContact O-N 3.37Å; R524-E526 VanDerWaalsContact C-N 3.32Å; R524-E526 PolarHBondContact O-N 2.71Å; E526-K530 VanDerWaalsContact O-CG 3.28Å; E526-K530 WeakPolarHBondContact O-CG 3.43Å; E526-K530 PolarHBondContact O-N 3.04Å; E526-K530 VanDerWaalsContact O-N 3.09Å; E526-K530 WeakPolarHBondContact OE1-CE 3.43Å; E526-K530 IonicContact OE1-NZ 3.48Å; E526-K530 PolarHBondContact OE1-NZ 3.1Å
527	Q	72.8	Confident	73.4	Confident	119 Å²	119	116.2 Å²	116.2	56%	0.556	52%	0.519	S	S	*	.	H	α-helix	trans	-73.8	-42.3	174.2	-68.7	-69.9	5.1	0	0	112	K523 R524 Q525 D529 K530 M531	K523-Q527 WeakPolarHBondContact O-CG 3.43Å; K523-Q527 PolarHBondContact O-N 2.75Å; R524-Q527 PolarHBondContact O-N 3.36Å; R524-Q527 VanDerWaalsContact O-N 3.17Å; Q525-Q527 VanDerWaalsContact C-N 3.3Å; Q525-Q527 PolarHBondContact O-N 2.86Å; Q527-D529 VanDerWaalsContact C-N 3.31Å; Q527-D529 PolarHBondContact O-N 3.48Å; Q527-K530 WeakPolarHBondContact O-CB 3.48Å; Q527-K530 PolarHBondContact O-N 3.09Å; Q527-K530 VanDerWaalsContact O-N 3.15Å; Q527-M531 PolarHBondContact O-N 3.09Å
528	E	77.3	Confident	73.7	Confident	88 Å²	88	113.8 Å²	113.8	41%	0.411	51%	0.512	S	S	.	.	H	α-helix	trans	-58.6	-43.6	173.2	-73.1	172.1	-163.1	0	0	110.7	R524 Q525 K530 M531 W532	R524-E528 IonicContact CZ-OE1 3.05Å; R524-E528 IonicContact NE-OE1 3.16Å; R524-E528 PolarHBondContact NE-OE1 2.91Å; R524-E528 WeakPolarHBondContact O-CG 3.25Å; R524-E528 PolarHBondContact O-N 3.27Å; Q525-E528 PolarHBondContact O-N 3Å; E528-K530 PolarHBondContact O-N 3.41Å; E528-M531 PolarHBondContact O-N 2.91Å; E528-W532 WeakPolarHBondContact O-CB 3.43Å; E528-W532 PolarHBondContact O-N 3.43Å
529	D	82.4	Confident	73.7	Confident	89 Å²	89	117 Å²	117	48%	0.476	52%	0.516	S	S	.	.	H	α-helix	trans	-63.9	-36.6	174.5	-90.4	4	0	0	0	112.8	Q525 Q527 R533	Q525-D529 WeakPolarHBondContact O-CB 3.22Å; Q525-D529 PolarHBondContact O-N 3Å; Q527-D529 VanDerWaalsContact C-N 3.31Å; Q527-D529 PolarHBondContact O-N 3.48Å; D529-R533 VanDerWaalsContact O-CG 3.3Å; D529-R533 WeakPolarHBondContact O-CG 3.46Å; D529-R533 PolarHBondContact O-N 3.41Å
530	K	84.4	Confident	73.8	Confident	91 Å²	91	115.2 Å²	115.2	40%	0.396	51%	0.514	S	S	.	.	H	α-helix	trans	-67.9	-44	175.4	-80.3	168.3	-171.7	158	0	111.4	E526 Q527 E528 R533 Q534	E526-K530 VanDerWaalsContact O-CG 3.28Å; E526-K530 WeakPolarHBondContact O-CG 3.43Å; E526-K530 PolarHBondContact O-N 3.04Å; E526-K530 VanDerWaalsContact O-N 3.09Å; E526-K530 WeakPolarHBondContact OE1-CE 3.43Å; E526-K530 IonicContact OE1-NZ 3.48Å; E526-K530 PolarHBondContact OE1-NZ 3.1Å; Q527-K530 WeakPolarHBondContact O-CB 3.48Å; Q527-K530 PolarHBondContact O-N 3.09Å; Q527-K530 VanDerWaalsContact O-N 3.15Å; E528-K530 PolarHBondContact O-N 3.41Å; K530-R533 PolarHBondContact O-N 3.18Å; K530-Q534 PolarHBondContact O-N 3.01Å; K530-Q534 VanDerWaalsContact O-N 3.11Å
531	M	47.5	Very low	74.3	Confident	114 Å²	114	116.2 Å²	116.2	56%	0.562	52%	0.519	S	S	*	.	H	α-helix	trans	-60.9	-46.3	173.6	-75.3	-154.6	-51.5	0	0	110.7	Q527 E528 R533 Q534 E535	Q527-M531 PolarHBondContact O-N 3.09Å; E528-M531 PolarHBondContact O-N 2.91Å; M531-R533 VanDerWaalsContact C-N 3.31Å; M531-R533 PolarHBondContact O-N 2.9Å; M531-Q534 CarbonylContact O-C 3.6Å; M531-Q534 WeakPolarHBondContact O-CA 3.45Å; M531-Q534 WeakPolarHBondContact O-CB 3.47Å; M531-Q534 PolarHBondContact O-N 3.06Å; M531-E535 PolarHBondContact O-N 3.38Å
532	W	78.4	Confident	74	Confident	146 Å²	146	117.8 Å²	117.8	55%	0.553	53%	0.526	S	S	*	.	H	α-helix	trans	-59	-41.3	179.5	-169.4	89.2	0	0	0	112.2	E528 Q534 E535 E536	E528-W532 WeakPolarHBondContact O-CB 3.43Å; E528-W532 PolarHBondContact O-N 3.43Å; W532-Q534 VanDerWaalsContact C-N 3.31Å; W532-Q534 PolarHBondContact O-N 3.39Å; W532-E535 PolarHBondContact O-N 3.48Å; W532-E536 HydrophobicContact CH2-CG 4.42Å; W532-E536 WeakPolarHBondContact CH2-OE1 3.27Å; W532-E536 HydrophobicContact CZ3-CB 4.33Å; W532-E536 HydrophobicContact CZ3-CG 4.44Å; W532-E536 WeakPolarHBondContact CZ3-OE2 3.44Å; W532-E536 WeakPolarHBondContact O-CB 3.3Å; W532-E536 PolarHBondContact O-N 2.93Å
533	R	83.1	Confident	74.2	Confident	153 Å²	153	117 Å²	117	58%	0.577	52%	0.522	S	S	*	.	H	α-helix	trans	-66.8	-28.9	173.9	-71	177	-152.7	-129.9	6.8	113.5	D529 K530 M531 K537	D529-R533 VanDerWaalsContact O-CG 3.3Å; D529-R533 WeakPolarHBondContact O-CG 3.46Å; D529-R533 PolarHBondContact O-N 3.41Å; K530-R533 PolarHBondContact O-N 3.18Å; M531-R533 VanDerWaalsContact C-N 3.31Å; M531-R533 PolarHBondContact O-N 2.9Å; R533-K537 VanDerWaalsContact O-CG 3.31Å; R533-K537 WeakPolarHBondContact O-CG 3.44Å; R533-K537 PolarHBondContact O-N 2.84Å
534	Q	73.2	Confident	74.4	Confident	130 Å²	130	118 Å²	118	61%	0.607	53%	0.526	S	S	*	.	H	α-helix	trans	-74.3	-44.8	173.7	-73.7	-173.2	3.2	0	0	110.8	K530 M531 W532 E536 K537 I538	K530-Q534 PolarHBondContact O-N 3.01Å; K530-Q534 VanDerWaalsContact O-N 3.11Å; M531-Q534 CarbonylContact O-C 3.6Å; M531-Q534 WeakPolarHBondContact O-CA 3.45Å; M531-Q534 WeakPolarHBondContact O-CB 3.47Å; M531-Q534 PolarHBondContact O-N 3.06Å; W532-Q534 VanDerWaalsContact C-N 3.31Å; W532-Q534 PolarHBondContact O-N 3.39Å; Q534-E536 VanDerWaalsContact C-N 3.3Å; Q534-E536 PolarHBondContact O-N 3.29Å; Q534-K537 WeakPolarHBondContact O-CB 3.48Å; Q534-K537 PolarHBondContact O-N 3.24Å; Q534-K537 VanDerWaalsContact O-N 3.17Å; Q534-I538 WeakPolarHBondContact O-CG1 3.5Å; Q534-I538 PolarHBondContact O-N 2.82Å
535	E	64.2	Low	74.3	Confident	118 Å²	118	115.8 Å²	115.8	55%	0.551	53%	0.526	S	S	*	.	H	α-helix	trans	-59.1	-40.6	174.3	-74	-175.8	168.5	0	0	112	M531 W532 K537 I538 R539	M531-E535 PolarHBondContact O-N 3.38Å; W532-E535 PolarHBondContact O-N 3.48Å; E535-K537 PolarHBondContact O-N 3.42Å; E535-I538 PolarHBondContact O-N 3.37Å; E535-R539 PolarHBondContact O-N 3.49Å
536	E	73	Confident	74.6	Confident	88 Å²	88	117.4 Å²	117.4	41%	0.411	53%	0.527	S	S	.	.	H	α-helix	trans	-62.3	-41.9	175.9	-169.6	178.9	-146.3	0	0	111.6	W532 Q534 I538 R539 E540	W532-E536 HydrophobicContact CH2-CG 4.42Å; W532-E536 WeakPolarHBondContact CH2-OE1 3.27Å; W532-E536 HydrophobicContact CZ3-CB 4.33Å; W532-E536 HydrophobicContact CZ3-CG 4.44Å; W532-E536 WeakPolarHBondContact CZ3-OE2 3.44Å; W532-E536 WeakPolarHBondContact O-CB 3.3Å; W532-E536 PolarHBondContact O-N 2.93Å; Q534-E536 VanDerWaalsContact C-N 3.3Å; Q534-E536 PolarHBondContact O-N 3.29Å; E536-I538 PolarHBondContact O-N 3.06Å; E536-R539 PolarHBondContact O-N 2.91Å; E536-E540 PolarHBondContact O-N 3.33Å
537	K	81.7	Confident	74.6	Confident	139 Å²	139	118.1 Å²	118.1	60%	0.604	53%	0.526	S	S	*	.	H	α-helix	trans	-65.4	-38.2	175.2	-74.1	173.7	-176.9	179.1	0	112.8	R533 Q534 E535 E540 Q541	R533-K537 VanDerWaalsContact O-CG 3.31Å; R533-K537 WeakPolarHBondContact O-CG 3.44Å; R533-K537 PolarHBondContact O-N 2.84Å; Q534-K537 WeakPolarHBondContact O-CB 3.48Å; Q534-K537 PolarHBondContact O-N 3.24Å; Q534-K537 VanDerWaalsContact O-N 3.17Å; E535-K537 PolarHBondContact O-N 3.42Å; K537-E540 PolarHBondContact O-N 3.13Å; K537-Q541 WeakPolarHBondContact O-CG 3.4Å; K537-Q541 PolarHBondContact O-N 3.13Å; K537-Q541 VanDerWaalsContact O-N 3.08Å
538	I	76.2	Confident	74.6	Confident	96 Å²	96	118.6 Å²	118.6	49%	0.492	53%	0.528	S	S	.	.	H	α-helix	trans	-64.1	-47.8	175.8	-68.1	167.6	0	0	0	109.1	Q534 E535 E536 E540 Q541 E542	Q534-I538 WeakPolarHBondContact O-CG1 3.5Å; Q534-I538 PolarHBondContact O-N 2.82Å; E535-I538 PolarHBondContact O-N 3.37Å; E536-I538 PolarHBondContact O-N 3.06Å; I538-E540 VanDerWaalsContact C-N 3.33Å; I538-E540 PolarHBondContact O-N 2.79Å; I538-Q541 WeakPolarHBondContact O-CA 3.27Å; I538-Q541 WeakPolarHBondContact O-CB 3.37Å; I538-Q541 PolarHBondContact O-N 3.43Å; I538-E542 HydrophobicContact CG2-CG 4.33Å; I538-E542 WeakPolarHBondContact O-CG 3.32Å; I538-E542 PolarHBondContact O-N 3Å
539	R	72.3	Confident	73.9	Confident	184 Å²	184	119.8 Å²	119.8	69%	0.694	53%	0.534	S	S	*	.	H	α-helix	trans	-56.5	-43.2	174.7	-91.8	-174.9	-179.6	158.7	5.4	113	E535 E536 Q541 E542 E543	E535-R539 PolarHBondContact O-N 3.49Å; E536-R539 PolarHBondContact O-N 2.91Å; R539-Q541 VanDerWaalsContact C-N 3.28Å; R539-Q541 PolarHBondContact O-N 3.08Å; R539-E542 PolarHBondContact O-N 3.06Å; R539-E543 WeakPolarHBondContact O-CB 3.43Å; R539-E543 PolarHBondContact O-N 2.93Å
540	E	77.7	Confident	73.4	Confident	103 Å²	103	119.9 Å²	119.9	48%	0.481	53%	0.531	S	S	.	.	H	α-helix	trans	-64.1	-32.5	176	-76.3	-171.5	175.1	0	0	112.9	E536 K537 I538 K544	E536-E540 PolarHBondContact O-N 3.33Å; K537-E540 PolarHBondContact O-N 3.13Å; I538-E540 VanDerWaalsContact C-N 3.33Å; I538-E540 PolarHBondContact O-N 2.79Å; E540-K544 WeakPolarHBondContact O-CD 3.38Å; E540-K544 VanDerWaalsContact O-CG 3.28Å; E540-K544 WeakPolarHBondContact O-CG 3.34Å; E540-K544 PolarHBondContact O-N 3.47Å
541	Q	76.2	Confident	72.9	Confident	134 Å²	134	122.1 Å²	122.1	63%	0.626	54%	0.541	S	S	*	.	H	α-helix	trans	-72.5	-45.4	174.4	-69.6	-130.6	3.1	0	0	111.5	K537 I538 R539 E543 K544 V545	K537-Q541 WeakPolarHBondContact O-CG 3.4Å; K537-Q541 PolarHBondContact O-N 3.13Å; K537-Q541 VanDerWaalsContact O-N 3.08Å; I538-Q541 WeakPolarHBondContact O-CA 3.27Å; I538-Q541 WeakPolarHBondContact O-CB 3.37Å; I538-Q541 PolarHBondContact O-N 3.43Å; R539-Q541 VanDerWaalsContact C-N 3.28Å; R539-Q541 PolarHBondContact O-N 3.08Å; Q541-E543 VanDerWaalsContact C-N 3.28Å; Q541-E543 PolarHBondContact O-N 3.02Å; Q541-K544 WeakPolarHBondContact O-CB 3.43Å; Q541-K544 PolarHBondContact O-N 3.26Å; Q541-K544 VanDerWaalsContact O-N 3.09Å; Q541-V545 WeakPolarHBondContact O-CG2 3.37Å; Q541-V545 PolarHBondContact O-N 2.85Å
542	E	63.6	Low	74.2	Confident	121 Å²	121	121.8 Å²	121.8	57%	0.565	54%	0.54	S	S	*	.	H	α-helix	trans	-57.1	-43.3	174.9	-71.2	177	167.2	0	0	111.1	I538 R539 K544 V545 W546	I538-E542 HydrophobicContact CG2-CG 4.33Å; I538-E542 WeakPolarHBondContact O-CG 3.32Å; I538-E542 PolarHBondContact O-N 3Å; R539-E542 PolarHBondContact O-N 3.06Å; E542-K544 VanDerWaalsContact C-N 3.31Å; E542-K544 PolarHBondContact O-N 3.48Å; E542-V545 PolarHBondContact O-N 3.36Å; E542-W546 WeakPolarHBondContact O-CB 3.35Å; E542-W546 PolarHBondContact O-N 3.48Å
543	E	76.1	Confident	73.9	Confident	105 Å²	105	124.5 Å²	124.5	49%	0.491	55%	0.55	S	S	.	*	H	α-helix	trans	-66.8	-32	178.1	-145.9	-163.4	-159.5	0	0	112.2	R539 Q541 R547	R539-E543 WeakPolarHBondContact O-CB 3.43Å; R539-E543 PolarHBondContact O-N 2.93Å; Q541-E543 VanDerWaalsContact C-N 3.28Å; Q541-E543 PolarHBondContact O-N 3.02Å; E543-R547 VanDerWaalsContact O-CG 3.32Å; E543-R547 WeakPolarHBondContact O-CG 3.34Å; E543-R547 PolarHBondContact O-N 3.5Å; E543-R547 VanDerWaalsContact O-N 3.07Å; E543-R547 IonicContact OE1-NH2 3.43Å; E543-R547 PolarHBondContact OE1-NH2 3.11Å; E543-R547 VanDerWaalsContact OE1-NH2 3.12Å; E543-R547 IonicContact OE2-CZ 2.7Å; E543-R547 IonicContact OE2-NE 2.84Å; E543-R547 IonicContact OE2-NH2 3.24Å; E543-R547 PolarHBondContact OE2-NH2 3.25Å
544	K	80.7	Confident	73.5	Confident	124 Å²	124	122 Å²	122	54%	0.539	55%	0.545	S	S	.	.	H	α-helix	trans	-70	-42.3	173	-77.3	166.5	-174.7	159.2	0	112.1	E540 Q541 E542 W546 R547 Q548	E540-K544 WeakPolarHBondContact O-CD 3.38Å; E540-K544 VanDerWaalsContact O-CG 3.28Å; E540-K544 WeakPolarHBondContact O-CG 3.34Å; E540-K544 PolarHBondContact O-N 3.47Å; Q541-K544 WeakPolarHBondContact O-CB 3.43Å; Q541-K544 PolarHBondContact O-N 3.26Å; Q541-K544 VanDerWaalsContact O-N 3.09Å; E542-K544 VanDerWaalsContact C-N 3.31Å; E542-K544 PolarHBondContact O-N 3.48Å; K544-W546 VanDerWaalsContact C-N 3.34Å; K544-R547 PolarHBondContact O-N 2.9Å; K544-Q548 PolarHBondContact O-N 3.37Å; K544-Q548 VanDerWaalsContact O-N 3.07Å
545	V	70.8	Confident	73.4	Confident	73 Å²	73	122.8 Å²	122.8	44%	0.442	55%	0.549	S	S	.	.	H	α-helix	trans	-61.6	-46.7	175.3	172.8	0	0	0	0	109.4	Q541 E542 R547 Q548 E549	Q541-V545 WeakPolarHBondContact O-CG2 3.37Å; Q541-V545 PolarHBondContact O-N 2.85Å; E542-V545 PolarHBondContact O-N 3.36Å; V545-R547 PolarHBondContact O-N 3.27Å; V545-Q548 CarbonylContact O-C 3.58Å; V545-Q548 WeakPolarHBondContact O-CA 3.42Å; V545-Q548 WeakPolarHBondContact O-CB 3.46Å; V545-Q548 PolarHBondContact O-N 2.98Å; V545-E549 HydrophobicContact CG1-CG 4.37Å; V545-E549 PolarHBondContact O-N 3.32Å
546	W	77	Confident	73.3	Confident	146 Å²	146	120.8 Å²	120.8	55%	0.553	54%	0.54	S	S	*	.	H	α-helix	trans	-58.4	-44.1	177.5	-171.2	83.1	0	0	0	112.6	E542 K544 Q548 E549 E550	E542-W546 WeakPolarHBondContact O-CB 3.35Å; E542-W546 PolarHBondContact O-N 3.48Å; K544-W546 VanDerWaalsContact C-N 3.34Å; W546-Q548 VanDerWaalsContact C-N 3.28Å; W546-Q548 PolarHBondContact O-N 3.39Å; W546-E549 PolarHBondContact O-N 3.24Å; W546-E550 WeakPolarHBondContact CZ3-OE2 3.38Å; W546-E550 WeakPolarHBondContact O-CB 3.3Å; W546-E550 PolarHBondContact O-N 3.28Å
547	R	77.4	Confident	73	Confident	120 Å²	120	123 Å²	123	45%	0.453	55%	0.55	S	S	.	.	H	α-helix	trans	-65.7	-26.7	174.1	-71	179.3	-146.2	-88	3.5	113.5	E543 K544 V545 K551	E543-R547 VanDerWaalsContact O-CG 3.32Å; E543-R547 WeakPolarHBondContact O-CG 3.34Å; E543-R547 PolarHBondContact O-N 3.5Å; E543-R547 VanDerWaalsContact O-N 3.07Å; E543-R547 IonicContact OE1-NH2 3.43Å; E543-R547 PolarHBondContact OE1-NH2 3.11Å; E543-R547 VanDerWaalsContact OE1-NH2 3.12Å; E543-R547 IonicContact OE2-CZ 2.7Å; E543-R547 IonicContact OE2-NE 2.84Å; E543-R547 IonicContact OE2-NH2 3.24Å; E543-R547 PolarHBondContact OE2-NH2 3.25Å; K544-R547 PolarHBondContact O-N 2.9Å; V545-R547 PolarHBondContact O-N 3.27Å; R547-K551 WeakPolarHBondContact O-CG 3.34Å; R547-K551 PolarHBondContact O-N 2.95Å
548	Q	73.2	Confident	72.8	Confident	129 Å²	129	122.5 Å²	122.5	60%	0.603	55%	0.548	S	S	*	.	H	α-helix	trans	-76.2	-44.6	173.3	-78	-171.8	-2.9	0	0	111.1	K544 V545 W546 E550 K551 I552	K544-Q548 PolarHBondContact O-N 3.37Å; K544-Q548 VanDerWaalsContact O-N 3.07Å; V545-Q548 CarbonylContact O-C 3.58Å; V545-Q548 WeakPolarHBondContact O-CA 3.42Å; V545-Q548 WeakPolarHBondContact O-CB 3.46Å; V545-Q548 PolarHBondContact O-N 2.98Å; W546-Q548 VanDerWaalsContact C-N 3.28Å; W546-Q548 PolarHBondContact O-N 3.39Å; Q548-E550 VanDerWaalsContact C-N 3.3Å; Q548-E550 PolarHBondContact O-N 3.29Å; Q548-K551 WeakPolarHBondContact O-CB 3.48Å; Q548-K551 PolarHBondContact O-N 2.87Å; Q548-K551 VanDerWaalsContact O-N 3.17Å; Q548-I552 WeakPolarHBondContact O-CG1 3.4Å; Q548-I552 PolarHBondContact O-N 3.46Å
549	E	62.9	Low	72.4	Confident	113 Å²	113	123.1 Å²	123.1	53%	0.528	54%	0.544	S	S	.	.	H	α-helix	trans	-58.5	-42.4	174.9	-73.2	-177.3	167.6	0	0	111.4	V545 W546 K551 I552 R553	V545-E549 HydrophobicContact CG1-CG 4.37Å; V545-E549 PolarHBondContact O-N 3.32Å; W546-E549 PolarHBondContact O-N 3.24Å; E549-K551 VanDerWaalsContact C-N 3.34Å; E549-K551 PolarHBondContact O-N 3.25Å; E549-I552 PolarHBondContact O-N 3.43Å; E549-R553 WeakPolarHBondContact O-CB 3.5Å; E549-R553 PolarHBondContact O-N 3.21Å
550	E	71.4	Confident	71.9	Confident	90 Å²	90	119.6 Å²	119.6	42%	0.421	54%	0.535	S	S	.	.	H	α-helix	trans	-59.4	-42.9	175.7	-169.4	179.5	-154.6	0	0	111.7	W546 Q548 R553 E554	W546-E550 WeakPolarHBondContact CZ3-OE2 3.38Å; W546-E550 WeakPolarHBondContact O-CB 3.3Å; W546-E550 PolarHBondContact O-N 3.28Å; Q548-E550 VanDerWaalsContact C-N 3.3Å; Q548-E550 PolarHBondContact O-N 3.29Å; E550-R553 PolarHBondContact O-N 3.03Å; E550-E554 PolarHBondContact O-N 2.83Å
551	K	73.4	Confident	71.6	Confident	138 Å²	138	119.8 Å²	119.8	60%	0.6	54%	0.536	S	S	*	.	H	α-helix	trans	-66.7	-37.8	175.8	-73.4	174.1	-176.5	178	0	113.2	R547 Q548 E549 R553 Q555	R547-K551 WeakPolarHBondContact O-CG 3.34Å; R547-K551 PolarHBondContact O-N 2.95Å; Q548-K551 WeakPolarHBondContact O-CB 3.48Å; Q548-K551 PolarHBondContact O-N 2.87Å; Q548-K551 VanDerWaalsContact O-N 3.17Å; E549-K551 VanDerWaalsContact C-N 3.34Å; E549-K551 PolarHBondContact O-N 3.25Å; K551-R553 VanDerWaalsContact C-N 3.32Å; K551-Q555 WeakPolarHBondContact O-CG 3.36Å; K551-Q555 PolarHBondContact O-N 2.98Å
552	I	76.3	Confident	71.1	Confident	108 Å²	108	120 Å²	120	55%	0.554	54%	0.537	S	S	*	.	H	α-helix	trans	-64.1	-44.4	175.2	-68.4	168	0	0	0	108.9	Q548 E549 E554 Q555 E556	Q548-I552 WeakPolarHBondContact O-CG1 3.4Å; Q548-I552 PolarHBondContact O-N 3.46Å; E549-I552 PolarHBondContact O-N 3.43Å; I552-E554 PolarHBondContact O-N 3.36Å; I552-Q555 PolarHBondContact O-N 2.91Å; I552-Q555 VanDerWaalsContact O-N 3.09Å; I552-E556 WeakPolarHBondContact O-CB 3.37Å; I552-E556 PolarHBondContact O-N 3.26Å
553	R	71.8	Confident	71.1	Confident	202 Å²	202	119.1 Å²	119.1	76%	0.762	53%	0.533	S	S	*	.	H	α-helix	trans	-61.2	-42.5	178.5	-147.8	-179.8	-110	171.3	-2.5	111.9	E549 E550 K551 Q555 E556 E557	E549-R553 WeakPolarHBondContact O-CB 3.5Å; E549-R553 PolarHBondContact O-N 3.21Å; E550-R553 PolarHBondContact O-N 3.03Å; K551-R553 VanDerWaalsContact C-N 3.32Å; R553-Q555 VanDerWaalsContact C-N 3.34Å; R553-Q555 PolarHBondContact O-N 3.49Å; R553-E556 WeakPolarHBondContact O-CB 3.39Å; R553-E556 PolarHBondContact O-N 3.29Å; R553-E557 PolarHBondContact O-N 3.44Å
554	E	74.6	Confident	70.9	Confident	101 Å²	101	118.8 Å²	118.8	47%	0.472	53%	0.532	S	S	.	.	H	α-helix	trans	-64	-34.8	172.7	-77.2	-169.3	171	0	0	113.4	E550 I552 K558	E550-E554 PolarHBondContact O-N 2.83Å; I552-E554 PolarHBondContact O-N 3.36Å; E554-K558 WeakPolarHBondContact O-CG 3.42Å; E554-K558 PolarHBondContact O-N 2.91Å; E554-K558 VanDerWaalsContact O-N 3.14Å
555	Q	71.1	Confident	70.6	Confident	146 Å²	146	118.6 Å²	118.6	68%	0.682	53%	0.531	S	S	*	.	H	α-helix	trans	-72.3	-39	175.1	-74.8	-153	14	0	0	112.2	K551 I552 R553 E557 K558 R559	K551-Q555 WeakPolarHBondContact O-CG 3.36Å; K551-Q555 PolarHBondContact O-N 2.98Å; I552-Q555 PolarHBondContact O-N 2.91Å; I552-Q555 VanDerWaalsContact O-N 3.09Å; R553-Q555 VanDerWaalsContact C-N 3.34Å; R553-Q555 PolarHBondContact O-N 3.49Å; Q555-E557 VanDerWaalsContact C-N 3.33Å; Q555-K558 PolarHBondContact O-N 3.44Å; Q555-R559 WeakPolarHBondContact O-CB 3.47Å; Q555-R559 PolarHBondContact O-N 2.84Å
556	E	61.6	Low	68.7	Low	76 Å²	76	120.6 Å²	120.6	36%	0.355	54%	0.537	S	S	.	.	H	α-helix	trans	-57.9	-47.2	173.9	-165.6	84	-168	0	0	110	I552 R553 K558 R559 Q560	I552-E556 WeakPolarHBondContact O-CB 3.37Å; I552-E556 PolarHBondContact O-N 3.26Å; R553-E556 WeakPolarHBondContact O-CB 3.39Å; R553-E556 PolarHBondContact O-N 3.29Å; E556-K558 PolarHBondContact O-N 2.8Å; E556-R559 VanDerWaalsContact CD-NH1 3.26Å; E556-R559 VanDerWaalsContact CD-NH2 3.28Å; E556-R559 WeakPolarHBondContact O-CB 3.37Å; E556-R559 PolarHBondContact O-N 3.43Å; E556-R559 IonicContact OE1-CZ 3.2Å; E556-R559 IonicContact OE1-NH1 2.93Å; E556-R559 PolarHBondContact OE1-NH1 2.83Å; E556-R559 IonicContact OE1-NH2 2.71Å; E556-R559 PolarHBondContact OE1-NH2 2.99Å; E556-R559 IonicContact OE2-CZ 3.72Å; E556-R559 IonicContact OE2-NH1 3.84Å; E556-R559 PolarHBondContact OE2-NH1 3.46Å; E556-R559 IonicContact OE2-NH2 3.98Å; E556-Q560 WeakPolarHBondContact O-CG 3.13Å; E556-Q560 PolarHBondContact O-N 3.36Å
557	E	67.1	Low	68	Low	134 Å²	134	120.6 Å²	120.6	63%	0.626	54%	0.537	S	S	*	.	H	α-helix	trans	-64.6	-40.4	178.9	-163.6	175.9	-165.9	0	0	112	R553 Q555 R559 Q560 E561	R553-E557 PolarHBondContact O-N 3.44Å; Q555-E557 VanDerWaalsContact C-N 3.33Å; E557-R559 PolarHBondContact O-N 3.32Å; E557-Q560 PolarHBondContact O-N 3.29Å; E557-E561 PolarHBondContact O-N 3.35Å
558	K	77.9	Confident	67.3	Low	130 Å²	130	119.3 Å²	119.3	57%	0.565	53%	0.534	S	S	*	.	H	α-helix	trans	-65.3	-36.2	173.3	-75.8	171.5	-174.4	160.1	0	112.9	E554 Q555 E556 Q562	E554-K558 WeakPolarHBondContact O-CG 3.42Å; E554-K558 PolarHBondContact O-N 2.91Å; E554-K558 VanDerWaalsContact O-N 3.14Å; Q555-K558 PolarHBondContact O-N 3.44Å; E556-K558 PolarHBondContact O-N 2.8Å; K558-Q562 PolarHBondContact O-N 2.94Å; K558-Q562 VanDerWaalsContact O-N 3.08Å
559	R	68.2	Low	66.7	Low	109 Å²	109	119.3 Å²	119.3	41%	0.411	53%	0.534	S	S	.	.	H	α-helix	trans	-66.5	-46	175.6	-167.5	-171.6	73.4	-126.3	-5.9	110.1	Q555 E556 E557 E561 Q562 E563	Q555-R559 WeakPolarHBondContact O-CB 3.47Å; Q555-R559 PolarHBondContact O-N 2.84Å; E556-R559 VanDerWaalsContact CD-NH1 3.26Å; E556-R559 VanDerWaalsContact CD-NH2 3.28Å; E556-R559 WeakPolarHBondContact O-CB 3.37Å; E556-R559 PolarHBondContact O-N 3.43Å; E556-R559 IonicContact OE1-CZ 3.2Å; E556-R559 IonicContact OE1-NH1 2.93Å; E556-R559 PolarHBondContact OE1-NH1 2.83Å; E556-R559 IonicContact OE1-NH2 2.71Å; E556-R559 PolarHBondContact OE1-NH2 2.99Å; E556-R559 IonicContact OE2-CZ 3.72Å; E556-R559 IonicContact OE2-NH1 3.84Å; E556-R559 PolarHBondContact OE2-NH1 3.46Å; E556-R559 IonicContact OE2-NH2 3.98Å; E557-R559 PolarHBondContact O-N 3.32Å; R559-E561 VanDerWaalsContact C-N 3.34Å; R559-E561 PolarHBondContact O-N 2.91Å; R559-Q562 PolarHBondContact O-N 3.34Å; R559-Q562 VanDerWaalsContact O-N 3.09Å; R559-E563 IonicContact NE-OE1 3.69Å; R559-E563 PolarHBondContact NE-OE1 2.94Å; R559-E563 WeakPolarHBondContact O-CG 3.42Å; R559-E563 PolarHBondContact O-N 3.01Å
560	Q	61.3	Low	66.6	Low	110 Å²	110	118.5 Å²	118.5	51%	0.514	53%	0.531	S	S	.	.	H	α-helix	trans	-60.2	-41.8	175.4	-72.1	-171.8	2	0	0	111.9	E556 E557 Q562 E563 E564	E556-Q560 WeakPolarHBondContact O-CG 3.13Å; E556-Q560 PolarHBondContact O-N 3.36Å; E557-Q560 PolarHBondContact O-N 3.29Å; Q560-Q562 VanDerWaalsContact C-N 3.32Å; Q560-Q562 PolarHBondContact O-N 2.86Å; Q560-E563 PolarHBondContact O-N 3.22Å; Q560-E564 WeakPolarHBondContact O-CB 3.38Å; Q560-E564 PolarHBondContact O-N 3.48Å
561	E	70.7	Confident	66.2	Low	106 Å²	106	118.6 Å²	118.6	50%	0.495	53%	0.531	S	S	.	.	H	α-helix	trans	-61.4	-37.6	173.3	-104.8	-157.3	-166.9	0	0	113.2	E557 R559 K565	E557-E561 PolarHBondContact O-N 3.35Å; R559-E561 VanDerWaalsContact C-N 3.34Å; R559-E561 PolarHBondContact O-N 2.91Å; E561-K565 VanDerWaalsContact O-CG 3.28Å; E561-K565 WeakPolarHBondContact O-CG 3.5Å; E561-K565 PolarHBondContact O-N 2.83Å; E561-K565 IonicContact OE2-NZ 3.46Å; E561-K565 PolarHBondContact OE2-NZ 2.91Å
562	Q	66	Low	65.9	Low	138 Å²	138	118.6 Å²	118.6	65%	0.645	53%	0.531	S	S	*	.	H	α-helix	trans	-70.7	-40.9	176.1	-79.1	-162.8	-2.9	0	0	112	K558 R559 Q560 E564 K565 M566	K558-Q562 PolarHBondContact O-N 2.94Å; K558-Q562 VanDerWaalsContact O-N 3.08Å; R559-Q562 PolarHBondContact O-N 3.34Å; R559-Q562 VanDerWaalsContact O-N 3.09Å; Q560-Q562 VanDerWaalsContact C-N 3.32Å; Q560-Q562 PolarHBondContact O-N 2.86Å; Q562-E564 VanDerWaalsContact C-N 3.31Å; Q562-E564 PolarHBondContact O-N 3.4Å; Q562-K565 PolarHBondContact O-N 2.97Å; Q562-M566 WeakPolarHBondContact O-CB 3.33Å; Q562-M566 WeakPolarHBondContact O-CG 3.33Å; Q562-M566 PolarHBondContact O-N 3.5Å
563	E	64.7	Low	65.3	Low	104 Å²	104	117.8 Å²	117.8	49%	0.486	53%	0.527	S	S	.	.	H	α-helix	trans	-60.1	-42.2	173.6	-74.4	170.5	-168.5	0	0	110.6	R559 Q560 K565 M566 W567	R559-E563 IonicContact NE-OE1 3.69Å; R559-E563 PolarHBondContact NE-OE1 2.94Å; R559-E563 WeakPolarHBondContact O-CG 3.42Å; R559-E563 PolarHBondContact O-N 3.01Å; Q560-E563 PolarHBondContact O-N 3.22Å; E563-K565 PolarHBondContact O-N 3.45Å; E563-M566 WeakPolarHBondContact O-CB 3.19Å; E563-M566 PolarHBondContact O-N 3.09Å; E563-W567 WeakPolarHBondContact O-CB 3.47Å; E563-W567 PolarHBondContact O-N 3.12Å
564	E	70.1	Confident	64.6	Low	98 Å²	98	116.2 Å²	116.2	46%	0.458	52%	0.521	S	S	.	.	H	α-helix	trans	-67.2	-35.9	176.3	-151.8	-162.4	153.7	0	0	112.2	Q560 Q562 W567 K568	Q560-E564 WeakPolarHBondContact O-CB 3.38Å; Q560-E564 PolarHBondContact O-N 3.48Å; Q562-E564 VanDerWaalsContact C-N 3.31Å; Q562-E564 PolarHBondContact O-N 3.4Å; E564-W567 PolarHBondContact O-N 3.04Å; E564-K568 WeakPolarHBondContact O-CG 3.45Å; E564-K568 PolarHBondContact O-N 3.35Å; E564-K568 WeakPolarHBondContact OE1-CE 3.48Å; E564-K568 IonicContact OE1-NZ 3.09Å; E564-K568 PolarHBondContact OE1-NZ 2.84Å
565	K	75.4	Confident	63.8	Low	120 Å²	120	116.1 Å²	116.1	52%	0.522	52%	0.52	S	S	.	.	H	α-helix	trans	-67.2	-42	173.4	-76.3	166.4	-171.2	150.7	0	112.1	E561 Q562 E563 K568 Q569	E561-K565 VanDerWaalsContact O-CG 3.28Å; E561-K565 WeakPolarHBondContact O-CG 3.5Å; E561-K565 PolarHBondContact O-N 2.83Å; E561-K565 IonicContact OE2-NZ 3.46Å; E561-K565 PolarHBondContact OE2-NZ 2.91Å; Q562-K565 PolarHBondContact O-N 2.97Å; E563-K565 PolarHBondContact O-N 3.45Å; K565-K568 PolarHBondContact O-N 3.02Å; K565-Q569 PolarHBondContact O-N 3.28Å
566	M	30	Very low	63	Low	115 Å²	115	115.2 Å²	115.2	57%	0.567	52%	0.516	S	S	*	.	H	α-helix	trans	-60.7	-47.1	173.3	-80.4	-107	-60.5	0	0	110.5	Q562 E563 K568 Q569 E570	Q562-M566 WeakPolarHBondContact O-CB 3.33Å; Q562-M566 WeakPolarHBondContact O-CG 3.33Å; Q562-M566 PolarHBondContact O-N 3.5Å; E563-M566 WeakPolarHBondContact O-CB 3.19Å; E563-M566 PolarHBondContact O-N 3.09Å; M566-K568 PolarHBondContact O-N 3.47Å; M566-Q569 CarbonylContact O-C 3.55Å; M566-Q569 WeakPolarHBondContact O-CA 3.36Å; M566-Q569 WeakPolarHBondContact O-CB 3.45Å; M566-Q569 PolarHBondContact O-N 2.9Å; M566-E570 PolarHBondContact O-N 3.45Å
567	W	62.1	Low	62.5	Low	145 Å²	145	115.9 Å²	115.9	55%	0.549	52%	0.519	S	S	.	.	H	α-helix	trans	-59.9	-44.7	178.9	-173.1	79.5	0	0	0	111.8	E563 E564 Q569 E570 E571	E563-W567 WeakPolarHBondContact O-CB 3.47Å; E563-W567 PolarHBondContact O-N 3.12Å; E564-W567 PolarHBondContact O-N 3.04Å; W567-Q569 VanDerWaalsContact C-N 3.28Å; W567-Q569 PolarHBondContact O-N 3.4Å; W567-E570 PolarHBondContact O-N 2.85Å; W567-E571 WeakPolarHBondContact O-CB 3.37Å; W567-E571 PolarHBondContact O-N 3.16Å
568	K	63.7	Low	61.6	Low	94 Å²	94	115.9 Å²	115.9	41%	0.409	52%	0.519	S	S	.	.	H	α-helix	trans	-65.2	-27.4	173.5	-73	173.9	-174.7	160.5	0	113.6	E564 K565 M566 K572	E564-K568 WeakPolarHBondContact O-CG 3.45Å; E564-K568 PolarHBondContact O-N 3.35Å; E564-K568 WeakPolarHBondContact OE1-CE 3.48Å; E564-K568 IonicContact OE1-NZ 3.09Å; E564-K568 PolarHBondContact OE1-NZ 2.84Å; K565-K568 PolarHBondContact O-N 3.02Å; M566-K568 PolarHBondContact O-N 3.47Å; K568-K572 WeakPolarHBondContact O-CG 3.42Å; K568-K572 PolarHBondContact O-N 3.5Å
569	Q	59.8	Low	60.2	Low	129 Å²	129	115.4 Å²	115.4	60%	0.603	52%	0.517	S	S	*	.	H	α-helix	trans	-76.1	-44.1	172.3	-87.6	-171.9	-14.7	0	0	111.7	K565 M566 W567 E571 K572 I573	K565-Q569 PolarHBondContact O-N 3.28Å; M566-Q569 CarbonylContact O-C 3.55Å; M566-Q569 WeakPolarHBondContact O-CA 3.36Å; M566-Q569 WeakPolarHBondContact O-CB 3.45Å; M566-Q569 PolarHBondContact O-N 2.9Å; W567-Q569 VanDerWaalsContact C-N 3.28Å; W567-Q569 PolarHBondContact O-N 3.4Å; Q569-E571 VanDerWaalsContact C-N 3.28Å; Q569-E571 PolarHBondContact O-N 3.19Å; Q569-K572 WeakPolarHBondContact O-CB 3.46Å; Q569-K572 PolarHBondContact O-N 3.27Å; Q569-I573 WeakPolarHBondContact O-CG1 3.45Å; Q569-I573 PolarHBondContact O-N 3.22Å
570	E	62.2	Low	59.5	Low	96 Å²	96	114.7 Å²	114.7	45%	0.449	52%	0.521	S	S	.	.	H	α-helix	trans	-60	-39.9	174.8	-81.8	-170.2	156.3	0	0	111.5	M566 W567 I573 R574	M566-E570 PolarHBondContact O-N 3.45Å; W567-E570 PolarHBondContact O-N 2.85Å; E570-I573 PolarHBondContact O-N 2.83Å; E570-R574 WeakPolarHBondContact O-CB 3.45Å; E570-R574 WeakPolarHBondContact O-CG 3.43Å; E570-R574 PolarHBondContact O-N 2.79Å
571	E	62.2	Low	58.7	Low	91 Å²	91	117.4 Å²	117.4	43%	0.425	53%	0.526	S	S	.	.	H	α-helix	trans	-60.5	-45.4	174.5	-168.4	-177	-160.6	0	0	111.2	W567 Q569 I573 R574 E575	W567-E571 WeakPolarHBondContact O-CB 3.37Å; W567-E571 PolarHBondContact O-N 3.16Å; Q569-E571 VanDerWaalsContact C-N 3.28Å; Q569-E571 PolarHBondContact O-N 3.19Å; E571-I573 PolarHBondContact O-N 2.92Å; E571-R574 PolarHBondContact O-N 3.07Å; E571-E575 PolarHBondContact O-N 2.87Å
572	K	68.3	Low	57.5	Low	138 Å²	138	120 Å²	120	60%	0.6	54%	0.538	S	S	*	.	H	α-helix	trans	-64.4	-37.7	174.9	-73.9	175.1	-177.7	177.6	0	113.2	K568 Q569 Q576	K568-K572 WeakPolarHBondContact O-CG 3.42Å; K568-K572 PolarHBondContact O-N 3.5Å; Q569-K572 WeakPolarHBondContact O-CB 3.46Å; Q569-K572 PolarHBondContact O-N 3.27Å; K572-Q576 WeakPolarHBondContact O-CB 3.47Å; K572-Q576 WeakPolarHBondContact O-CG 3.4Å; K572-Q576 PolarHBondContact O-N 3.44Å
573	I	62.6	Low	56.1	Low	91 Å²	91	120.2 Å²	120.2	47%	0.467	54%	0.539	S	S	.	.	H	α-helix	trans	-65.9	-45	175.3	-69	169.8	0	0	0	109.3	Q569 E570 E571 E575 Q576 E577	Q569-I573 WeakPolarHBondContact O-CG1 3.45Å; Q569-I573 PolarHBondContact O-N 3.22Å; E570-I573 PolarHBondContact O-N 2.83Å; E571-I573 PolarHBondContact O-N 2.92Å; I573-E575 VanDerWaalsContact C-N 3.34Å; I573-E575 PolarHBondContact O-N 3.02Å; I573-Q576 CarbonylContact O-C 3.6Å; I573-Q576 PolarHBondContact O-N 2.82Å; I573-Q576 VanDerWaalsContact O-N 3.14Å; I573-E577 HydrophobicContact CG2-CG 4.3Å; I573-E577 WeakPolarHBondContact O-CB 3.46Å; I573-E577 WeakPolarHBondContact O-CG 3.47Å; I573-E577 PolarHBondContact O-N 2.99Å
574	R	58.2	Low	54.9	Low	169 Å²	169	120.5 Å²	120.5	64%	0.638	54%	0.541	S	S	*	.	H	α-helix	trans	-58.5	-44.7	175.2	-79.9	-176.1	-165.6	161.7	9.1	111.8	E570 E571 Q576 E577 E578	E570-R574 WeakPolarHBondContact O-CB 3.45Å; E570-R574 WeakPolarHBondContact O-CG 3.43Å; E570-R574 PolarHBondContact O-N 2.79Å; E571-R574 PolarHBondContact O-N 3.07Å; R574-Q576 PolarHBondContact O-N 3.24Å; R574-E577 PolarHBondContact O-N 3.3Å; R574-E578 PolarHBondContact O-N 2.86Å
575	E	56.4	Low	53.7	Low	99 Å²	99	125.2 Å²	125.2	46%	0.463	56%	0.56	S	S	.	*	H	α-helix	trans	-63.4	-38.7	175	-76.3	-169.3	168.6	0	0	112.7	E571 I573 E578 K579	E571-E575 PolarHBondContact O-N 2.87Å; I573-E575 VanDerWaalsContact C-N 3.34Å; I573-E575 PolarHBondContact O-N 3.02Å; E575-E578 PolarHBondContact O-N 3.46Å; E575-K579 WeakPolarHBondContact O-CG 3.28Å; E575-K579 PolarHBondContact O-N 3.43Å
576	Q	54.2	Low	52.1	Low	128 Å²	128	124.7 Å²	124.7	60%	0.598	56%	0.562	S	S	*	*	H	α-helix	trans	-69.7	-39.8	175.7	-76.9	-167.8	-2.8	0	0	111.9	K572 I573 R574 E578 K579 I580	K572-Q576 WeakPolarHBondContact O-CB 3.47Å; K572-Q576 WeakPolarHBondContact O-CG 3.4Å; K572-Q576 PolarHBondContact O-N 3.44Å; I573-Q576 CarbonylContact O-C 3.6Å; I573-Q576 PolarHBondContact O-N 2.82Å; I573-Q576 VanDerWaalsContact O-N 3.14Å; R574-Q576 PolarHBondContact O-N 3.24Å; Q576-E578 VanDerWaalsContact C-N 3.32Å; Q576-K579 PolarHBondContact O-N 2.88Å; Q576-I580 WeakPolarHBondContact O-CB 3.46Å; Q576-I580 VanDerWaalsContact O-CG1 3.26Å; Q576-I580 WeakPolarHBondContact O-CG1 3.39Å; Q576-I580 PolarHBondContact O-N 3.4Å
577	E	51.8	Low	52.6	Low	90 Å²	90	125.4 Å²	125.4	42%	0.421	56%	0.558	S	S	.	*	H	α-helix	trans	-61.5	-41.4	172.9	-80.4	-168	-170.5	0	0	111.1	I573 R574 I580 R581	I573-E577 HydrophobicContact CG2-CG 4.3Å; I573-E577 WeakPolarHBondContact O-CB 3.46Å; I573-E577 WeakPolarHBondContact O-CG 3.47Å; I573-E577 PolarHBondContact O-N 2.99Å; R574-E577 PolarHBondContact O-N 3.3Å; E577-I580 PolarHBondContact O-N 2.99Å; E577-R581 WeakPolarHBondContact O-CB 3.22Å; E577-R581 VanDerWaalsContact O-CG 3.27Å; E577-R581 WeakPolarHBondContact O-CG 3.42Å; E577-R581 PolarHBondContact O-N 3.3Å; E577-R581 IonicContact OE2-CZ 3.55Å; E577-R581 IonicContact OE2-NH2 2.67Å; E577-R581 PolarHBondContact OE2-NH2 2.85Å
578	E	47.1	Very low	51.5	Low	133 Å²	133	125.9 Å²	125.9	62%	0.621	57%	0.566	S	S	*	*	H	α-helix	trans	-60.5	-45.8	173	-112	-170.2	164.3	0	0	111.2	R574 E575 Q576 I580 R581 E582	R574-E578 PolarHBondContact O-N 2.86Å; E575-E578 PolarHBondContact O-N 3.46Å; Q576-E578 VanDerWaalsContact C-N 3.32Å; E578-I580 VanDerWaalsContact C-N 3.34Å; E578-I580 PolarHBondContact O-N 2.95Å; E578-R581 PolarHBondContact O-N 2.81Å; E578-E582 WeakPolarHBondContact O-CG 3.39Å; E578-E582 PolarHBondContact O-N 3.42Å
579	K	49.7	Very low	50.2	Low	121 Å²	121	128.8 Å²	128.8	53%	0.526	58%	0.581	S	S	.	*	H	α-helix	trans	-64.4	-34.6	176.4	-73.2	169.2	-175.4	160.5	0	113.1	E575 Q576 E582 Q583	E575-K579 WeakPolarHBondContact O-CG 3.28Å; E575-K579 PolarHBondContact O-N 3.43Å; Q576-K579 PolarHBondContact O-N 2.88Å; K579-E582 PolarHBondContact O-N 3.41Å; K579-Q583 WeakPolarHBondContact O-CG 3.3Å; K579-Q583 PolarHBondContact O-N 3.49Å
580	I	52.8	Low	49.2	Very low	94 Å²	94	127.2 Å²	127.2	48%	0.482	57%	0.574	S	S	.	*	H	α-helix	trans	-71.8	-39.9	175.1	-70.1	166.5	0	0	0	110.5	Q576 E577 E578 E582 Q583	Q576-I580 WeakPolarHBondContact O-CB 3.46Å; Q576-I580 VanDerWaalsContact O-CG1 3.26Å; Q576-I580 WeakPolarHBondContact O-CG1 3.39Å; Q576-I580 PolarHBondContact O-N 3.4Å; E577-I580 PolarHBondContact O-N 2.99Å; E578-I580 VanDerWaalsContact C-N 3.34Å; E578-I580 PolarHBondContact O-N 2.95Å; I580-E582 VanDerWaalsContact C-N 3.26Å; I580-E582 PolarHBondContact O-N 2.82Å; I580-Q583 PolarHBondContact O-N 2.99Å; I580-Q583 VanDerWaalsContact O-N 3.12Å
581	R	45.1	Very low	48.1	Very low	166 Å²	166	128.4 Å²	128.4	63%	0.626	58%	0.579	S	S	*	*	H	α-helix	trans	-63.7	-33.6	172.7	-72.3	178	-155.2	-175.3	9.4	111.1	E577 E578	E577-R581 WeakPolarHBondContact O-CB 3.22Å; E577-R581 VanDerWaalsContact O-CG 3.27Å; E577-R581 WeakPolarHBondContact O-CG 3.42Å; E577-R581 PolarHBondContact O-N 3.3Å; E577-R581 IonicContact OE2-CZ 3.55Å; E577-R581 IonicContact OE2-NH2 2.67Å; E577-R581 PolarHBondContact OE2-NH2 2.85Å; E578-R581 PolarHBondContact O-N 2.81Å
582	E	46.3	Very low	47	Very low	160 Å²	160	131.4 Å²	131.4	75%	0.748	59%	0.591	S	S	*	*	H	α-helix	trans	-75.8	-20.5	172.9	-73.5	-170.1	156.5	0	0	114	E578 K579 I580 E584	E578-E582 WeakPolarHBondContact O-CG 3.39Å; E578-E582 PolarHBondContact O-N 3.42Å; K579-E582 PolarHBondContact O-N 3.41Å; I580-E582 VanDerWaalsContact C-N 3.26Å; I580-E582 PolarHBondContact O-N 2.82Å; E582-E584 PolarHBondContact O-N 3.06Å
583	Q	35.7	Very low	45.9	Very low	144 Å²	144	130 Å²	130	67%	0.673	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.1	19.4	175.1	-79.4	-169.5	4.8	0	0	114.3	K579 I580 K585	K579-Q583 WeakPolarHBondContact O-CG 3.3Å; K579-Q583 PolarHBondContact O-N 3.49Å; I580-Q583 PolarHBondContact O-N 2.99Å; I580-Q583 VanDerWaalsContact O-N 3.12Å; Q583-K585 PolarHBondContact O-N 3.21Å
584	E	40.4	Very low	45.1	Very low	109 Å²	109	131.5 Å²	131.5	51%	0.509	59%	0.589	S	S	.	*	T	Hydrogen-bonded Turn	trans	-77.7	34.9	175.7	-145.3	171.6	-143.9	0	0	113.8	E582 R587	E582-E584 PolarHBondContact O-N 3.06Å; E584-R587 HydrophobicContact CG-CB 4.12Å; E584-R587 HydrophobicContact CG-CG 4.05Å; E584-R587 IonicContact OE1-CZ 3.79Å; E584-R587 IonicContact OE1-NH1 3.12Å; E584-R587 PolarHBondContact OE1-NH1 3.1Å
585	K	43.1	Very low	44.3	Very low	198 Å²	198	129.4 Å²	129.4	86%	0.861	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.4	4.1	165.6	-73.3	-173.5	-179.6	174.4	0	114	Q583	Q583-K585 PolarHBondContact O-N 3.21Å
586	I	42.6	Very low	43.6	Very low	109 Å²	109	132 Å²	132	56%	0.559	60%	0.599	S	S	*	*	S	Bend	trans	-107.3	-18.1	171.4	-61.7	178.4	0	0	0	112.3	E588 Q589 E590	I586-E588 PolarHBondContact O-N 3.09Å; I586-Q589 PolarHBondContact O-N 2.83Å; I586-E590 PolarHBondContact O-N 2.94Å
587	R	40.5	Very low	42.9	Very low	130 Å²	130	130.9 Å²	130.9	49%	0.491	59%	0.593	S	S	.	*	H	α-helix	trans	-64.1	-34	-179.6	-71.4	-163.9	-177.7	148.5	-5.3	114.4	E584 Q589 E590 E591	E584-R587 HydrophobicContact CG-CB 4.12Å; E584-R587 HydrophobicContact CG-CG 4.05Å; E584-R587 IonicContact OE1-CZ 3.79Å; E584-R587 IonicContact OE1-NH1 3.12Å; E584-R587 PolarHBondContact OE1-NH1 3.1Å; R587-Q589 VanDerWaalsContact C-N 3.29Å; R587-Q589 PolarHBondContact O-N 3.46Å; R587-E590 PolarHBondContact O-N 3.45Å; R587-E591 PolarHBondContact O-N 3.21Å; R587-E591 VanDerWaalsContact O-N 3.1Å
588	E	39.5	Very low	42.4	Very low	155 Å²	155	131.8 Å²	131.8	72%	0.724	60%	0.597	S	S	*	*	H	α-helix	trans	-72.4	-16.3	-180	-76	-171.7	161.2	0	0	114.5	I586	I586-E588 PolarHBondContact O-N 3.09Å
589	Q	36.7	Very low	42.2	Very low	155 Å²	155	132.1 Å²	132.1	72%	0.724	60%	0.601	S	S	*	*	H	α-helix	trans	-94	-31.3	174.9	-71.7	-162.1	-11	0	0	112.6	I586 R587 K592	I586-Q589 PolarHBondContact O-N 2.83Å; R587-Q589 VanDerWaalsContact C-N 3.29Å; R587-Q589 PolarHBondContact O-N 3.46Å; Q589-K592 PolarHBondContact O-N 3.15Å
590	E	38.3	Very low	41.6	Very low	95 Å²	95	133.1 Å²	133.1	44%	0.444	61%	0.609	S	S	.	*	H	α-helix	trans	-71.5	-31.1	172.3	-74.3	-174.3	177.2	0	0	112.6	I586 R587 K592 I593 R594	I586-E590 PolarHBondContact O-N 2.94Å; R587-E590 PolarHBondContact O-N 3.45Å; E590-K592 PolarHBondContact O-N 3.43Å; E590-I593 PolarHBondContact O-N 3.08Å; E590-R594 WeakPolarHBondContact O-CB 3.35Å; E590-R594 PolarHBondContact O-N 3.14Å; E590-R594 IonicContact OE2-NH2 3.55Å; E590-R594 PolarHBondContact OE2-NH2 2.95Å
591	E	39.4	Very low	41.3	Very low	121 Å²	121	133.2 Å²	133.2	57%	0.565	61%	0.607	S	S	*	*	H	α-helix	trans	-59	-34.6	174.8	-114.5	-177.5	171.3	0	0	112.4	R587 R594 E595	R587-E591 PolarHBondContact O-N 3.21Å; R587-E591 VanDerWaalsContact O-N 3.1Å; E591-R594 PolarHBondContact O-N 3.24Å; E591-E595 WeakPolarHBondContact O-CG 3.44Å; E591-E595 PolarHBondContact O-N 3.29Å
592	K	39.5	Very low	41.2	Very low	154 Å²	154	130 Å²	130	67%	0.67	60%	0.6	S	S	*	*	H	α-helix	trans	-78.2	-26	-179.2	-70	-179.1	-178.4	172.1	0	114.3	Q589 E590	Q589-K592 PolarHBondContact O-N 3.15Å; E590-K592 PolarHBondContact O-N 3.43Å
593	I	44.2	Very low	41	Very low	109 Å²	109	129.4 Å²	129.4	56%	0.559	60%	0.597	S	S	*	*	H	α-helix	trans	-80.5	-37.1	171.4	-66.1	170.8	0	0	0	109	E590 Q596 E597	E590-I593 PolarHBondContact O-N 3.08Å; I593-Q596 PolarHBondContact O-N 2.66Å; I593-E597 PolarHBondContact O-N 2.97Å
594	R	45.9	Very low	41.3	Very low	122 Å²	122	129.7 Å²	129.7	46%	0.46	60%	0.598	S	S	.	*	H	α-helix	trans	-58.9	-45	173.2	-100.5	179.9	-103	-165.8	-7.6	113	E590 E591 Q596 E597 E598	E590-R594 WeakPolarHBondContact O-CB 3.35Å; E590-R594 PolarHBondContact O-N 3.14Å; E590-R594 IonicContact OE2-NH2 3.55Å; E590-R594 PolarHBondContact OE2-NH2 2.95Å; E591-R594 PolarHBondContact O-N 3.24Å; R594-Q596 PolarHBondContact O-N 3.22Å; R594-Q596 VanDerWaalsContact O-N 3.17Å; R594-E597 CarbonylContact O-C 3.53Å; R594-E597 PolarHBondContact O-N 2.93Å; R594-E598 VanDerWaalsContact O-CB 3.24Å; R594-E598 WeakPolarHBondContact O-CB 3.23Å; R594-E598 VanDerWaalsContact O-CG 3.29Å; R594-E598 WeakPolarHBondContact O-CG 3.49Å; R594-E598 PolarHBondContact O-N 3.3Å
595	E	42.1	Very low	41.7	Very low	126 Å²	126	129.5 Å²	129.5	59%	0.589	60%	0.597	S	S	*	*	H	α-helix	trans	-61.3	-28.3	178.9	-76.4	178.6	174	0	0	113.3	E591 M599	E591-E595 WeakPolarHBondContact O-CG 3.44Å; E591-E595 PolarHBondContact O-N 3.29Å; E595-M599 PolarHBondContact O-N 2.88Å
596	Q	41	Very low	41.8	Very low	154 Å²	154	125.5 Å²	125.5	72%	0.72	58%	0.58	S	S	*	*	H	α-helix	trans	-83	-36.9	175.2	-85.4	-169.1	-16	0	0	113.1	I593 R594 E598	I593-Q596 PolarHBondContact O-N 2.66Å; R594-Q596 PolarHBondContact O-N 3.22Å; R594-Q596 VanDerWaalsContact O-N 3.17Å; Q596-E598 VanDerWaalsContact C-N 3.34Å
597	E	39.4	Very low	41.3	Very low	103 Å²	103	127.1 Å²	127.1	48%	0.481	59%	0.586	S	S	.	*	H	α-helix	trans	-67.1	-37.4	171.1	-77.9	-177.6	156.7	0	0	111	I593 R594 M599 M600 Q601	I593-E597 PolarHBondContact O-N 2.97Å; R594-E597 CarbonylContact O-C 3.53Å; R594-E597 PolarHBondContact O-N 2.93Å; E597-M599 VanDerWaalsContact C-N 3.32Å; E597-M599 PolarHBondContact O-N 3.48Å; E597-M600 PolarHBondContact O-N 2.95Å; E597-Q601 VanDerWaalsContact O-CB 3.22Å; E597-Q601 WeakPolarHBondContact O-CB 3.48Å; E597-Q601 WeakPolarHBondContact O-CG 3.42Å; E597-Q601 PolarHBondContact O-N 3.27Å
598	E	41.9	Very low	41.7	Very low	110 Å²	110	122.3 Å²	122.3	51%	0.514	58%	0.578	S	S	.	*	H	α-helix	trans	-59.8	-38.6	175.5	-83.8	178.3	175.2	0	0	111.5	R594 Q596 Q601 E602	R594-E598 VanDerWaalsContact O-CB 3.24Å; R594-E598 WeakPolarHBondContact O-CB 3.23Å; R594-E598 VanDerWaalsContact O-CG 3.29Å; R594-E598 WeakPolarHBondContact O-CG 3.49Å; R594-E598 PolarHBondContact O-N 3.3Å; Q596-E598 VanDerWaalsContact C-N 3.34Å; E598-Q601 PolarHBondContact O-N 3.35Å; E598-E602 VanDerWaalsContact O-CB 3.32Å; E598-E602 WeakPolarHBondContact O-CB 3.47Å; E598-E602 PolarHBondContact O-N 2.88Å
599	M	41.7	Very low	41.9	Very low	140 Å²	140	118.6 Å²	118.6	69%	0.69	56%	0.56	S	S	*	*	H	α-helix	trans	-69.5	-34.3	177.4	-89.8	-98.6	-60.6	0	0	114	E595 E597	E595-M599 PolarHBondContact O-N 2.88Å; E597-M599 VanDerWaalsContact C-N 3.32Å; E597-M599 PolarHBondContact O-N 3.48Å
600	M	36.9	Very low	42.2	Very low	141 Å²	141	118.2 Å²	118.2	70%	0.695	56%	0.558	S	S	*	*	H	α-helix	trans	-78.8	-38.3	173.3	-84.8	-166.6	-54	0	0	111.4	E597 E602 Q603 E604	E597-M600 PolarHBondContact O-N 2.95Å; M600-E602 VanDerWaalsContact C-N 3.34Å; M600-Q603 PolarHBondContact O-N 3.44Å; M600-E604 PolarHBondContact O-N 2.86Å
601	Q	46.3	Very low	42.5	Very low	97 Å²	97	120.1 Å²	120.1	45%	0.453	57%	0.567	S	S	.	*	H	α-helix	trans	-64.5	-36.8	174.7	-79.9	179.2	-20.1	0	0	110.9	E597 E598 Q603 E604 E605	E597-Q601 VanDerWaalsContact O-CB 3.22Å; E597-Q601 WeakPolarHBondContact O-CB 3.48Å; E597-Q601 WeakPolarHBondContact O-CG 3.42Å; E597-Q601 PolarHBondContact O-N 3.27Å; E598-Q601 PolarHBondContact O-N 3.35Å; Q601-Q603 PolarHBondContact O-N 3.44Å; Q601-Q603 VanDerWaalsContact O-N 3.09Å; Q601-E604 CarbonylContact O-C 3.57Å; Q601-E604 PolarHBondContact O-N 2.92Å; Q601-E604 VanDerWaalsContact O-N 3.1Å; Q601-E605 WeakPolarHBondContact O-CA 3.41Å; Q601-E605 WeakPolarHBondContact O-CB 3.24Å; Q601-E605 WeakPolarHBondContact O-CG 3.43Å; Q601-E605 PolarHBondContact O-N 3.08Å
602	E	44	Very low	42.9	Very low	99 Å²	99	119.1 Å²	119.1	46%	0.463	56%	0.563	S	S	.	*	H	α-helix	trans	-61.5	-26.2	178	-129.9	-167.5	169.4	0	0	112.9	E598 M600 K606	E598-E602 VanDerWaalsContact O-CB 3.32Å; E598-E602 WeakPolarHBondContact O-CB 3.47Å; E598-E602 PolarHBondContact O-N 2.88Å; M600-E602 VanDerWaalsContact C-N 3.34Å; E602-K606 WeakPolarHBondContact O-CD 3.49Å; E602-K606 VanDerWaalsContact O-CG 3.28Å; E602-K606 WeakPolarHBondContact O-CG 3.32Å; E602-K606 PolarHBondContact O-N 2.88Å
603	Q	42.1	Very low	43.2	Very low	147 Å²	147	117.3 Å²	117.3	69%	0.687	56%	0.555	S	S	*	*	H	α-helix	trans	-82.2	-41.2	175	-82	-96.9	-16.2	0	0	112	M600 Q601 K606	M600-Q603 PolarHBondContact O-N 3.44Å; Q601-Q603 PolarHBondContact O-N 3.44Å; Q601-Q603 VanDerWaalsContact O-N 3.09Å; Q603-K606 PolarHBondContact O-N 3.38Å
604	E	42.8	Very low	43.1	Very low	150 Å²	150	118.5 Å²	118.5	70%	0.701	56%	0.56	S	S	*	*	H	α-helix	trans	-70.2	-37.3	173.3	-79	-170.8	157.1	0	0	112	M600 Q601 K606 M607 G608	M600-E604 PolarHBondContact O-N 2.86Å; Q601-E604 CarbonylContact O-C 3.57Å; Q601-E604 PolarHBondContact O-N 2.92Å; Q601-E604 VanDerWaalsContact O-N 3.1Å; E604-K606 PolarHBondContact O-N 3.37Å; E604-M607 PolarHBondContact O-N 3.32Å; E604-G608 PolarHBondContact O-N 2.92Å
605	E	47.1	Very low	43.2	Very low	104 Å²	104	118 Å²	118	49%	0.486	56%	0.563	S	S	.	*	H	α-helix	trans	-63.4	-35.9	172.1	-81.9	-174.6	151	0	0	110.7	Q601 M607 G608 E609	Q601-E605 WeakPolarHBondContact O-CA 3.41Å; Q601-E605 WeakPolarHBondContact O-CB 3.24Å; Q601-E605 WeakPolarHBondContact O-CG 3.43Å; Q601-E605 PolarHBondContact O-N 3.08Å; E605-M607 PolarHBondContact O-N 3.41Å; E605-G608 CarbonylContact O-C 3.59Å; E605-G608 PolarHBondContact O-N 3.01Å; E605-E609 HydrophobicContact CB-CG 4.49Å; E605-E609 WeakPolarHBondContact O-CA 3.42Å; E605-E609 WeakPolarHBondContact O-CB 3.37Å; E605-E609 WeakPolarHBondContact O-CG 3.47Å; E605-E609 PolarHBondContact O-N 2.69Å
606	K	46.7	Very low	43.6	Very low	115 Å²	115	116.8 Å²	116.8	50%	0.5	56%	0.557	S	S	.	*	H	α-helix	trans	-63.5	-31.1	175.8	-81.9	168.1	-170.8	159.1	0	113.6	E602 Q603 E604	E602-K606 WeakPolarHBondContact O-CD 3.49Å; E602-K606 VanDerWaalsContact O-CG 3.28Å; E602-K606 WeakPolarHBondContact O-CG 3.32Å; E602-K606 PolarHBondContact O-N 2.88Å; Q603-K606 PolarHBondContact O-N 3.38Å; E604-K606 PolarHBondContact O-N 3.37Å
607	M	31.2	Very low	44	Very low	142 Å²	142	116.2 Å²	116.2	70%	0.7	55%	0.554	S	S	*	*	H	α-helix	trans	-79.5	-43.6	171.9	-78	-82.4	-64.5	0	0	111.2	E604 E605 Q610 E611	E604-M607 PolarHBondContact O-N 3.32Å; E605-M607 PolarHBondContact O-N 3.41Å; M607-Q610 PolarHBondContact O-N 3.1Å; M607-E611 PolarHBondContact O-N 2.92Å
608	G	48.6	Very low	44.7	Very low	30 Å²	30	115.5 Å²	115.5	31%	0.309	55%	0.551	S	S	.	*	H	α-helix	trans	-58.3	-55.3	175.7	0	0	0	0	0	111.6	E604 E605 Q610 E611 E612	E604-G608 PolarHBondContact O-N 2.92Å; E605-G608 CarbonylContact O-C 3.59Å; E605-G608 PolarHBondContact O-N 3.01Å; G608-Q610 PolarHBondContact O-N 3.1Å; G608-Q610 VanDerWaalsContact O-N 3.08Å; G608-E611 CarbonylContact O-C 3.58Å; G608-E611 WeakPolarHBondContact O-CA 3.41Å; G608-E611 PolarHBondContact O-N 2.94Å; G608-E612 WeakPolarHBondContact O-CA 3.32Å; G608-E612 VanDerWaalsContact O-CB 3.23Å; G608-E612 WeakPolarHBondContact O-CB 3.46Å; G608-E612 PolarHBondContact O-N 2.85Å
609	E	44.9	Very low	45.4	Very low	76 Å²	76	116.4 Å²	116.4	36%	0.355	55%	0.553	S	S	.	*	H	α-helix	trans	-50.1	-32.2	173.8	-79.8	-176.3	-153.4	0	0	113.3	E605 K613	E605-E609 HydrophobicContact CB-CG 4.49Å; E605-E609 WeakPolarHBondContact O-CA 3.42Å; E605-E609 WeakPolarHBondContact O-CB 3.37Å; E605-E609 WeakPolarHBondContact O-CG 3.47Å; E605-E609 PolarHBondContact O-N 2.69Å; E609-K613 WeakPolarHBondContact O-CA 3.43Å; E609-K613 WeakPolarHBondContact O-CB 3.44Å; E609-K613 VanDerWaalsContact O-CD 3.24Å; E609-K613 WeakPolarHBondContact O-CD 3.3Å; E609-K613 WeakPolarHBondContact O-CG 3.28Å; E609-K613 PolarHBondContact O-N 3.38Å; E609-K613 IonicContact OE2-NZ 2.84Å; E609-K613 PolarHBondContact OE2-NZ 3.43Å
610	Q	42.6	Very low	45.5	Very low	147 Å²	147	114.3 Å²	114.3	69%	0.687	54%	0.543	S	S	*	.	H	α-helix	trans	-77.2	-35.8	178.7	-144.2	176.8	12.9	0	0	111.5	M607 G608	M607-Q610 PolarHBondContact O-N 3.1Å; G608-Q610 PolarHBondContact O-N 3.1Å; G608-Q610 VanDerWaalsContact O-N 3.08Å
611	E	44.1	Very low	46.6	Very low	135 Å²	135	114.6 Å²	114.6	63%	0.631	54%	0.536	S	S	*	.	H	α-helix	trans	-77.2	-37	174.4	-137.6	168.7	-162.7	0	0	111.5	M607 G608 M614 Q615	M607-E611 PolarHBondContact O-N 2.92Å; G608-E611 CarbonylContact O-C 3.58Å; G608-E611 WeakPolarHBondContact O-CA 3.41Å; G608-E611 PolarHBondContact O-N 2.94Å; E611-M614 PolarHBondContact O-N 3.18Å; E611-Q615 PolarHBondContact O-N 2.88Å; E611-Q615 VanDerWaalsContact O-N 3.11Å
612	E	47.2	Very low	47.1	Very low	100 Å²	100	117 Å²	117	47%	0.467	54%	0.541	S	S	.	.	H	α-helix	trans	-71.6	-36.5	175	-143.3	178.1	-166.4	0	0	110.3	G608 M614 Q615 E616	G608-E612 WeakPolarHBondContact O-CA 3.32Å; G608-E612 VanDerWaalsContact O-CB 3.23Å; G608-E612 WeakPolarHBondContact O-CB 3.46Å; G608-E612 PolarHBondContact O-N 2.85Å; E612-M614 VanDerWaalsContact C-N 3.25Å; E612-M614 PolarHBondContact O-N 3.37Å; E612-Q615 CarbonylContact O-C 3.58Å; E612-Q615 PolarHBondContact O-N 3.25Å; E612-Q615 VanDerWaalsContact O-N 3.09Å; E612-E616 HydrophobicContact CG-CG 4.24Å; E612-E616 WeakPolarHBondContact O-CA 3.17Å; E612-E616 WeakPolarHBondContact O-CB 3.5Å; E612-E616 VanDerWaalsContact O-CG 3.31Å; E612-E616 WeakPolarHBondContact O-CG 3.33Å; E612-E616 PolarHBondContact O-N 3.34Å
613	K	46.6	Very low	47.9	Very low	117 Å²	117	117.9 Å²	117.9	51%	0.509	55%	0.545	S	S	.	.	H	α-helix	trans	-59.2	-35.9	170.4	-84.4	162.7	-172.1	143.4	0	112.2	E609 Q617	E609-K613 WeakPolarHBondContact O-CA 3.43Å; E609-K613 WeakPolarHBondContact O-CB 3.44Å; E609-K613 VanDerWaalsContact O-CD 3.24Å; E609-K613 WeakPolarHBondContact O-CD 3.3Å; E609-K613 WeakPolarHBondContact O-CG 3.28Å; E609-K613 PolarHBondContact O-N 3.38Å; E609-K613 IonicContact OE2-NZ 2.84Å; E609-K613 PolarHBondContact OE2-NZ 3.43Å; K613-Q617 WeakPolarHBondContact O-CB 3.4Å; K613-Q617 PolarHBondContact O-N 3.25Å
614	M	41.7	Very low	48.7	Very low	134 Å²	134	114.9 Å²	114.9	66%	0.66	53%	0.531	S	S	*	.	H	α-helix	trans	-69.7	-42.5	173.8	-107.6	-163.4	-58.8	0	0	111.9	E611 E612 E618	E611-M614 PolarHBondContact O-N 3.18Å; E612-M614 VanDerWaalsContact C-N 3.25Å; E612-M614 PolarHBondContact O-N 3.37Å; M614-E618 PolarHBondContact O-N 2.84Å
615	Q	49.4	Very low	49.7	Very low	112 Å²	112	113 Å²	113	52%	0.523	52%	0.522	S	S	.	.	H	α-helix	trans	-74.3	-34.2	179	-67.8	-173.5	13.7	0	0	113.3	E611 E612 E618 K619	E611-Q615 PolarHBondContact O-N 2.88Å; E611-Q615 VanDerWaalsContact O-N 3.11Å; E612-Q615 CarbonylContact O-C 3.58Å; E612-Q615 PolarHBondContact O-N 3.25Å; E612-Q615 VanDerWaalsContact O-N 3.09Å; Q615-E618 PolarHBondContact O-N 2.84Å; Q615-K619 WeakPolarHBondContact O-CB 3.42Å; Q615-K619 WeakPolarHBondContact O-CG 3.48Å; Q615-K619 PolarHBondContact O-N 3.03Å
616	E	49.2	Very low	50.7	Low	99 Å²	99	114.9 Å²	114.9	46%	0.463	53%	0.529	S	S	.	.	H	α-helix	trans	-69.1	-39	172.5	-79.6	-172.1	146.9	0	0	110.3	E612 E618 K619 M620	E612-E616 HydrophobicContact CG-CG 4.24Å; E612-E616 WeakPolarHBondContact O-CA 3.17Å; E612-E616 WeakPolarHBondContact O-CB 3.5Å; E612-E616 VanDerWaalsContact O-CG 3.31Å; E612-E616 WeakPolarHBondContact O-CG 3.33Å; E612-E616 PolarHBondContact O-N 3.34Å; E616-E618 PolarHBondContact O-N 3.09Å; E616-K619 PolarHBondContact O-N 3.17Å; E616-M620 WeakPolarHBondContact O-CA 3.43Å; E616-M620 WeakPolarHBondContact O-CB 3.41Å; E616-M620 WeakPolarHBondContact O-CG 3.47Å; E616-M620 PolarHBondContact O-N 2.97Å
617	Q	49.3	Very low	51.6	Low	143 Å²	143	113.6 Å²	113.6	67%	0.668	53%	0.527	S	S	*	.	H	α-helix	trans	-64.7	-33	173.1	-162.3	174.3	39.1	0	0	111.1	K613 R621	K613-Q617 WeakPolarHBondContact O-CB 3.4Å; K613-Q617 PolarHBondContact O-N 3.25Å; Q617-R621 WeakPolarHBondContact O-CB 3.43Å; Q617-R621 PolarHBondContact O-N 3.43Å
618	E	54	Low	53.5	Low	88 Å²	88	114.6 Å²	114.6	41%	0.411	52%	0.523	S	S	.	.	H	α-helix	trans	-73.9	-40.5	171.9	-158.4	-174.5	163.4	0	0	112.8	M614 Q615 E616 R621 R622	M614-E618 PolarHBondContact O-N 2.84Å; Q615-E618 PolarHBondContact O-N 2.84Å; E616-E618 PolarHBondContact O-N 3.09Å; E618-R621 PolarHBondContact O-N 2.88Å; E618-R622 WeakPolarHBondContact O-CG 3.46Å; E618-R622 PolarHBondContact O-N 3.27Å; E618-R622 IonicContact OE1-CZ 3.8Å; E618-R622 IonicContact OE1-NE 2.99Å; E618-R622 IonicContact OE1-NH2 3.8Å; E618-R622 PolarHBondContact OE1-NH2 3.47Å
619	K	57.1	Low	54.4	Low	128 Å²	128	118.5 Å²	118.5	56%	0.557	53%	0.533	S	S	*	.	H	α-helix	trans	-65.4	-41.7	174.2	-78.6	177.1	-178.9	170.5	0	111.8	Q615 E616 R622 Q623	Q615-K619 WeakPolarHBondContact O-CB 3.42Å; Q615-K619 WeakPolarHBondContact O-CG 3.48Å; Q615-K619 PolarHBondContact O-N 3.03Å; E616-K619 PolarHBondContact O-N 3.17Å; K619-R622 CarbonylContact O-C 3.52Å; K619-R622 PolarHBondContact O-N 3.34Å; K619-Q623 WeakPolarHBondContact O-CB 3.47Å; K619-Q623 PolarHBondContact O-N 2.99Å
620	M	43.8	Very low	55.5	Low	96 Å²	96	121.1 Å²	121.1	47%	0.473	55%	0.545	S	S	.	.	H	α-helix	trans	-59	-47.7	171.8	-87.5	-75.1	-66.9	0	0	109.8	E616 R622 Q623 E624	E616-M620 WeakPolarHBondContact O-CA 3.43Å; E616-M620 WeakPolarHBondContact O-CB 3.41Å; E616-M620 WeakPolarHBondContact O-CG 3.47Å; E616-M620 PolarHBondContact O-N 2.97Å; M620-R622 VanDerWaalsContact C-N 3.31Å; M620-R622 PolarHBondContact O-N 3.47Å; M620-Q623 CarbonylContact O-C 3.6Å; M620-Q623 PolarHBondContact O-N 3.47Å; M620-Q623 VanDerWaalsContact O-N 3.16Å; M620-E624 WeakPolarHBondContact O-CB 3.39Å; M620-E624 WeakPolarHBondContact O-CG 3.41Å; M620-E624 PolarHBondContact O-N 3.46Å
621	R	60	Low	56.8	Low	147 Å²	147	119.9 Å²	119.9	56%	0.555	54%	0.539	S	S	*	.	H	α-helix	trans	-57.9	-42.5	174.9	-107.5	-174.7	64.6	-127.1	-3.9	112.8	Q617 E618 E625	Q617-R621 WeakPolarHBondContact O-CB 3.43Å; Q617-R621 PolarHBondContact O-N 3.43Å; E618-R621 PolarHBondContact O-N 2.88Å; R621-E625 WeakPolarHBondContact O-CB 3.27Å; R621-E625 PolarHBondContact O-N 3.34Å
622	R	56.9	Low	58.1	Low	148 Å²	148	119.4 Å²	119.4	56%	0.558	54%	0.537	S	S	*	.	H	α-helix	trans	-71.3	-33.5	177.3	-69.3	-175.9	-166.6	178.2	6.4	112.5	E618 K619 M620 K626	E618-R622 WeakPolarHBondContact O-CG 3.46Å; E618-R622 PolarHBondContact O-N 3.27Å; E618-R622 IonicContact OE1-CZ 3.8Å; E618-R622 IonicContact OE1-NE 2.99Å; E618-R622 IonicContact OE1-NH2 3.8Å; E618-R622 PolarHBondContact OE1-NH2 3.47Å; K619-R622 CarbonylContact O-C 3.52Å; K619-R622 PolarHBondContact O-N 3.34Å; M620-R622 VanDerWaalsContact C-N 3.31Å; M620-R622 PolarHBondContact O-N 3.47Å; R622-K626 WeakPolarHBondContact O-CG 3.44Å; R622-K626 PolarHBondContact O-N 2.78Å
623	Q	61	Low	59.5	Low	117 Å²	117	120.7 Å²	120.7	55%	0.547	54%	0.541	S	S	.	.	H	α-helix	trans	-69.5	-42.5	172.3	-100.6	-177.4	-21.6	0	0	111.2	K619 M620 E625 K626 I627	K619-Q623 WeakPolarHBondContact O-CB 3.47Å; K619-Q623 PolarHBondContact O-N 2.99Å; M620-Q623 CarbonylContact O-C 3.6Å; M620-Q623 PolarHBondContact O-N 3.47Å; M620-Q623 VanDerWaalsContact O-N 3.16Å; Q623-E625 VanDerWaalsContact C-N 3.31Å; Q623-E625 PolarHBondContact O-N 3.19Å; Q623-K626 CarbonylContact O-C 3.59Å; Q623-K626 PolarHBondContact O-N 3.24Å; Q623-I627 WeakPolarHBondContact O-CB 3.42Å; Q623-I627 VanDerWaalsContact O-CG1 3.24Å; Q623-I627 WeakPolarHBondContact O-CG1 3.3Å; Q623-I627 PolarHBondContact O-N 3.15Å
624	E	59.2	Low	60.8	Low	85 Å²	85	119.1 Å²	119.1	40%	0.397	54%	0.537	S	S	.	.	H	α-helix	trans	-61.2	-38.5	172.9	-76.7	179.1	177.4	0	0	111.4	M620 I627 R628	M620-E624 WeakPolarHBondContact O-CB 3.39Å; M620-E624 WeakPolarHBondContact O-CG 3.41Å; M620-E624 PolarHBondContact O-N 3.46Å; E624-I627 PolarHBondContact O-N 2.87Å; E624-R628 WeakPolarHBondContact O-CB 3.39Å; E624-R628 WeakPolarHBondContact O-CG 3.49Å; E624-R628 PolarHBondContact O-N 3.19Å
625	E	62.9	Low	62.6	Low	110 Å²	110	121.7 Å²	121.7	51%	0.514	54%	0.54	S	S	.	.	H	α-helix	trans	-63.9	-44.7	171.8	-109.5	175.1	178	0	0	111.8	R621 Q623 R628 E629	R621-E625 WeakPolarHBondContact O-CB 3.27Å; R621-E625 PolarHBondContact O-N 3.34Å; Q623-E625 VanDerWaalsContact C-N 3.31Å; Q623-E625 PolarHBondContact O-N 3.19Å; E625-R628 PolarHBondContact O-N 2.8Å; E625-E629 PolarHBondContact O-N 3.47Å
626	K	68.3	Low	63.7	Low	143 Å²	143	121.5 Å²	121.5	62%	0.622	54%	0.539	S	S	*	.	H	α-helix	trans	-65.4	-38.3	175.8	-73.3	178.6	-178.6	-175.2	0	112.7	R622 Q623 E629 Q630	R622-K626 WeakPolarHBondContact O-CG 3.44Å; R622-K626 PolarHBondContact O-N 2.78Å; Q623-K626 CarbonylContact O-C 3.59Å; Q623-K626 PolarHBondContact O-N 3.24Å; K626-E629 PolarHBondContact O-N 2.94Å; K626-Q630 WeakPolarHBondContact O-CB 3.37Å; K626-Q630 WeakPolarHBondContact O-CG 3.42Å; K626-Q630 PolarHBondContact O-N 3.17Å
627	I	66.4	Low	64.9	Low	89 Å²	89	122.7 Å²	122.7	46%	0.456	54%	0.544	S	S	.	.	H	α-helix	trans	-65.6	-45.1	175	-70.4	167.9	0	0	0	108.9	Q623 E624 E629 Q630 E631	Q623-I627 WeakPolarHBondContact O-CB 3.42Å; Q623-I627 VanDerWaalsContact O-CG1 3.24Å; Q623-I627 WeakPolarHBondContact O-CG1 3.3Å; Q623-I627 PolarHBondContact O-N 3.15Å; E624-I627 PolarHBondContact O-N 2.87Å; I627-E629 PolarHBondContact O-N 3.43Å; I627-Q630 CarbonylContact O-C 3.52Å; I627-Q630 PolarHBondContact O-N 3.2Å; I627-Q630 VanDerWaalsContact O-N 3.14Å; I627-E631 HydrophobicContact CG2-CG 4.15Å; I627-E631 WeakPolarHBondContact O-CB 3.31Å; I627-E631 WeakPolarHBondContact O-CG 3.34Å; I627-E631 PolarHBondContact O-N 3.3Å
628	R	69.7	Low	66.2	Low	163 Å²	163	122.2 Å²	122.2	62%	0.615	54%	0.54	S	S	*	.	H	α-helix	trans	-60.3	-43.9	175.1	-81.2	-178.5	-170.7	162.9	8.1	112.7	E624 E625 Q630 E631 E632	E624-R628 WeakPolarHBondContact O-CB 3.39Å; E624-R628 WeakPolarHBondContact O-CG 3.49Å; E624-R628 PolarHBondContact O-N 3.19Å; E625-R628 PolarHBondContact O-N 2.8Å; R628-Q630 VanDerWaalsContact C-N 3.3Å; R628-Q630 PolarHBondContact O-N 3.24Å; R628-E631 PolarHBondContact O-N 3.03Å; R628-E632 WeakPolarHBondContact O-CB 3.35Å; R628-E632 PolarHBondContact O-N 2.9Å
629	E	67.6	Low	67.2	Low	112 Å²	112	123.6 Å²	123.6	52%	0.523	55%	0.547	S	S	.	.	H	α-helix	trans	-62.9	-37.2	174.9	-78.6	-175.3	174	0	0	111.8	E625 K626 I627 K633	E625-E629 PolarHBondContact O-N 3.47Å; K626-E629 PolarHBondContact O-N 2.94Å; I627-E629 PolarHBondContact O-N 3.43Å; E629-K633 VanDerWaalsContact O-CG 3.32Å; E629-K633 WeakPolarHBondContact O-CG 3.35Å; E629-K633 PolarHBondContact O-N 3.27Å
630	Q	68.9	Low	68.2	Low	130 Å²	130	123.7 Å²	123.7	61%	0.607	55%	0.547	S	S	*	.	H	α-helix	trans	-70.4	-40.6	173.8	-77	-162.5	-14.1	0	0	112.4	K626 I627 R628 E632 K633 I634	K626-Q630 WeakPolarHBondContact O-CB 3.37Å; K626-Q630 WeakPolarHBondContact O-CG 3.42Å; K626-Q630 PolarHBondContact O-N 3.17Å; I627-Q630 CarbonylContact O-C 3.52Å; I627-Q630 PolarHBondContact O-N 3.2Å; I627-Q630 VanDerWaalsContact O-N 3.14Å; R628-Q630 VanDerWaalsContact C-N 3.3Å; R628-Q630 PolarHBondContact O-N 3.24Å; Q630-E632 VanDerWaalsContact C-N 3.3Å; Q630-E632 PolarHBondContact O-N 2.87Å; Q630-K633 PolarHBondContact O-N 3.38Å; Q630-I634 WeakPolarHBondContact O-CB 3.48Å; Q630-I634 VanDerWaalsContact O-CG1 3.25Å; Q630-I634 WeakPolarHBondContact O-CG1 3.27Å; Q630-I634 PolarHBondContact O-N 3.03Å
631	E	69.7	Low	69.7	Low	121 Å²	121	123.4 Å²	123.4	57%	0.565	55%	0.547	S	S	*	.	H	α-helix	trans	-61.5	-39.9	174.5	-76.7	179.3	165.6	0	0	111	I627 R628 I634 R635	I627-E631 HydrophobicContact CG2-CG 4.15Å; I627-E631 WeakPolarHBondContact O-CB 3.31Å; I627-E631 WeakPolarHBondContact O-CG 3.34Å; I627-E631 PolarHBondContact O-N 3.3Å; R628-E631 PolarHBondContact O-N 3.03Å; E631-I634 PolarHBondContact O-N 3.25Å; E631-R635 VanDerWaalsContact O-CB 3.3Å; E631-R635 WeakPolarHBondContact O-CB 3.5Å; E631-R635 PolarHBondContact O-N 3.1Å
632	E	71.7	Confident	70.6	Confident	126 Å²	126	124.2 Å²	124.2	59%	0.589	55%	0.55	S	S	*	.	H	α-helix	trans	-66.8	-43.4	176.5	-160.2	171.4	-148.7	0	0	111.2	R628 Q630 I634 R635 E636	R628-E632 WeakPolarHBondContact O-CB 3.35Å; R628-E632 PolarHBondContact O-N 2.9Å; Q630-E632 VanDerWaalsContact C-N 3.3Å; Q630-E632 PolarHBondContact O-N 2.87Å; E632-I634 PolarHBondContact O-N 2.79Å; E632-R635 WeakPolarHBondContact O-CB 3.26Å; E632-R635 PolarHBondContact O-N 3.08Å; E632-R635 VanDerWaalsContact O-N 3.13Å; E632-E636 PolarHBondContact O-N 3.04Å
633	K	76.5	Confident	71.5	Confident	127 Å²	127	122.4 Å²	122.4	55%	0.552	55%	0.547	S	S	*	.	H	α-helix	trans	-61.9	-41.2	172.3	-74.2	172.3	-176.3	171.1	0	112.9	E629 Q630 R635 E636 Q637	E629-K633 VanDerWaalsContact O-CG 3.32Å; E629-K633 WeakPolarHBondContact O-CG 3.35Å; E629-K633 PolarHBondContact O-N 3.27Å; Q630-K633 PolarHBondContact O-N 3.38Å; K633-R635 VanDerWaalsContact C-N 3.29Å; K633-E636 PolarHBondContact O-N 3.46Å; K633-Q637 WeakPolarHBondContact O-CG 3.42Å; K633-Q637 PolarHBondContact O-N 3.27Å
634	I	74.3	Confident	72.2	Confident	83 Å²	83	123 Å²	123	43%	0.426	55%	0.55	S	S	.	.	H	α-helix	trans	-64.7	-37.8	174.8	-70.7	167.7	0	0	0	110	Q630 E631 E632 Q637 K638	Q630-I634 WeakPolarHBondContact O-CB 3.48Å; Q630-I634 VanDerWaalsContact O-CG1 3.25Å; Q630-I634 WeakPolarHBondContact O-CG1 3.27Å; Q630-I634 PolarHBondContact O-N 3.03Å; E631-I634 PolarHBondContact O-N 3.25Å; E632-I634 PolarHBondContact O-N 2.79Å; I634-Q637 PolarHBondContact O-N 2.83Å; I634-K638 HydrophobicContact CG2-CD 4.27Å; I634-K638 HydrophobicContact CG2-CG 4.48Å; I634-K638 WeakPolarHBondContact O-CB 3.27Å; I634-K638 WeakPolarHBondContact O-CG 3.48Å; I634-K638 PolarHBondContact O-N 3.17Å
635	R	77.6	Confident	72.9	Confident	188 Å²	188	124.4 Å²	124.4	71%	0.709	56%	0.557	S	S	*	*	H	α-helix	trans	-66	-44.7	178	-157.2	-178.1	-118.4	167.6	-0.8	111.4	E631 E632 K633 Q637 K638 E639	E631-R635 VanDerWaalsContact O-CB 3.3Å; E631-R635 WeakPolarHBondContact O-CB 3.5Å; E631-R635 PolarHBondContact O-N 3.1Å; E632-R635 WeakPolarHBondContact O-CB 3.26Å; E632-R635 PolarHBondContact O-N 3.08Å; E632-R635 VanDerWaalsContact O-N 3.13Å; K633-R635 VanDerWaalsContact C-N 3.29Å; R635-Q637 VanDerWaalsContact C-N 3.34Å; R635-Q637 PolarHBondContact O-N 3.29Å; R635-K638 PolarHBondContact O-N 3.09Å; R635-E639 PolarHBondContact O-N 3.22Å
636	E	72.9	Confident	73.6	Confident	108 Å²	108	125.4 Å²	125.4	51%	0.505	56%	0.561	S	S	.	*	H	α-helix	trans	-61.8	-39.8	172.7	-73.5	-175.9	172.1	0	0	112.2	E632 K633 E639 K640	E632-E636 PolarHBondContact O-N 3.04Å; K633-E636 PolarHBondContact O-N 3.46Å; E636-E639 PolarHBondContact O-N 2.89Å; E636-K640 WeakPolarHBondContact O-CG 3.18Å; E636-K640 PolarHBondContact O-N 3.33Å
637	Q	75.6	Confident	74.2	Confident	125 Å²	125	124.7 Å²	124.7	58%	0.584	56%	0.558	S	S	*	*	H	α-helix	trans	-64.7	-41	174.3	-77.6	-174.4	-19.9	0	0	112	K633 I634 R635 E639 K640 I641	K633-Q637 WeakPolarHBondContact O-CG 3.42Å; K633-Q637 PolarHBondContact O-N 3.27Å; I634-Q637 PolarHBondContact O-N 2.83Å; R635-Q637 VanDerWaalsContact C-N 3.34Å; R635-Q637 PolarHBondContact O-N 3.29Å; Q637-E639 VanDerWaalsContact C-N 3.34Å; Q637-K640 PolarHBondContact O-N 3.12Å; Q637-I641 WeakPolarHBondContact O-CG1 3.42Å; Q637-I641 PolarHBondContact O-N 3.26Å
638	K	76.2	Confident	74.6	Confident	133 Å²	133	124.9 Å²	124.9	58%	0.578	56%	0.559	S	S	*	*	H	α-helix	trans	-64.5	-36.4	175.1	-77.9	-179.4	177.2	-177.2	0	112.4	I634 R635 I641 R642	I634-K638 HydrophobicContact CG2-CD 4.27Å; I634-K638 HydrophobicContact CG2-CG 4.48Å; I634-K638 WeakPolarHBondContact O-CB 3.27Å; I634-K638 WeakPolarHBondContact O-CG 3.48Å; I634-K638 PolarHBondContact O-N 3.17Å; R635-K638 PolarHBondContact O-N 3.09Å; K638-I641 PolarHBondContact O-N 2.91Å; K638-R642 WeakPolarHBondContact O-CG 3.48Å; K638-R642 PolarHBondContact O-N 2.92Å
639	E	73.9	Confident	74.8	Confident	117 Å²	117	124.2 Å²	124.2	55%	0.547	56%	0.557	S	S	.	*	H	α-helix	trans	-65.6	-43.1	172.5	-82.4	-168.7	160.6	0	0	112	R635 E636 Q637 I641 R642 E643	R635-E639 PolarHBondContact O-N 3.22Å; E636-E639 PolarHBondContact O-N 2.89Å; Q637-E639 VanDerWaalsContact C-N 3.34Å; E639-I641 VanDerWaalsContact C-N 3.3Å; E639-I641 PolarHBondContact O-N 2.82Å; E639-R642 WeakPolarHBondContact O-CB 3.44Å; E639-R642 PolarHBondContact O-N 3.48Å; E639-R642 VanDerWaalsContact O-N 3.16Å; E639-E643 PolarHBondContact O-N 3.35Å
640	K	79.4	Confident	74.9	Confident	130 Å²	130	123.9 Å²	123.9	57%	0.565	56%	0.555	S	S	*	*	H	α-helix	trans	-62	-37	175.1	-71.6	174.1	-176	171.9	0	113	E636 Q637 Q644	E636-K640 WeakPolarHBondContact O-CG 3.18Å; E636-K640 PolarHBondContact O-N 3.33Å; Q637-K640 PolarHBondContact O-N 3.12Å; K640-Q644 WeakPolarHBondContact O-CG 3.32Å; K640-Q644 PolarHBondContact O-N 3.19Å; K640-Q644 VanDerWaalsContact O-N 3.08Å
641	I	75.6	Confident	75.2	Confident	90 Å²	90	123.9 Å²	123.9	46%	0.462	56%	0.555	S	S	.	*	H	α-helix	trans	-65.6	-45	174.4	-69	167.3	0	0	0	110	Q637 K638 E639 E643 Q644 E645	Q637-I641 WeakPolarHBondContact O-CG1 3.42Å; Q637-I641 PolarHBondContact O-N 3.26Å; K638-I641 PolarHBondContact O-N 2.91Å; E639-I641 VanDerWaalsContact C-N 3.3Å; E639-I641 PolarHBondContact O-N 2.82Å; I641-E643 PolarHBondContact O-N 3.25Å; I641-Q644 CarbonylContact O-C 3.59Å; I641-Q644 WeakPolarHBondContact O-CA 3.32Å; I641-Q644 WeakPolarHBondContact O-CB 3.47Å; I641-Q644 PolarHBondContact O-N 2.83Å; I641-E645 HydrophobicContact CG2-CG 4.29Å; I641-E645 WeakPolarHBondContact O-CG 3.31Å; I641-E645 PolarHBondContact O-N 2.76Å
642	R	79.2	Confident	75.4	Confident	164 Å²	164	122.8 Å²	122.8	62%	0.619	55%	0.55	S	S	*	*	H	α-helix	trans	-59.9	-42.8	175.7	-77.9	178.4	179.8	172.7	-2.4	112.9	K638 E639 Q644 E645 E646	K638-R642 WeakPolarHBondContact O-CG 3.48Å; K638-R642 PolarHBondContact O-N 2.92Å; E639-R642 WeakPolarHBondContact O-CB 3.44Å; E639-R642 PolarHBondContact O-N 3.48Å; E639-R642 VanDerWaalsContact O-N 3.16Å; R642-Q644 PolarHBondContact O-N 2.91Å; R642-E645 PolarHBondContact O-N 3.36Å; R642-E646 PolarHBondContact O-N 3.24Å
643	E	75.9	Confident	75.6	Confident	110 Å²	110	120.9 Å²	120.9	51%	0.514	54%	0.541	S	S	.	.	H	α-helix	trans	-63.7	-30.8	174.7	-72.4	-179.1	179.7	0	0	112.4	E639 I641 K647	E639-E643 PolarHBondContact O-N 3.35Å; I641-E643 PolarHBondContact O-N 3.25Å; E643-K647 VanDerWaalsContact O-CG 3.31Å; E643-K647 WeakPolarHBondContact O-CG 3.3Å; E643-K647 PolarHBondContact O-N 3.43Å
644	Q	74.6	Confident	75.8	Confident	128 Å²	128	120.5 Å²	120.5	60%	0.598	54%	0.54	S	S	*	.	H	α-helix	trans	-74.3	-41	172.5	-76.7	-167.3	-22.3	0	0	112.1	K640 I641 R642 E646 K647 I648	K640-Q644 WeakPolarHBondContact O-CG 3.32Å; K640-Q644 PolarHBondContact O-N 3.19Å; K640-Q644 VanDerWaalsContact O-N 3.08Å; I641-Q644 CarbonylContact O-C 3.59Å; I641-Q644 WeakPolarHBondContact O-CA 3.32Å; I641-Q644 WeakPolarHBondContact O-CB 3.47Å; I641-Q644 PolarHBondContact O-N 2.83Å; R642-Q644 PolarHBondContact O-N 2.91Å; Q644-E646 VanDerWaalsContact C-N 3.33Å; Q644-E646 PolarHBondContact O-N 2.98Å; Q644-K647 PolarHBondContact O-N 3.3Å; Q644-I648 WeakPolarHBondContact O-CG1 3.4Å; Q644-I648 PolarHBondContact O-N 2.95Å
645	E	73.9	Confident	76	Confident	115 Å²	115	120.8 Å²	120.8	54%	0.537	54%	0.541	S	S	.	.	H	α-helix	trans	-59.9	-42.5	174.1	-72.5	173.3	169	0	0	111	I641 R642 K647 I648 W649	I641-E645 HydrophobicContact CG2-CG 4.29Å; I641-E645 WeakPolarHBondContact O-CG 3.31Å; I641-E645 PolarHBondContact O-N 2.76Å; R642-E645 PolarHBondContact O-N 3.36Å; E645-K647 PolarHBondContact O-N 3.48Å; E645-I648 PolarHBondContact O-N 3.48Å; E645-W649 WeakPolarHBondContact O-CB 3.28Å; E645-W649 PolarHBondContact O-N 2.77Å
646	E	78.2	Confident	76.2	Confident	131 Å²	131	118 Å²	118	61%	0.612	53%	0.53	S	S	*	.	H	α-helix	trans	-62.4	-41.6	174.4	-77.4	-179.2	176.1	0	0	112.1	R642 Q644 I648 W649 E650	R642-E646 PolarHBondContact O-N 3.24Å; Q644-E646 VanDerWaalsContact C-N 3.33Å; Q644-E646 PolarHBondContact O-N 2.98Å; E646-I648 PolarHBondContact O-N 2.72Å; E646-W649 PolarHBondContact O-N 3.47Å; E646-E650 WeakPolarHBondContact O-CG 3.46Å; E646-E650 PolarHBondContact O-N 3.18Å
647	K	79.5	Confident	76.5	Confident	129 Å²	129	118 Å²	118	56%	0.561	53%	0.531	S	S	*	.	H	α-helix	trans	-66.2	-36.7	175.9	-74.7	172	-172.8	170.3	0	113.2	E643 Q644 E645 W649 Q651	E643-K647 VanDerWaalsContact O-CG 3.31Å; E643-K647 WeakPolarHBondContact O-CG 3.3Å; E643-K647 PolarHBondContact O-N 3.43Å; Q644-K647 PolarHBondContact O-N 3.3Å; E645-K647 PolarHBondContact O-N 3.48Å; K647-W649 VanDerWaalsContact C-N 3.34Å; K647-Q651 PolarHBondContact O-N 3.14Å; K647-Q651 VanDerWaalsContact O-N 3.13Å
648	I	75.9	Confident	76.5	Confident	93 Å²	93	118.5 Å²	118.5	48%	0.477	53%	0.533	S	S	.	.	H	α-helix	trans	-65.3	-44.4	174.3	-70.2	168.1	0	0	0	109	Q644 E645 E646 E650 Q651 E652	Q644-I648 WeakPolarHBondContact O-CG1 3.4Å; Q644-I648 PolarHBondContact O-N 2.95Å; E645-I648 PolarHBondContact O-N 3.48Å; E646-I648 PolarHBondContact O-N 2.72Å; I648-E650 PolarHBondContact O-N 2.78Å; I648-Q651 CarbonylContact O-C 3.55Å; I648-Q651 WeakPolarHBondContact O-CA 3.49Å; I648-Q651 WeakPolarHBondContact O-CB 3.45Å; I648-Q651 PolarHBondContact O-N 3.47Å; I648-E652 HydrophobicContact CG2-CG 4.32Å; I648-E652 WeakPolarHBondContact O-CG 3.36Å; I648-E652 PolarHBondContact O-N 3.45Å
649	W	73.1	Confident	76.2	Confident	149 Å²	149	117 Å²	117	56%	0.564	53%	0.528	S	S	*	.	H	α-helix	trans	-62.4	-42.5	178.7	-164.9	74.5	0	0	0	112.6	E645 E646 K647 Q651 E652 E653	E645-W649 WeakPolarHBondContact O-CB 3.28Å; E645-W649 PolarHBondContact O-N 2.77Å; E646-W649 PolarHBondContact O-N 3.47Å; K647-W649 VanDerWaalsContact C-N 3.34Å; W649-Q651 VanDerWaalsContact C-N 3.26Å; W649-Q651 PolarHBondContact O-N 3.11Å; W649-E652 PolarHBondContact O-N 3.11Å; W649-E653 WeakPolarHBondContact O-CB 3.33Å; W649-E653 PolarHBondContact O-N 2.8Å
650	E	71.3	Confident	76.2	Confident	104 Å²	104	117.1 Å²	117.1	49%	0.486	53%	0.529	S	S	.	.	H	α-helix	trans	-63	-29.8	172.2	-73.9	-177.7	-177.8	0	0	113	E646 I648 K654	E646-E650 WeakPolarHBondContact O-CG 3.46Å; E646-E650 PolarHBondContact O-N 3.18Å; I648-E650 PolarHBondContact O-N 2.78Å; E650-K654 WeakPolarHBondContact O-CG 3.3Å; E650-K654 PolarHBondContact O-N 2.92Å
651	Q	74.7	Confident	75.6	Confident	131 Å²	131	116.8 Å²	116.8	61%	0.612	53%	0.53	S	S	*	.	H	α-helix	trans	-75.5	-42.7	172.9	-78.4	-164.3	-6.9	0	0	111.9	K647 I648 W649 E653 K654 I655	K647-Q651 PolarHBondContact O-N 3.14Å; K647-Q651 VanDerWaalsContact O-N 3.13Å; I648-Q651 CarbonylContact O-C 3.55Å; I648-Q651 WeakPolarHBondContact O-CA 3.49Å; I648-Q651 WeakPolarHBondContact O-CB 3.45Å; I648-Q651 PolarHBondContact O-N 3.47Å; W649-Q651 VanDerWaalsContact C-N 3.26Å; W649-Q651 PolarHBondContact O-N 3.11Å; Q651-E653 VanDerWaalsContact C-N 3.28Å; Q651-E653 PolarHBondContact O-N 3.39Å; Q651-K654 PolarHBondContact O-N 2.74Å; Q651-I655 WeakPolarHBondContact O-CG1 3.43Å; Q651-I655 PolarHBondContact O-N 2.98Å
652	E	74.2	Confident	74.5	Confident	97 Å²	97	118 Å²	118	45%	0.453	54%	0.535	S	S	.	.	H	α-helix	trans	-60.5	-38.3	174.8	-74.3	-179.1	173.4	0	0	111.5	I648 W649 I655 R656	I648-E652 HydrophobicContact CG2-CG 4.32Å; I648-E652 WeakPolarHBondContact O-CG 3.36Å; I648-E652 PolarHBondContact O-N 3.45Å; W649-E652 PolarHBondContact O-N 3.11Å; E652-I655 PolarHBondContact O-N 3.34Å; E652-R656 WeakPolarHBondContact O-CB 3.43Å; E652-R656 PolarHBondContact O-N 2.89Å
653	E	75.7	Confident	74.4	Confident	87 Å²	87	115.8 Å²	115.8	41%	0.407	53%	0.532	S	S	.	.	H	α-helix	trans	-63.1	-45.6	174.4	-168.9	-179.3	-156	0	0	111.4	W649 Q651 I655 R656 E657	W649-E653 WeakPolarHBondContact O-CB 3.33Å; W649-E653 PolarHBondContact O-N 2.8Å; Q651-E653 VanDerWaalsContact C-N 3.28Å; Q651-E653 PolarHBondContact O-N 3.39Å; E653-I655 VanDerWaalsContact C-N 3.35Å; E653-I655 PolarHBondContact O-N 2.76Å; E653-R656 WeakPolarHBondContact O-CB 3.33Å; E653-R656 PolarHBondContact O-N 2.85Å; E653-R656 VanDerWaalsContact O-N 3.16Å; E653-E657 WeakPolarHBondContact O-CG 3.42Å; E653-E657 PolarHBondContact O-N 2.93Å
654	K	79.6	Confident	74.3	Confident	119 Å²	119	115.5 Å²	115.5	52%	0.517	53%	0.531	S	S	.	.	H	α-helix	trans	-63.7	-37	176.2	-74	169.1	-174.3	160.6	0	113.4	E650 Q651 R656 Q658	E650-K654 WeakPolarHBondContact O-CG 3.3Å; E650-K654 PolarHBondContact O-N 2.92Å; Q651-K654 PolarHBondContact O-N 2.74Å; K654-R656 VanDerWaalsContact C-N 3.33Å; K654-Q658 WeakPolarHBondContact O-CG 3.39Å; K654-Q658 PolarHBondContact O-N 3.3Å
655	I	78.3	Confident	73.9	Confident	88 Å²	88	115 Å²	115	45%	0.451	53%	0.529	S	S	.	.	H	α-helix	trans	-64.7	-43.9	174.6	-69.2	167.5	0	0	0	109.2	Q651 E652 E653 E657 Q658 E659	Q651-I655 WeakPolarHBondContact O-CG1 3.43Å; Q651-I655 PolarHBondContact O-N 2.98Å; E652-I655 PolarHBondContact O-N 3.34Å; E653-I655 VanDerWaalsContact C-N 3.35Å; E653-I655 PolarHBondContact O-N 2.76Å; I655-E657 PolarHBondContact O-N 3.35Å; I655-Q658 CarbonylContact O-C 3.56Å; I655-Q658 WeakPolarHBondContact O-CB 3.25Å; I655-Q658 PolarHBondContact O-N 2.93Å; I655-Q658 VanDerWaalsContact O-N 3.12Å; I655-E659 HydrophobicContact CG2-CG 4.45Å; I655-E659 WeakPolarHBondContact O-CG 3.34Å; I655-E659 PolarHBondContact O-N 3.4Å
656	R	83.5	Confident	73.4	Confident	129 Å²	129	115.9 Å²	115.9	49%	0.487	53%	0.533	S	S	.	.	H	α-helix	trans	-63.1	-41.9	178.2	-155.2	-178.1	-61.6	157.4	4.7	112.3	E652 E653 K654 Q658 E659 E660	E652-R656 WeakPolarHBondContact O-CB 3.43Å; E652-R656 PolarHBondContact O-N 2.89Å; E653-R656 WeakPolarHBondContact O-CB 3.33Å; E653-R656 PolarHBondContact O-N 2.85Å; E653-R656 VanDerWaalsContact O-N 3.16Å; K654-R656 VanDerWaalsContact C-N 3.33Å; R656-Q658 VanDerWaalsContact C-N 3.31Å; R656-Q658 PolarHBondContact O-N 3.5Å; R656-E659 PolarHBondContact O-N 2.98Å; R656-E660 PolarHBondContact O-N 3.32Å
657	E	77.8	Confident	73.2	Confident	109 Å²	109	116.3 Å²	116.3	51%	0.509	54%	0.535	S	S	.	.	H	α-helix	trans	-62.2	-36.7	172.6	-71.8	-179.2	165.6	0	0	112.2	E653 I655 M661	E653-E657 WeakPolarHBondContact O-CG 3.42Å; E653-E657 PolarHBondContact O-N 2.93Å; I655-E657 PolarHBondContact O-N 3.35Å; E657-M661 WeakPolarHBondContact O-CB 3.29Å; E657-M661 VanDerWaalsContact O-CG 3.27Å; E657-M661 WeakPolarHBondContact O-CG 3.24Å; E657-M661 PolarHBondContact O-N 3.32Å
658	Q	76	Confident	72.9	Confident	136 Å²	136	115.5 Å²	115.5	64%	0.636	53%	0.531	S	S	*	.	H	α-helix	trans	-69.2	-38.4	174	-79.1	-173.9	-14	0	0	112.7	K654 I655 R656 M661 M662	K654-Q658 WeakPolarHBondContact O-CG 3.39Å; K654-Q658 PolarHBondContact O-N 3.3Å; I655-Q658 CarbonylContact O-C 3.56Å; I655-Q658 WeakPolarHBondContact O-CB 3.25Å; I655-Q658 PolarHBondContact O-N 2.93Å; I655-Q658 VanDerWaalsContact O-N 3.12Å; R656-Q658 VanDerWaalsContact C-N 3.31Å; R656-Q658 PolarHBondContact O-N 3.5Å; Q658-M661 PolarHBondContact O-N 2.81Å; Q658-M662 PolarHBondContact O-N 3.46Å
659	E	69.5	Low	71.4	Confident	102 Å²	102	116.2 Å²	116.2	48%	0.477	53%	0.534	S	S	.	.	H	α-helix	trans	-64.3	-43.9	174.8	-74.4	176.9	169.3	0	0	111.3	I655 R656 M661 M662 Q663	I655-E659 HydrophobicContact CG2-CG 4.45Å; I655-E659 WeakPolarHBondContact O-CG 3.34Å; I655-E659 PolarHBondContact O-N 3.4Å; R656-E659 PolarHBondContact O-N 2.98Å; E659-M661 PolarHBondContact O-N 3.37Å; E659-M662 HydrophobicContact CG-CE 4.42Å; E659-M662 PolarHBondContact O-N 3.2Å; E659-Q663 WeakPolarHBondContact O-CG 3.36Å; E659-Q663 PolarHBondContact O-N 3.48Å
660	E	74	Confident	71.4	Confident	119 Å²	119	110.6 Å²	110.6	56%	0.556	52%	0.522	S	S	*	.	H	α-helix	trans	-62.1	-41.4	174.5	-74.1	-179.1	-178.3	0	0	111.6	R656 M662 Q663 E664	R656-E660 PolarHBondContact O-N 3.32Å; E660-M662 PolarHBondContact O-N 2.95Å; E660-Q663 PolarHBondContact O-N 3.21Å; E660-E664 PolarHBondContact O-N 3.24Å
661	M	68	Low	71.6	Confident	122 Å²	122	111 Å²	111	60%	0.601	52%	0.524	S	S	*	.	H	α-helix	trans	-64.3	-36.1	174.7	-79.4	-79.2	-62	0	0	113.3	E657 Q658 E659 Q665	E657-M661 WeakPolarHBondContact O-CB 3.29Å; E657-M661 VanDerWaalsContact O-CG 3.27Å; E657-M661 WeakPolarHBondContact O-CG 3.24Å; E657-M661 PolarHBondContact O-N 3.32Å; Q658-M661 PolarHBondContact O-N 2.81Å; E659-M661 PolarHBondContact O-N 3.37Å; M661-Q665 WeakPolarHBondContact O-CG 3.28Å; M661-Q665 PolarHBondContact O-N 2.76Å
662	M	51.9	Low	71.1	Confident	115 Å²	115	111.1 Å²	111.1	57%	0.567	53%	0.525	S	S	*	.	H	α-helix	trans	-68.4	-43.4	173.1	-85.1	-168.8	-58.6	0	0	111.3	Q658 E659 E660 E664 Q665 E666	Q658-M662 PolarHBondContact O-N 3.46Å; E659-M662 HydrophobicContact CG-CE 4.42Å; E659-M662 PolarHBondContact O-N 3.2Å; E660-M662 PolarHBondContact O-N 2.95Å; M662-E664 PolarHBondContact O-N 2.95Å; M662-Q665 WeakPolarHBondContact O-CA 3.44Å; M662-Q665 WeakPolarHBondContact O-CB 3.29Å; M662-Q665 PolarHBondContact O-N 3.08Å; M662-Q665 VanDerWaalsContact O-N 3.08Å; M662-E666 PolarHBondContact O-N 2.96Å
663	Q	75.9	Confident	70.5	Confident	118 Å²	118	111.7 Å²	111.7	55%	0.551	53%	0.528	S	S	*	.	H	α-helix	trans	-61	-42.7	177.2	-75.9	179.2	-2.3	0	0	111.8	E659 E660 Q665 E666 E667	E659-Q663 WeakPolarHBondContact O-CG 3.36Å; E659-Q663 PolarHBondContact O-N 3.48Å; E660-Q663 PolarHBondContact O-N 3.21Å; Q663-Q665 VanDerWaalsContact C-N 3.27Å; Q663-Q665 PolarHBondContact O-N 2.95Å; Q663-E666 PolarHBondContact O-N 2.96Å; Q663-E667 PolarHBondContact O-N 3.33Å
664	E	74	Confident	70.5	Confident	105 Å²	105	113.5 Å²	113.5	49%	0.491	54%	0.536	S	S	.	.	H	α-helix	trans	-63.4	-31.6	174	-81	-164.7	-178.6	0	0	113.2	E660 M662 K668	E660-E664 PolarHBondContact O-N 3.24Å; M662-E664 PolarHBondContact O-N 2.95Å; E664-K668 WeakPolarHBondContact O-CD 3.45Å; E664-K668 VanDerWaalsContact O-CG 3.26Å; E664-K668 WeakPolarHBondContact O-CG 3.45Å; E664-K668 PolarHBondContact O-N 3.1Å; E664-K668 IonicContact OE2-NZ 2.82Å
665	Q	67.9	Low	70.1	Confident	118 Å²	118	113.4 Å²	113.4	55%	0.551	54%	0.536	S	S	*	.	H	α-helix	trans	-71.5	-41.8	173.9	-80.4	-85.3	-0.3	0	0	111.2	M661 M662 Q663 K668 M669	M661-Q665 WeakPolarHBondContact O-CG 3.28Å; M661-Q665 PolarHBondContact O-N 2.76Å; M662-Q665 WeakPolarHBondContact O-CA 3.44Å; M662-Q665 WeakPolarHBondContact O-CB 3.29Å; M662-Q665 PolarHBondContact O-N 3.08Å; M662-Q665 VanDerWaalsContact O-N 3.08Å; Q663-Q665 VanDerWaalsContact C-N 3.27Å; Q663-Q665 PolarHBondContact O-N 2.95Å; Q665-K668 PolarHBondContact O-N 2.84Å; Q665-M669 WeakPolarHBondContact O-CG 3.42Å; Q665-M669 PolarHBondContact O-N 3.08Å
666	E	63.3	Low	67.9	Low	133 Å²	133	115.1 Å²	115.1	62%	0.621	54%	0.543	S	S	*	.	H	α-helix	trans	-61.9	-43.8	174.5	-75.2	-178	169.3	0	0	111.5	M662 Q663 K668 M669 G670	M662-E666 PolarHBondContact O-N 2.96Å; Q663-E666 PolarHBondContact O-N 2.96Å; E666-K668 VanDerWaalsContact C-N 3.35Å; E666-K668 PolarHBondContact O-N 3.47Å; E666-M669 PolarHBondContact O-N 2.92Å; E666-G670 PolarHBondContact O-N 3.34Å
667	E	73.2	Confident	66.4	Low	140 Å²	140	118.2 Å²	118.2	65%	0.654	56%	0.555	S	S	*	*	H	α-helix	trans	-61.5	-41.2	175	-74.9	-174	169.8	0	0	111.9	Q663 M669 G670 E671	Q663-E667 PolarHBondContact O-N 3.33Å; E667-M669 PolarHBondContact O-N 3.05Å; E667-G670 PolarHBondContact O-N 3Å; E667-E671 PolarHBondContact O-N 3.32Å
668	K	73.3	Confident	66	Low	111 Å²	111	118.9 Å²	118.9	48%	0.483	56%	0.558	S	S	.	*	H	α-helix	trans	-65.9	-35.8	175.8	-75.9	167.8	-170.4	147.1	0	112.9	E664 Q665 E666 Q672	E664-K668 WeakPolarHBondContact O-CD 3.45Å; E664-K668 VanDerWaalsContact O-CG 3.26Å; E664-K668 WeakPolarHBondContact O-CG 3.45Å; E664-K668 PolarHBondContact O-N 3.1Å; E664-K668 IonicContact OE2-NZ 2.82Å; Q665-K668 PolarHBondContact O-N 2.84Å; E666-K668 VanDerWaalsContact C-N 3.35Å; E666-K668 PolarHBondContact O-N 3.47Å; K668-Q672 PolarHBondContact O-N 3.31Å; K668-Q672 VanDerWaalsContact O-N 3.16Å
669	M	43.3	Very low	65.5	Low	108 Å²	108	119 Å²	119	53%	0.532	56%	0.558	S	S	.	*	H	α-helix	trans	-67.1	-43.5	172.3	-72.3	-130.6	-55.7	0	0	110.8	Q665 E666 E667 E671 Q672 E673	Q665-M669 WeakPolarHBondContact O-CG 3.42Å; Q665-M669 PolarHBondContact O-N 3.08Å; E666-M669 PolarHBondContact O-N 2.92Å; E667-M669 PolarHBondContact O-N 3.05Å; M669-E671 VanDerWaalsContact C-N 3.34Å; M669-E671 PolarHBondContact O-N 3.3Å; M669-Q672 WeakPolarHBondContact O-CA 3.5Å; M669-Q672 WeakPolarHBondContact O-CB 3.32Å; M669-Q672 PolarHBondContact O-N 3.11Å; M669-E673 WeakPolarHBondContact O-CG 3.41Å; M669-E673 PolarHBondContact O-N 3.23Å
670	G	73.8	Confident	64.8	Low	32 Å²	32	119 Å²	119	33%	0.33	56%	0.559	S	S	.	*	H	α-helix	trans	-56.8	-44.7	175.1	0	0	0	0	0	112.6	E666 E667 Q672 E673 E674	E666-G670 PolarHBondContact O-N 3.34Å; E667-G670 PolarHBondContact O-N 3Å; G670-Q672 VanDerWaalsContact C-N 3.3Å; G670-Q672 PolarHBondContact O-N 3.02Å; G670-E673 PolarHBondContact O-N 3.21Å; G670-E674 WeakPolarHBondContact O-CB 3.29Å; G670-E674 PolarHBondContact O-N 2.74Å
671	E	74.9	Confident	64.3	Low	111 Å²	111	119.5 Å²	119.5	52%	0.519	56%	0.561	S	S	.	*	H	α-helix	trans	-65.3	-28.9	174.5	-71.9	-173.2	179.9	0	0	113.6	E667 M669 K675	E667-E671 PolarHBondContact O-N 3.32Å; M669-E671 VanDerWaalsContact C-N 3.34Å; M669-E671 PolarHBondContact O-N 3.3Å; E671-K675 WeakPolarHBondContact O-CD 3.38Å; E671-K675 VanDerWaalsContact O-CG 3.31Å; E671-K675 WeakPolarHBondContact O-CG 3.49Å; E671-K675 PolarHBondContact O-N 2.8Å
672	Q	64.6	Low	64.1	Low	134 Å²	134	119.9 Å²	119.9	63%	0.626	56%	0.561	S	S	*	*	H	α-helix	trans	-75.8	-41.2	173.8	-89.3	-164.5	-18.6	0	0	112	K668 M669 G670 E674 K675 M676	K668-Q672 PolarHBondContact O-N 3.31Å; K668-Q672 VanDerWaalsContact O-N 3.16Å; M669-Q672 WeakPolarHBondContact O-CA 3.5Å; M669-Q672 WeakPolarHBondContact O-CB 3.32Å; M669-Q672 PolarHBondContact O-N 3.11Å; G670-Q672 VanDerWaalsContact C-N 3.3Å; G670-Q672 PolarHBondContact O-N 3.02Å; Q672-E674 VanDerWaalsContact C-N 3.35Å; Q672-K675 PolarHBondContact O-N 2.94Å; Q672-M676 PolarHBondContact O-N 2.9Å
673	E	62.7	Low	63.9	Low	110 Å²	110	120 Å²	120	51%	0.514	56%	0.562	S	S	.	*	H	α-helix	trans	-61.8	-43.1	175	-73.3	-178.8	174	0	0	110.9	M669 G670 K675 M676 W677	M669-E673 WeakPolarHBondContact O-CG 3.41Å; M669-E673 PolarHBondContact O-N 3.23Å; G670-E673 PolarHBondContact O-N 3.21Å; E673-K675 VanDerWaalsContact C-N 3.34Å; E673-K675 PolarHBondContact O-N 3.44Å; E673-M676 WeakPolarHBondContact O-CB 3.39Å; E673-M676 PolarHBondContact O-N 2.86Å; E673-M676 VanDerWaalsContact O-N 3.13Å; E673-W677 PolarHBondContact O-N 2.67Å
674	E	74.4	Confident	63.3	Low	125 Å²	125	119.7 Å²	119.7	58%	0.584	56%	0.56	S	S	*	*	H	α-helix	trans	-61	-41.8	175.9	-168.8	173.6	-165.6	0	0	111.7	G670 Q672 M676 W677 E678	G670-E674 WeakPolarHBondContact O-CB 3.29Å; G670-E674 PolarHBondContact O-N 2.74Å; Q672-E674 VanDerWaalsContact C-N 3.35Å; E674-M676 VanDerWaalsContact C-N 3.33Å; E674-M676 PolarHBondContact O-N 2.95Å; E674-W677 WeakPolarHBondContact O-CB 3.32Å; E674-W677 PolarHBondContact O-N 3.41Å; E674-E678 PolarHBondContact O-N 3.46Å
675	K	71.3	Confident	63.3	Low	117 Å²	117	119.7 Å²	119.7	51%	0.509	56%	0.56	S	S	.	*	H	α-helix	trans	-65.1	-34.1	174.3	-74.9	168.6	-172.6	148.4	0	113.3	E671 Q672 E673 Q679	E671-K675 WeakPolarHBondContact O-CD 3.38Å; E671-K675 VanDerWaalsContact O-CG 3.31Å; E671-K675 WeakPolarHBondContact O-CG 3.49Å; E671-K675 PolarHBondContact O-N 2.8Å; Q672-K675 PolarHBondContact O-N 2.94Å; E673-K675 VanDerWaalsContact C-N 3.34Å; E673-K675 PolarHBondContact O-N 3.44Å; K675-Q679 PolarHBondContact O-N 3.28Å; K675-Q679 VanDerWaalsContact O-N 3.13Å
676	M	33.2	Very low	63.3	Low	123 Å²	123	119.6 Å²	119.6	61%	0.606	56%	0.56	S	S	*	*	H	α-helix	trans	-67.2	-42.9	173.1	-76.5	-155.4	-53.4	0	0	111	Q672 E673 E674 E678 Q679 E680	Q672-M676 PolarHBondContact O-N 2.9Å; E673-M676 WeakPolarHBondContact O-CB 3.39Å; E673-M676 PolarHBondContact O-N 2.86Å; E673-M676 VanDerWaalsContact O-N 3.13Å; E674-M676 VanDerWaalsContact C-N 3.33Å; E674-M676 PolarHBondContact O-N 2.95Å; M676-E678 PolarHBondContact O-N 2.77Å; M676-Q679 PolarHBondContact O-N 2.82Å; M676-E680 WeakPolarHBondContact O-CB 3.48Å; M676-E680 PolarHBondContact O-N 2.96Å
677	W	51	Low	63	Low	194 Å²	194	119.4 Å²	119.4	74%	0.735	56%	0.559	S	S	*	*	H	α-helix	trans	-59.7	-44.5	175.8	-90.5	73	0	0	0	112	E673 E674 Q679 E680 E681	E673-W677 PolarHBondContact O-N 2.67Å; E674-W677 WeakPolarHBondContact O-CB 3.32Å; E674-W677 PolarHBondContact O-N 3.41Å; W677-Q679 PolarHBondContact O-N 3.07Å; W677-E680 PolarHBondContact O-N 2.77Å; W677-E681 WeakPolarHBondContact O-CB 3.34Å; W677-E681 PolarHBondContact O-N 3.4Å
678	E	69.4	Low	62.9	Low	123 Å²	123	117.8 Å²	117.8	58%	0.575	55%	0.552	S	S	*	*	H	α-helix	trans	-61.7	-41	175.5	-71.5	-176.7	163.3	0	0	112.3	E674 M676 E682	E674-E678 PolarHBondContact O-N 3.46Å; M676-E678 PolarHBondContact O-N 2.77Å; E678-E682 PolarHBondContact O-N 3.42Å
679	Q	65.4	Low	62.9	Low	138 Å²	138	117.5 Å²	117.5	65%	0.645	55%	0.55	S	S	*	*	H	α-helix	trans	-66.6	-39.4	175	-84.9	-171.8	3.7	0	0	112.8	K675 M676 W677 E682 M683	K675-Q679 PolarHBondContact O-N 3.28Å; K675-Q679 VanDerWaalsContact O-N 3.13Å; M676-Q679 PolarHBondContact O-N 2.82Å; W677-Q679 PolarHBondContact O-N 3.07Å; Q679-E682 PolarHBondContact O-N 3.49Å; Q679-M683 PolarHBondContact O-N 3.28Å
680	E	56.1	Low	63.2	Low	104 Å²	104	117.5 Å²	117.5	49%	0.486	55%	0.55	S	S	.	*	H	α-helix	trans	-67.1	-40	178.4	-169.2	166.2	-174.9	0	0	111.2	M676 W677 M683 Q684	M676-E680 WeakPolarHBondContact O-CB 3.48Å; M676-E680 PolarHBondContact O-N 2.96Å; W677-E680 PolarHBondContact O-N 2.77Å; E680-M683 WeakPolarHBondContact O-CB 3.35Å; E680-M683 PolarHBondContact O-N 3.2Å; E680-Q684 WeakPolarHBondContact O-CG 3.47Å; E680-Q684 PolarHBondContact O-N 3.39Å
681	E	62	Low	63.2	Low	129 Å²	129	124.8 Å²	124.8	60%	0.603	57%	0.568	S	S	*	*	H	α-helix	trans	-63.1	-41.9	173.2	-167.3	177.7	-177.4	0	0	111.6	W677 M683 Q684 E685	W677-E681 WeakPolarHBondContact O-CB 3.34Å; W677-E681 PolarHBondContact O-N 3.4Å; E681-M683 VanDerWaalsContact C-N 3.34Å; E681-M683 PolarHBondContact O-N 2.79Å; E681-Q684 PolarHBondContact O-N 3.22Å; E681-E685 PolarHBondContact O-N 3.29Å
682	E	64.8	Low	63.1	Low	129 Å²	129	126.3 Å²	126.3	60%	0.603	57%	0.569	S	S	*	*	H	α-helix	trans	-65.1	-37	175.8	-163.3	179.5	-175.2	0	0	112.1	E678 Q679 E685 Q686	E678-E682 PolarHBondContact O-N 3.42Å; Q679-E682 PolarHBondContact O-N 3.49Å; E682-E685 PolarHBondContact O-N 2.88Å; E682-Q686 WeakPolarHBondContact O-CG 3.13Å; E682-Q686 PolarHBondContact O-N 3.34Å
683	M	47.7	Very low	63.2	Low	117 Å²	117	125.8 Å²	125.8	58%	0.576	57%	0.566	S	S	*	*	H	α-helix	trans	-64.3	-46.8	173.2	-121.4	-162.1	-45.1	0	0	111.5	Q679 E680 E681 E685 Q686 E687	Q679-M683 PolarHBondContact O-N 3.28Å; E680-M683 WeakPolarHBondContact O-CB 3.35Å; E680-M683 PolarHBondContact O-N 3.2Å; E681-M683 VanDerWaalsContact C-N 3.34Å; E681-M683 PolarHBondContact O-N 2.79Å; M683-E685 VanDerWaalsContact C-N 3.3Å; M683-E685 PolarHBondContact O-N 3.36Å; M683-Q686 WeakPolarHBondContact O-CB 3.46Å; M683-Q686 PolarHBondContact O-N 3.15Å; M683-Q686 VanDerWaalsContact O-N 3.1Å; M683-E687 PolarHBondContact O-N 3.36Å
684	Q	63.2	Low	62.8	Low	113 Å²	113	124.4 Å²	124.4	53%	0.528	56%	0.56	S	S	.	*	H	α-helix	trans	-61	-40.1	177.6	-74.4	-175.3	7.3	0	0	111.4	E680 E681 Q686 E687 E688	E680-Q684 WeakPolarHBondContact O-CG 3.47Å; E680-Q684 PolarHBondContact O-N 3.39Å; E681-Q684 PolarHBondContact O-N 3.22Å; Q684-Q686 PolarHBondContact O-N 3.13Å; Q684-E687 PolarHBondContact O-N 2.89Å; Q684-E688 PolarHBondContact O-N 3Å
685	E	73	Confident	62.3	Low	104 Å²	104	124 Å²	124	49%	0.486	56%	0.558	S	S	.	*	H	α-helix	trans	-62.3	-40.4	173	-86.4	-151.4	174.6	0	0	113.2	E681 E682 M683 K689	E681-E685 PolarHBondContact O-N 3.29Å; E682-E685 PolarHBondContact O-N 2.88Å; M683-E685 VanDerWaalsContact C-N 3.3Å; M683-E685 PolarHBondContact O-N 3.36Å; E685-K689 WeakPolarHBondContact O-CD 3.3Å; E685-K689 VanDerWaalsContact O-CG 3.27Å; E685-K689 WeakPolarHBondContact O-CG 3.23Å; E685-K689 PolarHBondContact O-N 2.79Å; E685-K689 IonicContact OE2-NZ 3.04Å; E685-K689 PolarHBondContact OE2-NZ 2.81Å
686	Q	68	Low	62.3	Low	116 Å²	116	125 Å²	125	54%	0.542	56%	0.562	S	S	.	*	H	α-helix	trans	-65	-43.6	175.9	-75.1	-99.2	5.8	0	0	111.2	E682 M683 Q684 K689 M690	E682-Q686 WeakPolarHBondContact O-CG 3.13Å; E682-Q686 PolarHBondContact O-N 3.34Å; M683-Q686 WeakPolarHBondContact O-CB 3.46Å; M683-Q686 PolarHBondContact O-N 3.15Å; M683-Q686 VanDerWaalsContact O-N 3.1Å; Q684-Q686 PolarHBondContact O-N 3.13Å; Q686-K689 WeakPolarHBondContact O-CB 3.42Å; Q686-K689 PolarHBondContact O-N 3.49Å; Q686-M690 PolarHBondContact O-N 2.88Å
687	E	58.2	Low	64.3	Low	130 Å²	130	123.5 Å²	123.5	61%	0.607	56%	0.556	S	S	*	*	H	α-helix	trans	-62.3	-41.5	175.3	-75.4	-168.1	163.1	0	0	112.1	M683 Q684 K689 M690 R691	M683-E687 PolarHBondContact O-N 3.36Å; Q684-E687 PolarHBondContact O-N 2.89Å; E687-K689 PolarHBondContact O-N 3.35Å; E687-M690 WeakPolarHBondContact O-CB 3.48Å; E687-M690 PolarHBondContact O-N 2.82Å; E687-R691 WeakPolarHBondContact O-CB 3.49Å; E687-R691 PolarHBondContact O-N 3.48Å
688	E	69.8	Low	65.4	Low	106 Å²	106	121.2 Å²	121.2	50%	0.495	55%	0.547	S	S	.	.	H	α-helix	trans	-63.4	-40.9	173.7	-80.1	-156.9	173.9	0	0	112.2	Q684 M690 R691 R692	Q684-E688 PolarHBondContact O-N 3Å; E688-M690 VanDerWaalsContact C-N 3.34Å; E688-R691 PolarHBondContact O-N 3.08Å; E688-R692 WeakPolarHBondContact O-CG 3.45Å; E688-R692 PolarHBondContact O-N 3.13Å; E688-R692 IonicContact OE2-CZ 2.84Å; E688-R692 IonicContact OE2-NH2 2.86Å; E688-R692 PolarHBondContact OE2-NH2 3.42Å
689	K	74.3	Confident	65.6	Low	104 Å²	104	120.7 Å²	120.7	45%	0.452	55%	0.545	S	S	.	.	H	α-helix	trans	-62.5	-42.7	175.8	-75.5	164.2	-170.1	147.3	0	110.9	E685 Q686 E687 R692 Q693	E685-K689 WeakPolarHBondContact O-CD 3.3Å; E685-K689 VanDerWaalsContact O-CG 3.27Å; E685-K689 WeakPolarHBondContact O-CG 3.23Å; E685-K689 PolarHBondContact O-N 2.79Å; E685-K689 IonicContact OE2-NZ 3.04Å; E685-K689 PolarHBondContact OE2-NZ 2.81Å; Q686-K689 WeakPolarHBondContact O-CB 3.42Å; Q686-K689 PolarHBondContact O-N 3.49Å; E687-K689 PolarHBondContact O-N 3.35Å; K689-R692 PolarHBondContact O-N 2.76Å; K689-Q693 PolarHBondContact O-N 2.94Å; K689-Q693 VanDerWaalsContact O-N 3.11Å
690	M	49.9	Very low	65.8	Low	109 Å²	109	120.1 Å²	120.1	54%	0.537	54%	0.542	S	S	.	.	H	α-helix	trans	-60.4	-49.3	173.2	-84.9	-83.1	-69.5	0	0	111.8	Q686 E687 E688 R692 Q693 E694	Q686-M690 PolarHBondContact O-N 2.88Å; E687-M690 WeakPolarHBondContact O-CB 3.48Å; E687-M690 PolarHBondContact O-N 2.82Å; E688-M690 VanDerWaalsContact C-N 3.34Å; M690-R692 VanDerWaalsContact C-N 3.31Å; M690-R692 PolarHBondContact O-N 3.29Å; M690-Q693 WeakPolarHBondContact O-CA 3.36Å; M690-Q693 WeakPolarHBondContact O-CB 3.43Å; M690-Q693 PolarHBondContact O-N 3.48Å; M690-E694 PolarHBondContact O-N 2.84Å
691	R	73.6	Confident	66	Low	184 Å²	184	119.4 Å²	119.4	69%	0.694	54%	0.539	S	S	*	.	H	α-helix	trans	-55.7	-43.8	176.4	-100.3	-177.4	173.9	-99.6	0.5	112.6	E687 E688 Q693 E694 E695	E687-R691 WeakPolarHBondContact O-CB 3.49Å; E687-R691 PolarHBondContact O-N 3.48Å; E688-R691 PolarHBondContact O-N 3.08Å; R691-Q693 VanDerWaalsContact C-N 3.3Å; R691-Q693 PolarHBondContact O-N 2.98Å; R691-E694 PolarHBondContact O-N 2.64Å; R691-E695 PolarHBondContact O-N 2.88Å
692	R	72.5	Confident	66.5	Low	144 Å²	144	119.5 Å²	119.5	54%	0.543	54%	0.537	S	S	.	.	H	α-helix	trans	-67	-30	177.2	-68.3	176.7	-158.3	160.4	7.7	112.4	E688 K689 M690 K696	E688-R692 WeakPolarHBondContact O-CG 3.45Å; E688-R692 PolarHBondContact O-N 3.13Å; E688-R692 IonicContact OE2-CZ 2.84Å; E688-R692 IonicContact OE2-NH2 2.86Å; E688-R692 PolarHBondContact OE2-NH2 3.42Å; K689-R692 PolarHBondContact O-N 2.76Å; M690-R692 VanDerWaalsContact C-N 3.31Å; M690-R692 PolarHBondContact O-N 3.29Å; R692-K696 WeakPolarHBondContact O-CG 3.47Å; R692-K696 PolarHBondContact O-N 3.26Å
693	Q	66.4	Low	67.1	Low	122 Å²	122	119.4 Å²	119.4	57%	0.57	54%	0.535	S	S	*	.	H	α-helix	trans	-73.1	-43.5	172.3	-74.3	-172.7	1.4	0	0	111.7	K689 M690 R691 E695 K696 I697	K689-Q693 PolarHBondContact O-N 2.94Å; K689-Q693 VanDerWaalsContact O-N 3.11Å; M690-Q693 WeakPolarHBondContact O-CA 3.36Å; M690-Q693 WeakPolarHBondContact O-CB 3.43Å; M690-Q693 PolarHBondContact O-N 3.48Å; R691-Q693 VanDerWaalsContact C-N 3.3Å; R691-Q693 PolarHBondContact O-N 2.98Å; Q693-E695 VanDerWaalsContact C-N 3.3Å; Q693-E695 PolarHBondContact O-N 3.07Å; Q693-K696 WeakPolarHBondContact O-CB 3.48Å; Q693-K696 PolarHBondContact O-N 3.16Å; Q693-I697 WeakPolarHBondContact O-CG1 3.38Å; Q693-I697 PolarHBondContact O-N 3.46Å
694	E	54.9	Low	68.5	Low	81 Å²	81	118 Å²	118	38%	0.379	53%	0.529	S	S	.	.	H	α-helix	trans	-58.6	-41.5	174.6	-74.8	-169.9	178	0	0	112.2	M690 R691 K696 I697 R698	M690-E694 PolarHBondContact O-N 2.84Å; R691-E694 PolarHBondContact O-N 2.64Å; E694-K696 VanDerWaalsContact C-N 3.33Å; E694-K696 PolarHBondContact O-N 2.81Å; E694-I697 PolarHBondContact O-N 3.32Å; E694-R698 WeakPolarHBondContact O-CG 3.45Å; E694-R698 PolarHBondContact O-N 3.34Å; E694-R698 IonicContact OE2-CZ 3.94Å; E694-R698 IonicContact OE2-NH2 2.72Å; E694-R698 PolarHBondContact OE2-NH2 3.25Å
695	E	64.6	Low	69.1	Low	118 Å²	118	119.8 Å²	119.8	55%	0.551	53%	0.531	S	S	*	.	H	α-helix	trans	-62.7	-40.5	177.9	-167.8	174.8	-166.5	0	0	111.7	R691 Q693 I697 R698 E699	R691-E695 PolarHBondContact O-N 2.88Å; Q693-E695 VanDerWaalsContact C-N 3.3Å; Q693-E695 PolarHBondContact O-N 3.07Å; E695-I697 PolarHBondContact O-N 3.11Å; E695-R698 PolarHBondContact O-N 3.38Å; E695-E699 PolarHBondContact O-N 3.34Å
696	K	69.6	Low	69.4	Low	137 Å²	137	119 Å²	119	60%	0.596	53%	0.527	S	S	*	.	H	α-helix	trans	-63.9	-39.6	173.8	-72.6	174	-177.8	177.4	0	112.5	R692 Q693 E694 E699 Q700	R692-K696 WeakPolarHBondContact O-CG 3.47Å; R692-K696 PolarHBondContact O-N 3.26Å; Q693-K696 WeakPolarHBondContact O-CB 3.48Å; Q693-K696 PolarHBondContact O-N 3.16Å; E694-K696 VanDerWaalsContact C-N 3.33Å; E694-K696 PolarHBondContact O-N 2.81Å; K696-E699 PolarHBondContact O-N 3.23Å; K696-Q700 WeakPolarHBondContact O-CG 3.42Å; K696-Q700 PolarHBondContact O-N 3.42Å
697	I	76	Confident	69.7	Low	92 Å²	92	119.5 Å²	119.5	47%	0.472	53%	0.529	S	S	.	.	H	α-helix	trans	-64.8	-45.8	175.4	-67.1	169.2	0	0	0	109.7	Q693 E694 E695 E699 Q700 E701	Q693-I697 WeakPolarHBondContact O-CG1 3.38Å; Q693-I697 PolarHBondContact O-N 3.46Å; E694-I697 PolarHBondContact O-N 3.32Å; E695-I697 PolarHBondContact O-N 3.11Å; I697-E699 VanDerWaalsContact C-N 3.31Å; I697-E699 PolarHBondContact O-N 3.4Å; I697-Q700 CarbonylContact O-C 3.55Å; I697-Q700 WeakPolarHBondContact O-CB 3.27Å; I697-Q700 PolarHBondContact O-N 3.06Å; I697-E701 HydrophobicContact CG2-CG 4.42Å; I697-E701 PolarHBondContact O-N 3.36Å
698	R	73.5	Confident	70	Confident	146 Å²	146	117.8 Å²	117.8	55%	0.551	52%	0.521	S	S	*	.	H	α-helix	trans	-58.9	-40	176.1	-73.9	-179	-169.2	133	15.2	112.3	E694 E695 E701 K702	E694-R698 WeakPolarHBondContact O-CG 3.45Å; E694-R698 PolarHBondContact O-N 3.34Å; E694-R698 IonicContact OE2-CZ 3.94Å; E694-R698 IonicContact OE2-NH2 2.72Å; E694-R698 PolarHBondContact OE2-NH2 3.25Å; E695-R698 PolarHBondContact O-N 3.38Å; R698-E701 PolarHBondContact O-N 3.13Å; R698-K702 WeakPolarHBondContact O-CB 3.32Å; R698-K702 PolarHBondContact O-N 3.45Å
699	E	74.2	Confident	69.9	Low	112 Å²	112	118.2 Å²	118.2	52%	0.523	52%	0.523	S	S	.	.	H	α-helix	trans	-65.2	-39.2	173.7	-77.4	-168	163.7	0	0	112.8	E695 K696 I697 K702 K703	E695-E699 PolarHBondContact O-N 3.34Å; K696-E699 PolarHBondContact O-N 3.23Å; I697-E699 VanDerWaalsContact C-N 3.31Å; I697-E699 PolarHBondContact O-N 3.4Å; E699-K702 PolarHBondContact O-N 2.84Å; E699-K703 WeakPolarHBondContact O-CG 3.34Å; E699-K703 PolarHBondContact O-N 3.37Å; E699-K703 VanDerWaalsContact O-N 3.12Å
700	Q	70.5	Confident	70.1	Confident	126 Å²	126	119.3 Å²	119.3	59%	0.589	53%	0.528	S	S	*	.	H	α-helix	trans	-66.8	-42.8	175.1	-74.2	-176.8	-9.3	0	0	111.8	K696 I697 K702 K703 I704	K696-Q700 WeakPolarHBondContact O-CG 3.42Å; K696-Q700 PolarHBondContact O-N 3.42Å; I697-Q700 CarbonylContact O-C 3.55Å; I697-Q700 WeakPolarHBondContact O-CB 3.27Å; I697-Q700 PolarHBondContact O-N 3.06Å; Q700-K702 VanDerWaalsContact C-N 3.3Å; Q700-K702 PolarHBondContact O-N 3Å; Q700-K703 PolarHBondContact O-N 2.86Å; Q700-I704 WeakPolarHBondContact O-CG1 3.21Å; Q700-I704 PolarHBondContact O-N 3.07Å
701	E	60.3	Low	71.5	Confident	89 Å²	89	118.4 Å²	118.4	42%	0.416	52%	0.524	S	S	.	.	H	α-helix	trans	-59.2	-41.4	173.7	-75.8	-173.1	-179.9	0	0	111.7	I697 R698 K703 I704 R705	I697-E701 HydrophobicContact CG2-CG 4.42Å; I697-E701 PolarHBondContact O-N 3.36Å; R698-E701 PolarHBondContact O-N 3.13Å; E701-K703 VanDerWaalsContact C-N 3.34Å; E701-K703 PolarHBondContact O-N 3.02Å; E701-I704 PolarHBondContact O-N 3.38Å; E701-R705 WeakPolarHBondContact O-CG 3.1Å; E701-R705 PolarHBondContact O-N 3.41Å; E701-R705 IonicContact OE2-NH2 2.79Å; E701-R705 PolarHBondContact OE2-NH2 3.35Å
702	K	72.5	Confident	71.8	Confident	131 Å²	131	116.2 Å²	116.2	57%	0.57	52%	0.516	S	S	*	.	H	α-helix	trans	-61.4	-42.9	176.1	-170.7	179.6	175.2	-175.6	0	111.5	R698 E699 Q700 R705 E706	R698-K702 WeakPolarHBondContact O-CB 3.32Å; R698-K702 PolarHBondContact O-N 3.45Å; E699-K702 PolarHBondContact O-N 2.84Å; Q700-K702 VanDerWaalsContact C-N 3.3Å; Q700-K702 PolarHBondContact O-N 3Å; K702-R705 PolarHBondContact O-N 2.97Å; K702-E706 WeakPolarHBondContact CE-OE1 3.22Å; K702-E706 WeakPolarHBondContact O-CG 3.42Å; K702-E706 PolarHBondContact O-N 2.72Å
703	K	76	Confident	72.1	Confident	126 Å²	126	114.9 Å²	114.9	55%	0.548	52%	0.516	S	S	.	.	H	α-helix	trans	-64.4	-38.2	175.8	-71.5	173.5	-175.4	169.9	0	112.6	E699 Q700 E701 E706 Q707	E699-K703 WeakPolarHBondContact O-CG 3.34Å; E699-K703 PolarHBondContact O-N 3.37Å; E699-K703 VanDerWaalsContact O-N 3.12Å; Q700-K703 PolarHBondContact O-N 2.86Å; E701-K703 VanDerWaalsContact C-N 3.34Å; E701-K703 PolarHBondContact O-N 3.02Å; K703-E706 PolarHBondContact O-N 3.32Å; K703-Q707 WeakPolarHBondContact O-CG 3.39Å; K703-Q707 PolarHBondContact O-N 3.41Å
704	I	77.2	Confident	72.5	Confident	88 Å²	88	115.5 Å²	115.5	45%	0.451	52%	0.519	S	S	.	.	H	α-helix	trans	-64.6	-46.3	175	-69.8	163	0	0	0	110	Q700 E701 E706 Q707 E708	Q700-I704 WeakPolarHBondContact O-CG1 3.21Å; Q700-I704 PolarHBondContact O-N 3.07Å; E701-I704 PolarHBondContact O-N 3.38Å; I704-E706 VanDerWaalsContact C-N 3.33Å; I704-E706 PolarHBondContact O-N 2.83Å; I704-Q707 CarbonylContact O-C 3.54Å; I704-Q707 WeakPolarHBondContact O-CA 3.43Å; I704-Q707 WeakPolarHBondContact O-CB 3.27Å; I704-Q707 PolarHBondContact O-N 3.37Å; I704-E708 HydrophobicContact CG2-CG 4.25Å; I704-E708 WeakPolarHBondContact O-CG 3.34Å; I704-E708 PolarHBondContact O-N 3.47Å
705	R	76.7	Confident	73	Confident	151 Å²	151	116.3 Å²	116.3	57%	0.57	52%	0.523	S	S	*	.	H	α-helix	trans	-58.9	-43	176.6	-72	-179.7	-155.5	161.7	10.7	112.2	E701 K702 Q707 E708 E709	E701-R705 WeakPolarHBondContact O-CG 3.1Å; E701-R705 PolarHBondContact O-N 3.41Å; E701-R705 IonicContact OE2-NH2 2.79Å; E701-R705 PolarHBondContact OE2-NH2 3.35Å; K702-R705 PolarHBondContact O-N 2.97Å; R705-Q707 VanDerWaalsContact C-N 3.27Å; R705-Q707 PolarHBondContact O-N 2.95Å; R705-E708 PolarHBondContact O-N 3.22Å; R705-E709 WeakPolarHBondContact O-CB 3.18Å; R705-E709 PolarHBondContact O-N 2.92Å
706	E	79	Confident	73.2	Confident	88 Å²	88	116.7 Å²	116.7	41%	0.411	52%	0.524	S	S	.	.	H	α-helix	trans	-64	-30.3	174.9	-72.6	174.4	-167.3	0	0	112.6	K702 K703 I704 K710	K702-E706 WeakPolarHBondContact CE-OE1 3.22Å; K702-E706 WeakPolarHBondContact O-CG 3.42Å; K702-E706 PolarHBondContact O-N 2.72Å; K703-E706 PolarHBondContact O-N 3.32Å; I704-E706 VanDerWaalsContact C-N 3.33Å; I704-E706 PolarHBondContact O-N 2.83Å; E706-K710 WeakPolarHBondContact O-CG 3.5Å; E706-K710 PolarHBondContact O-N 3.38Å
707	Q	73.9	Confident	73.3	Confident	126 Å²	126	116 Å²	116	59%	0.589	53%	0.525	S	S	*	.	H	α-helix	trans	-75.4	-41.6	172.8	-75.3	-177.5	-14	0	0	112.2	K703 I704 R705 E709 K710 I711	K703-Q707 WeakPolarHBondContact O-CG 3.39Å; K703-Q707 PolarHBondContact O-N 3.41Å; I704-Q707 CarbonylContact O-C 3.54Å; I704-Q707 WeakPolarHBondContact O-CA 3.43Å; I704-Q707 WeakPolarHBondContact O-CB 3.27Å; I704-Q707 PolarHBondContact O-N 3.37Å; R705-Q707 VanDerWaalsContact C-N 3.27Å; R705-Q707 PolarHBondContact O-N 2.95Å; Q707-E709 VanDerWaalsContact C-N 3.28Å; Q707-E709 PolarHBondContact O-N 3.42Å; Q707-K710 PolarHBondContact O-N 2.85Å; Q707-I711 WeakPolarHBondContact O-CG1 3.5Å; Q707-I711 PolarHBondContact O-N 3.41Å
708	E	64.2	Low	72.4	Confident	94 Å²	94	117.1 Å²	117.1	44%	0.439	53%	0.529	S	S	.	.	H	α-helix	trans	-62.2	-35.8	175.5	-73.1	178.7	169.9	0	0	112.1	I704 R705 I711 R712	I704-E708 HydrophobicContact CG2-CG 4.25Å; I704-E708 WeakPolarHBondContact O-CG 3.34Å; I704-E708 PolarHBondContact O-N 3.47Å; R705-E708 PolarHBondContact O-N 3.22Å; E708-I711 PolarHBondContact O-N 3.32Å; E708-R712 WeakPolarHBondContact O-CB 3.35Å; E708-R712 PolarHBondContact O-N 3.15Å
709	E	69.1	Low	72.3	Confident	115 Å²	115	115.7 Å²	115.7	54%	0.537	53%	0.529	S	S	.	.	H	α-helix	trans	-66.7	-43.3	175	-164.4	171.5	-161.3	0	0	111.2	R705 Q707 I711 R712 E713	R705-E709 WeakPolarHBondContact O-CB 3.18Å; R705-E709 PolarHBondContact O-N 2.92Å; Q707-E709 VanDerWaalsContact C-N 3.28Å; Q707-E709 PolarHBondContact O-N 3.42Å; E709-I711 PolarHBondContact O-N 3.02Å; E709-R712 WeakPolarHBondContact O-CB 3.33Å; E709-R712 PolarHBondContact O-N 3.48Å; E709-E713 WeakPolarHBondContact O-CG 3.48Å; E709-E713 PolarHBondContact O-N 2.72Å
710	K	78	Confident	72.4	Confident	127 Å²	127	115.3 Å²	115.3	55%	0.552	53%	0.527	S	S	*	.	H	α-helix	trans	-63.9	-37.1	174.3	-72.7	171.9	-176.4	170.9	0	113.5	E706 Q707 Q714	E706-K710 WeakPolarHBondContact O-CG 3.5Å; E706-K710 PolarHBondContact O-N 3.38Å; Q707-K710 PolarHBondContact O-N 2.85Å; K710-Q714 WeakPolarHBondContact O-CG 3.33Å; K710-Q714 PolarHBondContact O-N 3.15Å
711	I	79.3	Confident	72.3	Confident	89 Å²	89	115.5 Å²	115.5	46%	0.456	53%	0.528	S	S	.	.	H	α-helix	trans	-65.7	-44	174.7	-69.1	168.4	0	0	0	109.5	Q707 E708 E709 E713 Q714 E715	Q707-I711 WeakPolarHBondContact O-CG1 3.5Å; Q707-I711 PolarHBondContact O-N 3.41Å; E708-I711 PolarHBondContact O-N 3.32Å; E709-I711 PolarHBondContact O-N 3.02Å; I711-E713 PolarHBondContact O-N 3.44Å; I711-Q714 CarbonylContact O-C 3.59Å; I711-Q714 WeakPolarHBondContact O-CB 3.5Å; I711-Q714 PolarHBondContact O-N 3.14Å; I711-Q714 VanDerWaalsContact O-N 3.12Å; I711-E715 HydrophobicContact CG2-CG 4.39Å; I711-E715 WeakPolarHBondContact O-CG 3.44Å; I711-E715 PolarHBondContact O-N 2.85Å
712	R	79.8	Confident	72.6	Confident	139 Å²	139	117.8 Å²	117.8	53%	0.525	54%	0.539	S	S	.	.	H	α-helix	trans	-58.3	-46.4	174.7	-97.6	-177.8	-81.6	178.9	-7.9	112.6	E708 E709 Q714 E715 E716	E708-R712 WeakPolarHBondContact O-CB 3.35Å; E708-R712 PolarHBondContact O-N 3.15Å; E709-R712 WeakPolarHBondContact O-CB 3.33Å; E709-R712 PolarHBondContact O-N 3.48Å; R712-Q714 VanDerWaalsContact C-N 3.27Å; R712-Q714 PolarHBondContact O-N 3.08Å; R712-E715 PolarHBondContact O-N 3.24Å; R712-E715 VanDerWaalsContact O-N 3.15Å; R712-E716 PolarHBondContact O-N 3.23Å
713	E	79.4	Confident	72.6	Confident	115 Å²	115	118.3 Å²	118.3	54%	0.537	54%	0.543	S	S	.	.	H	α-helix	trans	-60.1	-37.3	175.1	-71.4	178.1	170.3	0	0	112	E709 I711 M717	E709-E713 WeakPolarHBondContact O-CG 3.48Å; E709-E713 PolarHBondContact O-N 2.72Å; I711-E713 PolarHBondContact O-N 3.44Å; E713-M717 WeakPolarHBondContact O-CB 3.45Å; E713-M717 VanDerWaalsContact O-CG 3.24Å; E713-M717 WeakPolarHBondContact O-CG 3.46Å; E713-M717 PolarHBondContact O-N 2.83Å; E713-M717 VanDerWaalsContact O-N 3.08Å
714	Q	73	Confident	72.6	Confident	136 Å²	136	118 Å²	118	64%	0.636	54%	0.542	S	S	*	.	H	α-helix	trans	-68.8	-38.4	174.1	-77.8	-174.6	-11.5	0	0	112.9	K710 I711 R712 M717 M718	K710-Q714 WeakPolarHBondContact O-CG 3.33Å; K710-Q714 PolarHBondContact O-N 3.15Å; I711-Q714 CarbonylContact O-C 3.59Å; I711-Q714 WeakPolarHBondContact O-CB 3.5Å; I711-Q714 PolarHBondContact O-N 3.14Å; I711-Q714 VanDerWaalsContact O-N 3.12Å; R712-Q714 VanDerWaalsContact C-N 3.27Å; R712-Q714 PolarHBondContact O-N 3.08Å; Q714-M717 PolarHBondContact O-N 3.43Å; Q714-M718 WeakPolarHBondContact O-CG 3.41Å; Q714-M718 PolarHBondContact O-N 2.79Å
715	E	67.1	Low	71.5	Confident	98 Å²	98	118.9 Å²	118.9	46%	0.458	55%	0.545	S	S	.	.	H	α-helix	trans	-64.9	-43.7	175.5	-74.9	178.4	168.3	0	0	111.5	I711 R712 M717 M718 Q719	I711-E715 HydrophobicContact CG2-CG 4.39Å; I711-E715 WeakPolarHBondContact O-CG 3.44Å; I711-E715 PolarHBondContact O-N 2.85Å; R712-E715 PolarHBondContact O-N 3.24Å; R712-E715 VanDerWaalsContact O-N 3.15Å; E715-M717 VanDerWaalsContact C-N 3.34Å; E715-M717 PolarHBondContact O-N 3.17Å; E715-M718 HydrophobicContact CG-CE 4.27Å; E715-M718 PolarHBondContact O-N 3.37Å; E715-Q719 WeakPolarHBondContact O-CG 3.37Å; E715-Q719 PolarHBondContact O-N 3.47Å
716	E	67.8	Low	71.3	Confident	125 Å²	125	113.5 Å²	113.5	58%	0.584	54%	0.536	S	S	*	.	H	α-helix	trans	-61.8	-42.4	174.8	-73.1	-178.1	178.7	0	0	111.4	R712 M718 Q719 E720	R712-E716 PolarHBondContact O-N 3.23Å; E716-M718 VanDerWaalsContact C-N 3.34Å; E716-M718 PolarHBondContact O-N 2.8Å; E716-Q719 PolarHBondContact O-N 2.79Å; E716-E720 PolarHBondContact O-N 2.67Å
717	M	72	Confident	71.2	Confident	123 Å²	123	115.1 Å²	115.1	61%	0.606	54%	0.544	S	S	*	.	H	α-helix	trans	-63.2	-36.8	174.5	-78.3	-75.8	-61.9	0	0	113.2	E713 Q714 E715 Q721	E713-M717 WeakPolarHBondContact O-CB 3.45Å; E713-M717 VanDerWaalsContact O-CG 3.24Å; E713-M717 WeakPolarHBondContact O-CG 3.46Å; E713-M717 PolarHBondContact O-N 2.83Å; E713-M717 VanDerWaalsContact O-N 3.08Å; Q714-M717 PolarHBondContact O-N 3.43Å; E715-M717 VanDerWaalsContact C-N 3.34Å; E715-M717 PolarHBondContact O-N 3.17Å; M717-Q721 WeakPolarHBondContact O-CG 3.41Å; M717-Q721 PolarHBondContact O-N 3.42Å; M717-Q721 VanDerWaalsContact O-N 3.17Å
718	M	56.3	Low	71	Confident	115 Å²	115	115.5 Å²	115.5	57%	0.567	55%	0.546	S	S	*	.	H	α-helix	trans	-68.5	-42.1	173.7	-78.8	-167.8	-58.2	0	0	111.5	Q714 E715 E716 E720 Q721 E722	Q714-M718 WeakPolarHBondContact O-CG 3.41Å; Q714-M718 PolarHBondContact O-N 2.79Å; E715-M718 HydrophobicContact CG-CE 4.27Å; E715-M718 PolarHBondContact O-N 3.37Å; E716-M718 VanDerWaalsContact C-N 3.34Å; E716-M718 PolarHBondContact O-N 2.8Å; M718-E720 VanDerWaalsContact C-N 3.35Å; M718-E720 PolarHBondContact O-N 3.33Å; M718-Q721 CarbonylContact O-C 3.6Å; M718-Q721 WeakPolarHBondContact O-CA 3.45Å; M718-Q721 WeakPolarHBondContact O-CB 3.48Å; M718-Q721 PolarHBondContact O-N 3Å; M718-Q721 VanDerWaalsContact O-N 3.09Å; M718-E722 PolarHBondContact O-N 3.14Å
719	Q	73.1	Confident	70.9	Confident	116 Å²	116	116.3 Å²	116.3	54%	0.542	55%	0.55	S	S	.	.	H	α-helix	trans	-60.8	-43.6	176.2	-75.1	177.4	2.8	0	0	111.4	E715 E716 Q721 E722 E723	E715-Q719 WeakPolarHBondContact O-CG 3.37Å; E715-Q719 PolarHBondContact O-N 3.47Å; E716-Q719 PolarHBondContact O-N 2.79Å; Q719-Q721 VanDerWaalsContact C-N 3.27Å; Q719-Q721 PolarHBondContact O-N 3.5Å; Q719-E722 PolarHBondContact O-N 3.03Å; Q719-E723 PolarHBondContact O-N 3.45Å
720	E	75.4	Confident	71.1	Confident	105 Å²	105	112.8 Å²	112.8	49%	0.491	54%	0.544	S	S	.	.	H	α-helix	trans	-61.4	-35	173.4	-83.7	-161.2	-176.7	0	0	113	E716 M718 K724	E716-E720 PolarHBondContact O-N 2.67Å; M718-E720 VanDerWaalsContact C-N 3.35Å; M718-E720 PolarHBondContact O-N 3.33Å; E720-K724 WeakPolarHBondContact O-CB 3.44Å; E720-K724 WeakPolarHBondContact O-CD 3.37Å; E720-K724 VanDerWaalsContact O-CG 3.27Å; E720-K724 WeakPolarHBondContact O-CG 3.26Å; E720-K724 PolarHBondContact O-N 2.82Å; E720-K724 VanDerWaalsContact O-N 3.12Å; E720-K724 IonicContact OE2-NZ 2.95Å; E720-K724 PolarHBondContact OE2-NZ 3.32Å
721	Q	68.2	Low	71	Confident	129 Å²	129	112.8 Å²	112.8	60%	0.603	54%	0.544	S	S	*	.	H	α-helix	trans	-69.1	-41.8	174.5	-80.4	-112.5	-7.9	0	0	111.6	M717 M718 Q719 K724 M725	M717-Q721 WeakPolarHBondContact O-CG 3.41Å; M717-Q721 PolarHBondContact O-N 3.42Å; M717-Q721 VanDerWaalsContact O-N 3.17Å; M718-Q721 CarbonylContact O-C 3.6Å; M718-Q721 WeakPolarHBondContact O-CA 3.45Å; M718-Q721 WeakPolarHBondContact O-CB 3.48Å; M718-Q721 PolarHBondContact O-N 3Å; M718-Q721 VanDerWaalsContact O-N 3.09Å; Q719-Q721 VanDerWaalsContact C-N 3.27Å; Q719-Q721 PolarHBondContact O-N 3.5Å; Q721-K724 PolarHBondContact O-N 3.29Å; Q721-M725 WeakPolarHBondContact O-CG 3.49Å; Q721-M725 PolarHBondContact O-N 2.98Å
722	E	65.9	Low	69.5	Low	137 Å²	137	114.3 Å²	114.3	64%	0.64	55%	0.551	S	S	*	*	H	α-helix	trans	-62.5	-43.1	175.3	-76.1	-176.5	168.3	0	0	111.5	M718 Q719 K724 M725 G726	M718-E722 PolarHBondContact O-N 3.14Å; Q719-E722 PolarHBondContact O-N 3.03Å; E722-K724 PolarHBondContact O-N 3.48Å; E722-M725 PolarHBondContact O-N 3.43Å; E722-G726 PolarHBondContact O-N 3.34Å
723	E	73	Confident	68.9	Low	143 Å²	143	111.4 Å²	111.4	67%	0.668	55%	0.551	S	S	*	*	H	α-helix	trans	-61.7	-43.3	174.7	-74.8	-172	166.5	0	0	111.7	Q719 M725 G726 E727	Q719-E723 PolarHBondContact O-N 3.45Å; E723-M725 VanDerWaalsContact C-N 3.34Å; E723-M725 PolarHBondContact O-N 3.26Å; E723-G726 PolarHBondContact O-N 2.81Å; E723-E727 PolarHBondContact O-N 2.74Å
724	K	77.1	Confident	68.7	Low	120 Å²	120	111.9 Å²	111.9	52%	0.522	55%	0.553	S	S	.	*	H	α-helix	trans	-62.9	-39.4	175.7	-76.3	166.6	-172.6	144.8	0	112.2	E720 Q721 E722 Q728	E720-K724 WeakPolarHBondContact O-CB 3.44Å; E720-K724 WeakPolarHBondContact O-CD 3.37Å; E720-K724 VanDerWaalsContact O-CG 3.27Å; E720-K724 WeakPolarHBondContact O-CG 3.26Å; E720-K724 PolarHBondContact O-N 2.82Å; E720-K724 VanDerWaalsContact O-N 3.12Å; E720-K724 IonicContact OE2-NZ 2.95Å; E720-K724 PolarHBondContact OE2-NZ 3.32Å; Q721-K724 PolarHBondContact O-N 3.29Å; E722-K724 PolarHBondContact O-N 3.48Å; K724-Q728 PolarHBondContact O-N 3.2Å; K724-Q728 VanDerWaalsContact O-N 3.11Å
725	M	53.7	Low	68.8	Low	106 Å²	106	112 Å²	112	52%	0.522	55%	0.554	S	S	.	*	H	α-helix	trans	-65.4	-44.1	173.5	-70.5	-129	-58.3	0	0	111.1	Q721 E722 E723 E727 Q728 E729	Q721-M725 WeakPolarHBondContact O-CG 3.49Å; Q721-M725 PolarHBondContact O-N 2.98Å; E722-M725 PolarHBondContact O-N 3.43Å; E723-M725 VanDerWaalsContact C-N 3.34Å; E723-M725 PolarHBondContact O-N 3.26Å; M725-E727 VanDerWaalsContact C-N 3.33Å; M725-E727 PolarHBondContact O-N 3.45Å; M725-Q728 CarbonylContact O-C 3.58Å; M725-Q728 WeakPolarHBondContact O-CA 3.43Å; M725-Q728 WeakPolarHBondContact O-CB 3.36Å; M725-Q728 PolarHBondContact O-N 3.29Å; M725-E729 WeakPolarHBondContact O-CG 3.43Å; M725-E729 PolarHBondContact O-N 3.11Å
726	G	72.7	Confident	69.1	Low	37 Å²	37	112.6 Å²	112.6	38%	0.381	56%	0.557	S	S	.	*	H	α-helix	trans	-59.3	-40.6	176.1	0	0	0	0	0	112.8	E722 E723 Q728 E729 G730	E722-G726 PolarHBondContact O-N 3.34Å; E723-G726 PolarHBondContact O-N 2.81Å; G726-Q728 VanDerWaalsContact C-N 3.31Å; G726-Q728 PolarHBondContact O-N 2.81Å; G726-E729 PolarHBondContact O-N 3.25Å; G726-G730 PolarHBondContact O-N 3.35Å
727	E	77.1	Confident	69.7	Low	123 Å²	123	109.3 Å²	109.3	58%	0.575	55%	0.55	S	S	*	*	H	α-helix	trans	-63.8	-36	171.8	-74.3	-170.1	179.3	0	0	112.8	E723 M725 K731	E723-E727 PolarHBondContact O-N 2.74Å; M725-E727 VanDerWaalsContact C-N 3.33Å; M725-E727 PolarHBondContact O-N 3.45Å; E727-K731 WeakPolarHBondContact O-CG 3.45Å; E727-K731 PolarHBondContact O-N 3.31Å; E727-K731 VanDerWaalsContact O-N 3.11Å; E727-K731 IonicContact OE2-NZ 3.35Å
728	Q	69	Low	70.1	Confident	133 Å²	133	109.3 Å²	109.3	62%	0.621	55%	0.547	S	S	*	.	H	α-helix	trans	-71.6	-41.5	178.7	-134.9	178.5	10.5	0	0	111.4	K724 M725 G726 K731 M732	K724-Q728 PolarHBondContact O-N 3.2Å; K724-Q728 VanDerWaalsContact O-N 3.11Å; M725-Q728 CarbonylContact O-C 3.58Å; M725-Q728 WeakPolarHBondContact O-CA 3.43Å; M725-Q728 WeakPolarHBondContact O-CB 3.36Å; M725-Q728 PolarHBondContact O-N 3.29Å; G726-Q728 VanDerWaalsContact C-N 3.31Å; G726-Q728 PolarHBondContact O-N 2.81Å; Q728-K731 PolarHBondContact O-N 3.48Å; Q728-M732 PolarHBondContact O-N 2.92Å
729	E	62	Low	70.7	Confident	112 Å²	112	109.2 Å²	109.2	52%	0.523	55%	0.547	S	S	.	.	H	α-helix	trans	-60.8	-45.4	171.6	-73.3	-177.8	168.6	0	0	110.8	M725 G726 K731 M732 C733	M725-E729 WeakPolarHBondContact O-CG 3.43Å; M725-E729 PolarHBondContact O-N 3.11Å; G726-E729 PolarHBondContact O-N 3.25Å; E729-K731 VanDerWaalsContact C-N 3.31Å; E729-K731 PolarHBondContact O-N 2.89Å; E729-M732 WeakPolarHBondContact O-CA 3.27Å; E729-M732 WeakPolarHBondContact O-CB 3.44Å; E729-M732 PolarHBondContact O-N 3.47Å; E729-C733 PolarHBondContact O-N 3.3Å; E729-C733 PolarHBondContact O-SG 2.8Å; E729-C733 VanDerWaalsContact O-SG 3.33Å
730	G	73.6	Confident	70.8	Confident	41 Å²	41	109.1 Å²	109.1	42%	0.423	55%	0.546	S	S	.	.	H	α-helix	trans	-57.6	-41.2	175.3	0	0	0	0	0	113	G726 C733 E734	G726-G730 PolarHBondContact O-N 3.35Å; G730-C733 PolarHBondContact O-N 3.27Å; G730-E734 PolarHBondContact O-N 2.94Å
731	K	74.9	Confident	71	Confident	126 Å²	126	109 Å²	109	55%	0.548	55%	0.546	S	S	.	.	H	α-helix	trans	-65.6	-38.3	174.3	-72.4	164.5	-172.3	154.2	0	112.4	E727 Q728 E729 Q735	E727-K731 WeakPolarHBondContact O-CG 3.45Å; E727-K731 PolarHBondContact O-N 3.31Å; E727-K731 VanDerWaalsContact O-N 3.11Å; E727-K731 IonicContact OE2-NZ 3.35Å; Q728-K731 PolarHBondContact O-N 3.48Å; E729-K731 VanDerWaalsContact C-N 3.31Å; E729-K731 PolarHBondContact O-N 2.89Å; K731-Q735 PolarHBondContact O-N 3.47Å; K731-Q735 VanDerWaalsContact O-N 3.08Å
732	M	47.8	Very low	71.4	Confident	122 Å²	122	108.7 Å²	108.7	60%	0.601	54%	0.544	S	S	*	.	H	α-helix	trans	-65.1	-45.4	173.9	-74	-146.9	-57.2	0	0	111.5	Q728 E729 E734 Q735 E736	Q728-M732 PolarHBondContact O-N 2.92Å; E729-M732 WeakPolarHBondContact O-CA 3.27Å; E729-M732 WeakPolarHBondContact O-CB 3.44Å; E729-M732 PolarHBondContact O-N 3.47Å; M732-E734 VanDerWaalsContact C-N 3.29Å; M732-E734 PolarHBondContact O-N 3.38Å; M732-Q735 CarbonylContact O-C 3.55Å; M732-Q735 WeakPolarHBondContact O-CA 3.36Å; M732-Q735 WeakPolarHBondContact O-CB 3.44Å; M732-Q735 PolarHBondContact O-N 3.34Å; M732-E736 WeakPolarHBondContact O-CB 3.38Å; M732-E736 PolarHBondContact O-N 2.98Å
733	C	67.3	Low	72.1	Confident	77 Å²	77	108.1 Å²	108.1	52%	0.52	54%	0.542	S	S	.	.	H	α-helix	trans	-59.2	-40.5	177	-67.8	0	0	0	0	111.6	E729 G730 Q735 E736 A737	E729-C733 PolarHBondContact O-N 3.3Å; E729-C733 PolarHBondContact O-SG 2.8Å; E729-C733 VanDerWaalsContact O-SG 3.33Å; G730-C733 PolarHBondContact O-N 3.27Å; C733-Q735 VanDerWaalsContact C-N 3.34Å; C733-Q735 PolarHBondContact O-N 3.24Å; C733-E736 PolarHBondContact O-N 2.91Å; C733-A737 WeakPolarHBondContact O-CB 3.45Å; C733-A737 PolarHBondContact O-N 3.42Å
734	E	76.2	Confident	72.4	Confident	125 Å²	125	106.1 Å²	106.1	58%	0.584	53%	0.532	S	S	*	.	H	α-helix	trans	-62.8	-38.5	172.2	-98.4	-167	-179.9	0	0	113	G730 M732 K738	G730-E734 PolarHBondContact O-N 2.94Å; M732-E734 VanDerWaalsContact C-N 3.29Å; M732-E734 PolarHBondContact O-N 3.38Å; E734-K738 WeakPolarHBondContact O-CG 3.32Å; E734-K738 PolarHBondContact O-N 2.89Å; E734-K738 VanDerWaalsContact O-N 3.13Å; E734-K738 IonicContact OE2-NZ 3.99Å
735	Q	73.5	Confident	72.6	Confident	139 Å²	139	105 Å²	105	65%	0.65	53%	0.528	S	S	*	.	H	α-helix	trans	-67	-41.7	175.4	-109	-174.1	-9.7	0	0	111.8	K731 M732 C733 K738 M739	K731-Q735 PolarHBondContact O-N 3.47Å; K731-Q735 VanDerWaalsContact O-N 3.08Å; M732-Q735 CarbonylContact O-C 3.55Å; M732-Q735 WeakPolarHBondContact O-CA 3.36Å; M732-Q735 WeakPolarHBondContact O-CB 3.44Å; M732-Q735 PolarHBondContact O-N 3.34Å; C733-Q735 VanDerWaalsContact C-N 3.34Å; C733-Q735 PolarHBondContact O-N 3.24Å; Q735-K738 PolarHBondContact O-N 2.86Å; Q735-M739 PolarHBondContact O-N 2.9Å
736	E	75.2	Confident	73.3	Confident	111 Å²	111	105 Å²	105	52%	0.519	53%	0.527	S	S	.	.	H	α-helix	trans	-64.6	-44	177.6	-167.6	173.3	-169.5	0	0	111	M732 C733 K738 M739 Q740	M732-E736 WeakPolarHBondContact O-CB 3.38Å; M732-E736 PolarHBondContact O-N 2.98Å; C733-E736 PolarHBondContact O-N 2.91Å; E736-K738 VanDerWaalsContact C-N 3.35Å; E736-K738 PolarHBondContact O-N 2.95Å; E736-M739 CarbonylContact O-C 3.6Å; E736-M739 WeakPolarHBondContact O-CA 3.43Å; E736-M739 WeakPolarHBondContact O-CB 3.41Å; E736-M739 PolarHBondContact O-N 3.38Å; E736-Q740 PolarHBondContact O-N 3.11Å
737	A	79.2	Confident	74	Confident	55 Å²	55	111.2 Å²	111.2	46%	0.455	54%	0.539	S	S	.	.	H	α-helix	trans	-60	-42.2	174.5	0	0	0	0	0	112.3	C733 M739 Q740 E741	C733-A737 WeakPolarHBondContact O-CB 3.45Å; C733-A737 PolarHBondContact O-N 3.42Å; A737-M739 VanDerWaalsContact C-N 3.28Å; A737-M739 PolarHBondContact O-N 3.09Å; A737-Q740 PolarHBondContact O-N 3.12Å; A737-E741 PolarHBondContact O-N 2.9Å
738	K	81.8	Confident	74.3	Confident	123 Å²	123	111.9 Å²	111.9	54%	0.535	54%	0.536	S	S	.	.	H	α-helix	trans	-63.7	-34.7	174.2	-74.6	167.8	-176.2	156.6	0	112.2	E734 Q735 E736 Q742	E734-K738 WeakPolarHBondContact O-CG 3.32Å; E734-K738 PolarHBondContact O-N 2.89Å; E734-K738 VanDerWaalsContact O-N 3.13Å; E734-K738 IonicContact OE2-NZ 3.99Å; Q735-K738 PolarHBondContact O-N 2.86Å; E736-K738 VanDerWaalsContact C-N 3.35Å; E736-K738 PolarHBondContact O-N 2.95Å; K738-Q742 WeakPolarHBondContact O-CG 3.32Å; K738-Q742 PolarHBondContact O-N 3.17Å; K738-Q742 VanDerWaalsContact O-N 3.14Å
739	M	67.4	Low	74.6	Confident	114 Å²	114	111.3 Å²	111.3	56%	0.562	53%	0.534	S	S	*	.	H	α-helix	trans	-70.9	-44.4	177.2	-149.6	-175.1	-32	0	0	111.1	Q735 E736 A737 E741 Q742 E743	Q735-M739 PolarHBondContact O-N 2.9Å; E736-M739 CarbonylContact O-C 3.6Å; E736-M739 WeakPolarHBondContact O-CA 3.43Å; E736-M739 WeakPolarHBondContact O-CB 3.41Å; E736-M739 PolarHBondContact O-N 3.38Å; A737-M739 VanDerWaalsContact C-N 3.28Å; A737-M739 PolarHBondContact O-N 3.09Å; M739-E741 VanDerWaalsContact C-N 3.32Å; M739-E741 PolarHBondContact O-N 3.27Å; M739-Q742 CarbonylContact O-C 3.55Å; M739-Q742 WeakPolarHBondContact O-CB 3.43Å; M739-Q742 PolarHBondContact O-N 3.37Å; M739-Q742 VanDerWaalsContact O-N 3.15Å; M739-E743 PolarHBondContact O-N 3.47Å
740	Q	75.7	Confident	75.4	Confident	114 Å²	114	109.9 Å²	109.9	53%	0.533	53%	0.527	S	S	.	.	H	α-helix	trans	-60.9	-40.4	174.3	-74	-174.9	-9.9	0	0	111.8	E736 A737 Q742 E743 E744	E736-Q740 PolarHBondContact O-N 3.11Å; A737-Q740 PolarHBondContact O-N 3.12Å; Q740-Q742 VanDerWaalsContact C-N 3.32Å; Q740-Q742 PolarHBondContact O-N 3.35Å; Q740-E743 PolarHBondContact O-N 3.18Å; Q740-E744 PolarHBondContact O-N 2.91Å
741	E	80.6	Confident	75.7	Confident	101 Å²	101	112.9 Å²	112.9	47%	0.472	53%	0.53	S	S	.	.	H	α-helix	trans	-64	-37.8	175.3	-161.5	-159.6	148.7	0	0	112	A737 M739 K745	A737-E741 PolarHBondContact O-N 2.9Å; M739-E741 VanDerWaalsContact C-N 3.32Å; M739-E741 PolarHBondContact O-N 3.27Å; E741-K745 WeakPolarHBondContact O-CG 3.21Å; E741-K745 PolarHBondContact O-N 3.02Å; E741-K745 VanDerWaalsContact O-N 3.08Å; E741-K745 VanDerWaalsContact OE1-CE 3.26Å; E741-K745 WeakPolarHBondContact OE1-CE 3.22Å; E741-K745 IonicContact OE1-NZ 2.93Å; E741-K745 PolarHBondContact OE1-NZ 2.81Å
742	Q	76.4	Confident	76	Confident	124 Å²	124	113.5 Å²	113.5	58%	0.579	53%	0.533	S	S	*	.	H	α-helix	trans	-65.6	-42.8	172.3	-79.3	-87.8	-6	0	0	111.7	K738 M739 Q740 K745 M746	K738-Q742 WeakPolarHBondContact O-CG 3.32Å; K738-Q742 PolarHBondContact O-N 3.17Å; K738-Q742 VanDerWaalsContact O-N 3.14Å; M739-Q742 CarbonylContact O-C 3.55Å; M739-Q742 WeakPolarHBondContact O-CB 3.43Å; M739-Q742 PolarHBondContact O-N 3.37Å; M739-Q742 VanDerWaalsContact O-N 3.15Å; Q740-Q742 VanDerWaalsContact C-N 3.32Å; Q740-Q742 PolarHBondContact O-N 3.35Å; Q742-K745 PolarHBondContact O-N 3.24Å; Q742-M746 PolarHBondContact O-N 3.07Å
743	E	80	Confident	77.7	Confident	125 Å²	125	112 Å²	112	58%	0.584	53%	0.526	S	S	*	.	H	α-helix	trans	-62.3	-42.1	175.3	-76.8	-172.5	162.7	0	0	111.9	M739 Q740 K745 M746 R747	M739-E743 PolarHBondContact O-N 3.47Å; Q740-E743 PolarHBondContact O-N 3.18Å; E743-K745 VanDerWaalsContact C-N 3.35Å; E743-K745 PolarHBondContact O-N 3.42Å; E743-M746 WeakPolarHBondContact O-CB 3.42Å; E743-M746 PolarHBondContact O-N 2.95Å; E743-R747 WeakPolarHBondContact O-CB 3.42Å; E743-R747 PolarHBondContact O-N 3.03Å
744	E	79.4	Confident	78.5	Confident	101 Å²	101	115 Å²	115	47%	0.472	53%	0.527	S	S	.	.	H	α-helix	trans	-62.7	-40.8	174.1	-80.3	-158.1	162.8	0	0	112.3	Q740 M746 R747 R748	Q740-E744 PolarHBondContact O-N 2.91Å; E744-M746 VanDerWaalsContact C-N 3.34Å; E744-R747 PolarHBondContact O-N 3.42Å; E744-R748 WeakPolarHBondContact O-CG 3.28Å; E744-R748 PolarHBondContact O-N 3.43Å; E744-R748 IonicContact OE2-CZ 2.81Å; E744-R748 IonicContact OE2-NH1 3.17Å; E744-R748 IonicContact OE2-NH2 3.84Å; E744-R748 PolarHBondContact OE2-NH2 3.45Å
745	K	81.5	Confident	78.7	Confident	97 Å²	97	115.1 Å²	115.1	42%	0.422	53%	0.527	S	S	.	.	H	α-helix	trans	-61.9	-43.8	175.8	-77.8	172.7	-174	161.6	0	111.1	E741 Q742 E743 R748 Q749	E741-K745 WeakPolarHBondContact O-CG 3.21Å; E741-K745 PolarHBondContact O-N 3.02Å; E741-K745 VanDerWaalsContact O-N 3.08Å; E741-K745 VanDerWaalsContact OE1-CE 3.26Å; E741-K745 WeakPolarHBondContact OE1-CE 3.22Å; E741-K745 IonicContact OE1-NZ 2.93Å; E741-K745 PolarHBondContact OE1-NZ 2.81Å; Q742-K745 PolarHBondContact O-N 3.24Å; E743-K745 VanDerWaalsContact C-N 3.35Å; E743-K745 PolarHBondContact O-N 3.42Å; K745-R748 PolarHBondContact O-N 3.46Å; K745-Q749 WeakPolarHBondContact O-CG 3.5Å; K745-Q749 PolarHBondContact O-N 3.22Å
746	M	68.7	Low	79	Confident	105 Å²	105	114.4 Å²	114.4	52%	0.517	52%	0.524	S	S	.	.	H	α-helix	trans	-60	-47	172.7	-81.9	-79.4	-66.3	0	0	111.4	Q742 E743 E744 R748 Q749 E750	Q742-M746 PolarHBondContact O-N 3.07Å; E743-M746 WeakPolarHBondContact O-CB 3.42Å; E743-M746 PolarHBondContact O-N 2.95Å; E744-M746 VanDerWaalsContact C-N 3.34Å; M746-R748 PolarHBondContact O-N 3.36Å; M746-Q749 CarbonylContact O-C 3.55Å; M746-Q749 WeakPolarHBondContact O-CA 3.47Å; M746-Q749 WeakPolarHBondContact O-CB 3.37Å; M746-Q749 PolarHBondContact O-N 3.24Å; M746-Q749 VanDerWaalsContact O-N 3.07Å; M746-E750 PolarHBondContact O-N 3.49Å
747	R	86.8	Confident	79.4	Confident	167 Å²	167	113.3 Å²	113.3	63%	0.63	52%	0.519	S	S	*	.	H	α-helix	trans	-58.2	-45.6	177.1	-115.8	177.9	171.6	-108.6	3.6	112.6	E743 E744 Q749 E750 E751	E743-R747 WeakPolarHBondContact O-CB 3.42Å; E743-R747 PolarHBondContact O-N 3.03Å; E744-R747 PolarHBondContact O-N 3.42Å; R747-Q749 VanDerWaalsContact C-N 3.28Å; R747-Q749 PolarHBondContact O-N 3.45Å; R747-E750 WeakPolarHBondContact O-CB 3.31Å; R747-E750 PolarHBondContact O-N 2.87Å; R747-E751 PolarHBondContact O-N 3.39Å
748	R	82.7	Confident	79.6	Confident	137 Å²	137	116.9 Å²	116.9	52%	0.517	52%	0.524	S	S	.	.	H	α-helix	trans	-64.8	-32.8	176	-70.9	179.7	-170.8	129.2	12.9	111.9	E744 K745 M746 K752	E744-R748 WeakPolarHBondContact O-CG 3.28Å; E744-R748 PolarHBondContact O-N 3.43Å; E744-R748 IonicContact OE2-CZ 2.81Å; E744-R748 IonicContact OE2-NH1 3.17Å; E744-R748 IonicContact OE2-NH2 3.84Å; E744-R748 PolarHBondContact OE2-NH2 3.45Å; K745-R748 PolarHBondContact O-N 3.46Å; M746-R748 PolarHBondContact O-N 3.36Å; R748-K752 WeakPolarHBondContact O-CG 3.47Å; R748-K752 PolarHBondContact O-N 3.02Å
749	Q	76.8	Confident	79.6	Confident	122 Å²	122	117.1 Å²	117.1	57%	0.57	53%	0.525	S	S	*	.	H	α-helix	trans	-70.1	-43.3	172.2	-76.7	-174.8	-7.7	0	0	111.8	K745 M746 R747 E751 K752 I753	K745-Q749 WeakPolarHBondContact O-CG 3.5Å; K745-Q749 PolarHBondContact O-N 3.22Å; M746-Q749 CarbonylContact O-C 3.55Å; M746-Q749 WeakPolarHBondContact O-CA 3.47Å; M746-Q749 WeakPolarHBondContact O-CB 3.37Å; M746-Q749 PolarHBondContact O-N 3.24Å; M746-Q749 VanDerWaalsContact O-N 3.07Å; R747-Q749 VanDerWaalsContact C-N 3.28Å; R747-Q749 PolarHBondContact O-N 3.45Å; Q749-E751 VanDerWaalsContact C-N 3.33Å; Q749-E751 PolarHBondContact O-N 3.22Å; Q749-K752 PolarHBondContact O-N 3.25Å; Q749-I753 WeakPolarHBondContact O-CG1 3.36Å; Q749-I753 PolarHBondContact O-N 3.43Å
750	E	77.9	Confident	80.4	Confident	82 Å²	82	115.9 Å²	115.9	38%	0.383	52%	0.52	S	S	.	.	H	α-helix	trans	-59.6	-41.2	174.4	-75.7	-172.2	-177.2	0	0	112.2	M746 R747 I753 R754	M746-E750 PolarHBondContact O-N 3.49Å; R747-E750 WeakPolarHBondContact O-CB 3.31Å; R747-E750 PolarHBondContact O-N 2.87Å; E750-I753 PolarHBondContact O-N 2.88Å; E750-R754 WeakPolarHBondContact O-CG 3.38Å; E750-R754 PolarHBondContact O-N 3.25Å; E750-R754 IonicContact OE2-CZ 3.84Å; E750-R754 IonicContact OE2-NH2 2.85Å; E750-R754 PolarHBondContact OE2-NH2 2.98Å
751	E	80	Confident	80.8	Confident	103 Å²	103	117.5 Å²	117.5	48%	0.481	52%	0.521	S	S	.	.	H	α-helix	trans	-63.3	-41.8	176.1	-78.9	-179.5	169.7	0	0	112.1	R747 Q749 I753 R754 E755	R747-E751 PolarHBondContact O-N 3.39Å; Q749-E751 VanDerWaalsContact C-N 3.33Å; Q749-E751 PolarHBondContact O-N 3.22Å; E751-I753 VanDerWaalsContact C-N 3.31Å; E751-I753 PolarHBondContact O-N 2.83Å; E751-R754 PolarHBondContact O-N 2.98Å; E751-E755 PolarHBondContact O-N 2.88Å
752	K	81.5	Confident	80.9	Confident	140 Å²	140	117 Å²	117	61%	0.609	52%	0.519	S	S	*	.	H	α-helix	trans	-61.7	-39.7	173.8	-73.4	175.6	-178.3	-178.6	0	112	R748 Q749 E755 Q756	R748-K752 WeakPolarHBondContact O-CG 3.47Å; R748-K752 PolarHBondContact O-N 3.02Å; Q749-K752 PolarHBondContact O-N 3.25Å; K752-E755 PolarHBondContact O-N 3.35Å; K752-Q756 WeakPolarHBondContact O-CG 3.42Å; K752-Q756 PolarHBondContact O-N 3.23Å
753	I	83.4	Confident	81	Confident	90 Å²	90	117.1 Å²	117.1	46%	0.462	52%	0.52	S	S	.	.	H	α-helix	trans	-64.9	-45.9	174.8	-67	168	0	0	0	110	Q749 E750 E751 E755 Q756 E757	Q749-I753 WeakPolarHBondContact O-CG1 3.36Å; Q749-I753 PolarHBondContact O-N 3.43Å; E750-I753 PolarHBondContact O-N 2.88Å; E751-I753 VanDerWaalsContact C-N 3.31Å; E751-I753 PolarHBondContact O-N 2.83Å; I753-E755 VanDerWaalsContact C-N 3.33Å; I753-E755 PolarHBondContact O-N 3.41Å; I753-Q756 CarbonylContact O-C 3.55Å; I753-Q756 WeakPolarHBondContact O-CB 3.42Å; I753-Q756 PolarHBondContact O-N 2.93Å; I753-Q756 VanDerWaalsContact O-N 3.11Å; I753-E757 HydrophobicContact CG2-CG 4.37Å; I753-E757 WeakPolarHBondContact O-CG 3.48Å; I753-E757 PolarHBondContact O-N 3.43Å
754	R	83.5	Confident	81.1	Confident	139 Å²	139	115.7 Å²	115.7	53%	0.525	51%	0.513	S	S	.	.	H	α-helix	trans	-59.9	-40.3	176.7	-75.2	-177.9	-167.7	123.3	15.1	112.6	E750 E751 E757 K758	E750-R754 WeakPolarHBondContact O-CG 3.38Å; E750-R754 PolarHBondContact O-N 3.25Å; E750-R754 IonicContact OE2-CZ 3.84Å; E750-R754 IonicContact OE2-NH2 2.85Å; E750-R754 PolarHBondContact OE2-NH2 2.98Å; E751-R754 PolarHBondContact O-N 2.98Å; R754-E757 PolarHBondContact O-N 2.79Å; R754-K758 WeakPolarHBondContact O-CB 3.47Å; R754-K758 PolarHBondContact O-N 3.11Å
755	E	82.1	Confident	81.2	Confident	128 Å²	128	116.2 Å²	116.2	60%	0.598	52%	0.515	S	S	*	.	H	α-helix	trans	-65.2	-40.4	174	-80.4	-169.3	159.5	0	0	112.2	E751 K752 I753 K758 K759	E751-E755 PolarHBondContact O-N 2.88Å; K752-E755 PolarHBondContact O-N 3.35Å; I753-E755 VanDerWaalsContact C-N 3.33Å; I753-E755 PolarHBondContact O-N 3.41Å; E755-K758 PolarHBondContact O-N 3.06Å; E755-K759 WeakPolarHBondContact O-CG 3.47Å; E755-K759 PolarHBondContact O-N 3.37Å
756	Q	79.8	Confident	81.2	Confident	125 Å²	125	118 Å²	118	58%	0.584	52%	0.523	S	S	*	.	H	α-helix	trans	-64.4	-43.6	174.1	-75.1	-176.5	-11.2	0	0	111.6	K752 I753 K758 K759 I760	K752-Q756 WeakPolarHBondContact O-CG 3.42Å; K752-Q756 PolarHBondContact O-N 3.23Å; I753-Q756 CarbonylContact O-C 3.55Å; I753-Q756 WeakPolarHBondContact O-CB 3.42Å; I753-Q756 PolarHBondContact O-N 2.93Å; I753-Q756 VanDerWaalsContact O-N 3.11Å; Q756-K758 VanDerWaalsContact C-N 3.3Å; Q756-K758 PolarHBondContact O-N 2.86Å; Q756-K759 PolarHBondContact O-N 3.4Å; Q756-I760 WeakPolarHBondContact O-CG1 3.43Å; Q756-I760 PolarHBondContact O-N 2.89Å
757	E	82.4	Confident	81.9	Confident	88 Å²	88	117.3 Å²	117.3	41%	0.411	52%	0.52	S	S	.	.	H	α-helix	trans	-59.3	-40.6	173.9	-76.3	-176.1	-178.5	0	0	111.9	I753 R754 I760 R761	I753-E757 HydrophobicContact CG2-CG 4.37Å; I753-E757 WeakPolarHBondContact O-CG 3.48Å; I753-E757 PolarHBondContact O-N 3.43Å; R754-E757 PolarHBondContact O-N 2.79Å; E757-I760 PolarHBondContact O-N 3.01Å; E757-R761 WeakPolarHBondContact O-CG 3.4Å; E757-R761 PolarHBondContact O-N 3.22Å; E757-R761 IonicContact OE2-NH2 2.75Å; E757-R761 PolarHBondContact OE2-NH2 3.31Å
758	K	83.2	Confident	81.9	Confident	130 Å²	130	115.4 Å²	115.4	57%	0.565	51%	0.513	S	S	*	.	H	α-helix	trans	-63.6	-43.3	176.8	-168.8	-179.1	175.2	-172.3	0	111.4	R754 E755 Q756 I760 R761 E762	R754-K758 WeakPolarHBondContact O-CB 3.47Å; R754-K758 PolarHBondContact O-N 3.11Å; E755-K758 PolarHBondContact O-N 3.06Å; Q756-K758 VanDerWaalsContact C-N 3.3Å; Q756-K758 PolarHBondContact O-N 2.86Å; K758-I760 VanDerWaalsContact C-N 3.33Å; K758-I760 PolarHBondContact O-N 2.94Å; K758-R761 PolarHBondContact O-N 3.47Å; K758-E762 WeakPolarHBondContact CE-OE1 3.45Å; K758-E762 WeakPolarHBondContact O-CG 3.45Å; K758-E762 PolarHBondContact O-N 2.93Å
759	K	82.3	Confident	81.9	Confident	127 Å²	127	114.6 Å²	114.6	55%	0.552	52%	0.515	S	S	*	.	H	α-helix	trans	-63.1	-38.4	175	-72.4	174.3	-178.9	171.6	0	112.3	E755 Q756 Q763	E755-K759 WeakPolarHBondContact O-CG 3.47Å; E755-K759 PolarHBondContact O-N 3.37Å; Q756-K759 PolarHBondContact O-N 3.4Å; K759-Q763 WeakPolarHBondContact O-CG 3.47Å; K759-Q763 PolarHBondContact O-N 3.27Å
760	I	83.8	Confident	81.9	Confident	88 Å²	88	115.4 Å²	115.4	45%	0.451	52%	0.519	S	S	.	.	H	α-helix	trans	-64.3	-46.7	174.3	-68.3	167.7	0	0	0	110.1	Q756 E757 K758 E762 Q763 E764	Q756-I760 WeakPolarHBondContact O-CG1 3.43Å; Q756-I760 PolarHBondContact O-N 2.89Å; E757-I760 PolarHBondContact O-N 3.01Å; K758-I760 VanDerWaalsContact C-N 3.33Å; K758-I760 PolarHBondContact O-N 2.94Å; I760-E762 VanDerWaalsContact C-N 3.34Å; I760-E762 PolarHBondContact O-N 3.26Å; I760-Q763 CarbonylContact O-C 3.59Å; I760-Q763 WeakPolarHBondContact O-CA 3.42Å; I760-Q763 WeakPolarHBondContact O-CB 3.39Å; I760-Q763 PolarHBondContact O-N 2.88Å; I760-E764 HydrophobicContact CG2-CG 4.22Å; I760-E764 WeakPolarHBondContact O-CG 3.38Å; I760-E764 PolarHBondContact O-N 3.28Å
761	R	85.1	Confident	81.9	Confident	148 Å²	148	116.1 Å²	116.1	56%	0.558	52%	0.523	S	S	*	.	H	α-helix	trans	-59.8	-42.2	176.6	-74.2	-177.2	-140.8	160.2	7.3	112.8	E757 K758 Q763 E764 E765	E757-R761 WeakPolarHBondContact O-CG 3.4Å; E757-R761 PolarHBondContact O-N 3.22Å; E757-R761 IonicContact OE2-NH2 2.75Å; E757-R761 PolarHBondContact OE2-NH2 3.31Å; K758-R761 PolarHBondContact O-N 3.47Å; R761-Q763 VanDerWaalsContact C-N 3.28Å; R761-Q763 PolarHBondContact O-N 2.91Å; R761-E764 PolarHBondContact O-N 3.31Å; R761-E765 PolarHBondContact O-N 3Å
762	E	82.1	Confident	81.9	Confident	91 Å²	91	117 Å²	117	43%	0.425	53%	0.527	S	S	.	.	H	α-helix	trans	-64.5	-33.1	175.3	-73.5	172.4	-169.2	0	0	111.9	K758 I760 K766	K758-E762 WeakPolarHBondContact CE-OE1 3.45Å; K758-E762 WeakPolarHBondContact O-CG 3.45Å; K758-E762 PolarHBondContact O-N 2.93Å; I760-E762 VanDerWaalsContact C-N 3.34Å; I760-E762 PolarHBondContact O-N 3.26Å; E762-K766 WeakPolarHBondContact O-CG 3.36Å; E762-K766 PolarHBondContact O-N 3.06Å
763	Q	78.4	Confident	81.9	Confident	127 Å²	127	116.3 Å²	116.3	59%	0.593	53%	0.527	S	S	*	.	H	α-helix	trans	-72	-41.1	171.8	-75.9	-175.5	-15.5	0	0	112.2	K759 I760 R761 K766 I767	K759-Q763 WeakPolarHBondContact O-CG 3.47Å; K759-Q763 PolarHBondContact O-N 3.27Å; I760-Q763 CarbonylContact O-C 3.59Å; I760-Q763 WeakPolarHBondContact O-CA 3.42Å; I760-Q763 WeakPolarHBondContact O-CB 3.39Å; I760-Q763 PolarHBondContact O-N 2.88Å; R761-Q763 VanDerWaalsContact C-N 3.28Å; R761-Q763 PolarHBondContact O-N 2.91Å; Q763-K766 PolarHBondContact O-N 2.84Å; Q763-I767 WeakPolarHBondContact O-CG1 3.43Å; Q763-I767 PolarHBondContact O-N 3.37Å
764	E	82.5	Confident	81.3	Confident	95 Å²	95	117.3 Å²	117.3	44%	0.444	53%	0.531	S	S	.	.	H	α-helix	trans	-62.1	-40.3	175.7	-74.9	177.8	172.7	0	0	111.8	I760 R761 I767 R768	I760-E764 HydrophobicContact CG2-CG 4.22Å; I760-E764 WeakPolarHBondContact O-CG 3.38Å; I760-E764 PolarHBondContact O-N 3.28Å; R761-E764 PolarHBondContact O-N 3.31Å; E764-I767 PolarHBondContact O-N 3.26Å; E764-R768 WeakPolarHBondContact O-CB 3.47Å; E764-R768 PolarHBondContact O-N 2.78Å
765	E	81.4	Confident	81.1	Confident	112 Å²	112	116.2 Å²	116.2	52%	0.523	53%	0.532	S	S	.	.	H	α-helix	trans	-62.2	-44.1	173.6	-93.3	-172.9	162.4	0	0	111.9	R761 I767 R768 E769	R761-E765 PolarHBondContact O-N 3Å; E765-I767 VanDerWaalsContact C-N 3.31Å; E765-I767 PolarHBondContact O-N 3.44Å; E765-R768 WeakPolarHBondContact O-CA 3.43Å; E765-R768 WeakPolarHBondContact O-CB 3.45Å; E765-R768 PolarHBondContact O-N 3.44Å; E765-R768 VanDerWaalsContact O-N 3.1Å; E765-E769 WeakPolarHBondContact O-CG 3.5Å; E765-E769 PolarHBondContact O-N 3.05Å
766	K	81.7	Confident	81	Confident	134 Å²	134	114.7 Å²	114.7	58%	0.583	53%	0.525	S	S	*	.	H	α-helix	trans	-62.9	-36.9	176.5	-73.3	174.3	-177.5	175.6	0	113	E762 Q763 Q770	E762-K766 WeakPolarHBondContact O-CG 3.36Å; E762-K766 PolarHBondContact O-N 3.06Å; Q763-K766 PolarHBondContact O-N 2.84Å; K766-Q770 WeakPolarHBondContact O-CG 3.39Å; K766-Q770 PolarHBondContact O-N 3.49Å
767	I	83.5	Confident	80.7	Confident	90 Å²	90	115 Å²	115	46%	0.462	53%	0.526	S	S	.	.	H	α-helix	trans	-65.7	-43.9	173.3	-68.4	167.9	0	0	0	109.5	Q763 E764 E765 E769 Q770 E771	Q763-I767 WeakPolarHBondContact O-CG1 3.43Å; Q763-I767 PolarHBondContact O-N 3.37Å; E764-I767 PolarHBondContact O-N 3.26Å; E765-I767 VanDerWaalsContact C-N 3.31Å; E765-I767 PolarHBondContact O-N 3.44Å; I767-E769 PolarHBondContact O-N 3.39Å; I767-Q770 CarbonylContact O-C 3.59Å; I767-Q770 WeakPolarHBondContact O-CB 3.5Å; I767-Q770 PolarHBondContact O-N 2.88Å; I767-Q770 VanDerWaalsContact O-N 3.15Å; I767-E771 HydrophobicContact CG2-CG 4.35Å; I767-E771 WeakPolarHBondContact O-CG 3.44Å; I767-E771 PolarHBondContact O-N 3.18Å
768	R	86.4	Confident	80.4	Confident	128 Å²	128	116.1 Å²	116.1	48%	0.483	53%	0.532	S	S	.	.	H	α-helix	trans	-60.3	-45.3	177.6	-128.3	-178.5	-71.1	155.6	-1.3	112.3	E764 E765 Q770 E771 E772	E764-R768 WeakPolarHBondContact O-CB 3.47Å; E764-R768 PolarHBondContact O-N 2.78Å; E765-R768 WeakPolarHBondContact O-CA 3.43Å; E765-R768 WeakPolarHBondContact O-CB 3.45Å; E765-R768 PolarHBondContact O-N 3.44Å; E765-R768 VanDerWaalsContact O-N 3.1Å; R768-Q770 VanDerWaalsContact C-N 3.31Å; R768-Q770 PolarHBondContact O-N 3.1Å; R768-E771 PolarHBondContact O-N 2.8Å; R768-E772 PolarHBondContact O-N 3.15Å
769	E	81.3	Confident	80.3	Confident	120 Å²	120	116.4 Å²	116.4	56%	0.561	54%	0.535	S	S	*	.	H	α-helix	trans	-61.8	-38.6	174.5	-71.9	176.8	171.3	0	0	111.7	E765 I767 M773	E765-E769 WeakPolarHBondContact O-CG 3.5Å; E765-E769 PolarHBondContact O-N 3.05Å; I767-E769 PolarHBondContact O-N 3.39Å; E769-M773 WeakPolarHBondContact O-CB 3.32Å; E769-M773 VanDerWaalsContact O-CG 3.32Å; E769-M773 WeakPolarHBondContact O-CG 3.38Å; E769-M773 PolarHBondContact O-N 2.85Å
770	Q	77.4	Confident	80.2	Confident	138 Å²	138	115.5 Å²	115.5	65%	0.645	53%	0.531	S	S	*	.	H	α-helix	trans	-66.4	-39.5	172.9	-83	-171.9	-17.2	0	0	112.7	K766 I767 R768 M773 M774	K766-Q770 WeakPolarHBondContact O-CG 3.39Å; K766-Q770 PolarHBondContact O-N 3.49Å; I767-Q770 CarbonylContact O-C 3.59Å; I767-Q770 WeakPolarHBondContact O-CB 3.5Å; I767-Q770 PolarHBondContact O-N 2.88Å; I767-Q770 VanDerWaalsContact O-N 3.15Å; R768-Q770 VanDerWaalsContact C-N 3.31Å; R768-Q770 PolarHBondContact O-N 3.1Å; Q770-M773 PolarHBondContact O-N 3.17Å; Q770-M774 WeakPolarHBondContact O-CB 3.48Å; Q770-M774 PolarHBondContact O-N 2.74Å
771	E	78	Confident	78.9	Confident	98 Å²	98	116.7 Å²	116.7	46%	0.458	54%	0.536	S	S	.	.	H	α-helix	trans	-64.3	-44.5	175.5	-76.1	178.2	169.6	0	0	111.3	I767 R768 M774 Q775	I767-E771 HydrophobicContact CG2-CG 4.35Å; I767-E771 WeakPolarHBondContact O-CG 3.44Å; I767-E771 PolarHBondContact O-N 3.18Å; R768-E771 PolarHBondContact O-N 2.8Å; E771-M774 WeakPolarHBondContact O-CB 3.41Å; E771-M774 PolarHBondContact O-N 2.89Å; E771-M774 VanDerWaalsContact O-N 3.17Å; E771-Q775 WeakPolarHBondContact O-CG 3.33Å; E771-Q775 PolarHBondContact O-N 3.24Å
772	E	80.5	Confident	77.7	Confident	122 Å²	122	117.9 Å²	117.9	57%	0.57	54%	0.54	S	S	*	.	H	α-helix	trans	-61.5	-44.2	175.5	-74.9	-178.9	-178.6	0	0	111.6	R768 M774 Q775 E776	R768-E772 PolarHBondContact O-N 3.15Å; E772-M774 VanDerWaalsContact C-N 3.29Å; E772-M774 PolarHBondContact O-N 3.39Å; E772-Q775 PolarHBondContact O-N 3.49Å; E772-E776 PolarHBondContact O-N 3.04Å
773	M	80.5	Confident	77.5	Confident	125 Å²	125	118.7 Å²	118.7	62%	0.616	54%	0.544	S	S	*	.	H	α-helix	trans	-61	-36.6	173.8	-79.7	-94.2	-65	0	0	112.8	E769 Q770 Q777	E769-M773 WeakPolarHBondContact O-CB 3.32Å; E769-M773 VanDerWaalsContact O-CG 3.32Å; E769-M773 WeakPolarHBondContact O-CG 3.38Å; E769-M773 PolarHBondContact O-N 2.85Å; Q770-M773 PolarHBondContact O-N 3.17Å; M773-Q777 WeakPolarHBondContact O-CG 3.43Å; M773-Q777 PolarHBondContact O-N 3.47Å; M773-Q777 VanDerWaalsContact O-N 3.11Å
774	M	71.9	Confident	77.2	Confident	111 Å²	111	119.1 Å²	119.1	55%	0.547	55%	0.546	S	S	.	.	H	α-helix	trans	-68.3	-44.2	175	-123.6	-174.8	-45.4	0	0	111.2	Q770 E771 E772 E776 Q777 E778	Q770-M774 WeakPolarHBondContact O-CB 3.48Å; Q770-M774 PolarHBondContact O-N 2.74Å; E771-M774 WeakPolarHBondContact O-CB 3.41Å; E771-M774 PolarHBondContact O-N 2.89Å; E771-M774 VanDerWaalsContact O-N 3.17Å; E772-M774 VanDerWaalsContact C-N 3.29Å; E772-M774 PolarHBondContact O-N 3.39Å; M774-E776 VanDerWaalsContact C-N 3.33Å; M774-E776 PolarHBondContact O-N 3.19Å; M774-Q777 CarbonylContact O-C 3.58Å; M774-Q777 WeakPolarHBondContact O-CB 3.39Å; M774-Q777 PolarHBondContact O-N 3.18Å; M774-E778 WeakPolarHBondContact O-CG 3.49Å; M774-E778 PolarHBondContact O-N 3.4Å
775	Q	78.5	Confident	76.7	Confident	115 Å²	115	120.2 Å²	120.2	54%	0.537	55%	0.552	S	S	.	*	H	α-helix	trans	-61.5	-42.2	176.5	-74.3	176.2	7.3	0	0	111.2	E771 E772 Q777 E778 E779	E771-Q775 WeakPolarHBondContact O-CG 3.33Å; E771-Q775 PolarHBondContact O-N 3.24Å; E772-Q775 PolarHBondContact O-N 3.49Å; Q775-Q777 VanDerWaalsContact C-N 3.29Å; Q775-Q777 PolarHBondContact O-N 2.82Å; Q775-E778 PolarHBondContact O-N 3.11Å; Q775-E779 PolarHBondContact O-N 3.11Å
776	E	80.3	Confident	76.6	Confident	97 Å²	97	119.9 Å²	119.9	45%	0.453	55%	0.55	S	S	.	.	H	α-helix	trans	-66.4	-32.7	177.1	-152.7	-163	149.1	0	0	112	E772 M774 K780	E772-E776 PolarHBondContact O-N 3.04Å; M774-E776 VanDerWaalsContact C-N 3.33Å; M774-E776 PolarHBondContact O-N 3.19Å; E776-K780 WeakPolarHBondContact O-CB 3.28Å; E776-K780 WeakPolarHBondContact O-CD 3.44Å; E776-K780 VanDerWaalsContact O-CG 3.28Å; E776-K780 WeakPolarHBondContact O-CG 3.5Å; E776-K780 PolarHBondContact O-N 3.15Å; E776-K780 VanDerWaalsContact O-N 3.15Å; E776-K780 IonicContact OE1-NZ 3.51Å; E776-K780 PolarHBondContact OE1-NZ 3.19Å
777	Q	74	Confident	76.4	Confident	130 Å²	130	119.6 Å²	119.6	61%	0.607	55%	0.549	S	S	*	.	H	α-helix	trans	-69	-42	170.6	-78.5	-95.9	-9.7	0	0	112	M773 M774 Q775 K780 M781	M773-Q777 WeakPolarHBondContact O-CG 3.43Å; M773-Q777 PolarHBondContact O-N 3.47Å; M773-Q777 VanDerWaalsContact O-N 3.11Å; M774-Q777 CarbonylContact O-C 3.58Å; M774-Q777 WeakPolarHBondContact O-CB 3.39Å; M774-Q777 PolarHBondContact O-N 3.18Å; Q775-Q777 VanDerWaalsContact C-N 3.29Å; Q775-Q777 PolarHBondContact O-N 2.82Å; Q777-K780 PolarHBondContact O-N 3.45Å; Q777-M781 PolarHBondContact O-N 2.97Å
778	E	76.1	Confident	75.3	Confident	113 Å²	113	121.4 Å²	121.4	53%	0.528	56%	0.557	S	S	.	*	H	α-helix	trans	-63.4	-44.3	175.5	-77.6	-176	166.5	0	0	111.5	M774 Q775 K780 M781 W782	M774-E778 WeakPolarHBondContact O-CG 3.49Å; M774-E778 PolarHBondContact O-N 3.4Å; Q775-E778 PolarHBondContact O-N 3.11Å; E778-K780 VanDerWaalsContact C-N 3.34Å; E778-K780 PolarHBondContact O-N 2.98Å; E778-M781 WeakPolarHBondContact O-CB 3.45Å; E778-M781 PolarHBondContact O-N 2.85Å; E778-W782 WeakPolarHBondContact O-CB 3.25Å; E778-W782 PolarHBondContact O-N 3.13Å
779	E	80	Confident	74.8	Confident	135 Å²	135	118.8 Å²	118.8	63%	0.631	56%	0.557	S	S	*	*	H	α-helix	trans	-60	-43.2	174.2	-80.4	-171.8	161	0	0	111.5	Q775 M781 W782 E783	Q775-E779 PolarHBondContact O-N 3.11Å; E779-M781 VanDerWaalsContact C-N 3.32Å; E779-M781 PolarHBondContact O-N 3.43Å; E779-W782 WeakPolarHBondContact O-CB 3.48Å; E779-W782 PolarHBondContact O-N 2.81Å; E779-W782 VanDerWaalsContact O-N 3.11Å; E779-E783 PolarHBondContact O-N 3.37Å
780	K	80.7	Confident	74.4	Confident	109 Å²	109	117.7 Å²	117.7	47%	0.474	55%	0.552	S	S	.	*	H	α-helix	trans	-62.8	-37.8	175.5	-77	168.8	-173.1	153.1	0	112.5	E776 Q777 E778 Q784	E776-K780 WeakPolarHBondContact O-CB 3.28Å; E776-K780 WeakPolarHBondContact O-CD 3.44Å; E776-K780 VanDerWaalsContact O-CG 3.28Å; E776-K780 WeakPolarHBondContact O-CG 3.5Å; E776-K780 PolarHBondContact O-N 3.15Å; E776-K780 VanDerWaalsContact O-N 3.15Å; E776-K780 IonicContact OE1-NZ 3.51Å; E776-K780 PolarHBondContact OE1-NZ 3.19Å; Q777-K780 PolarHBondContact O-N 3.45Å; E778-K780 VanDerWaalsContact C-N 3.34Å; E778-K780 PolarHBondContact O-N 2.98Å; K780-Q784 PolarHBondContact O-N 2.79Å
781	M	56.2	Low	74.2	Confident	113 Å²	113	117.5 Å²	117.5	56%	0.557	55%	0.551	S	S	*	*	H	α-helix	trans	-64.6	-43.2	171.1	-84	-158.6	-53.5	0	0	111.2	Q777 E778 E779 Q784 E785	Q777-M781 PolarHBondContact O-N 2.97Å; E778-M781 WeakPolarHBondContact O-CB 3.45Å; E778-M781 PolarHBondContact O-N 2.85Å; E779-M781 VanDerWaalsContact C-N 3.32Å; E779-M781 PolarHBondContact O-N 3.43Å; M781-Q784 CarbonylContact O-C 3.59Å; M781-Q784 WeakPolarHBondContact O-CA 3.42Å; M781-Q784 VanDerWaalsContact O-CB 3.29Å; M781-Q784 WeakPolarHBondContact O-CB 3.42Å; M781-Q784 PolarHBondContact O-N 3.22Å; M781-E785 PolarHBondContact O-N 3.45Å
782	W	61.3	Low	74	Confident	172 Å²	172	117.9 Å²	117.9	65%	0.652	55%	0.553	S	S	*	*	H	α-helix	trans	-62.6	-44.4	-179.8	-132.9	82.5	0	0	0	111.9	E778 E779 Q784 E785 E786	E778-W782 WeakPolarHBondContact O-CB 3.25Å; E778-W782 PolarHBondContact O-N 3.13Å; E779-W782 WeakPolarHBondContact O-CB 3.48Å; E779-W782 PolarHBondContact O-N 2.81Å; E779-W782 VanDerWaalsContact O-N 3.11Å; W782-Q784 PolarHBondContact O-N 2.84Å; W782-E785 PolarHBondContact O-N 3.32Å; W782-E786 WeakPolarHBondContact O-CB 3.39Å; W782-E786 PolarHBondContact O-N 3.06Å
783	E	76.2	Confident	73.6	Confident	108 Å²	108	118.6 Å²	118.6	51%	0.505	56%	0.556	S	S	.	*	H	α-helix	trans	-61.8	-32.3	172.8	-73	-171.7	177.9	0	0	112.4	E779 K787	E779-E783 PolarHBondContact O-N 3.37Å; E783-K787 WeakPolarHBondContact O-CB 3.46Å; E783-K787 WeakPolarHBondContact O-CD 3.29Å; E783-K787 VanDerWaalsContact O-CG 3.25Å; E783-K787 WeakPolarHBondContact O-CG 3.49Å; E783-K787 PolarHBondContact O-N 3.18Å; E783-K787 VanDerWaalsContact O-N 3.13Å; E783-K787 IonicContact OE2-NZ 2.69Å
784	Q	73.4	Confident	73.4	Confident	137 Å²	137	118.7 Å²	118.7	64%	0.64	55%	0.553	S	S	*	*	H	α-helix	trans	-71	-43.9	174.3	-111.3	-174.9	6.9	0	0	111.9	K780 M781 W782 K787 M788	K780-Q784 PolarHBondContact O-N 2.79Å; M781-Q784 CarbonylContact O-C 3.59Å; M781-Q784 WeakPolarHBondContact O-CA 3.42Å; M781-Q784 VanDerWaalsContact O-CB 3.29Å; M781-Q784 WeakPolarHBondContact O-CB 3.42Å; M781-Q784 PolarHBondContact O-N 3.22Å; W782-Q784 PolarHBondContact O-N 2.84Å; Q784-K787 PolarHBondContact O-N 3.12Å; Q784-M788 PolarHBondContact O-N 3.22Å
785	E	72.4	Confident	73.2	Confident	118 Å²	118	118.9 Å²	118.9	55%	0.551	55%	0.554	S	S	*	*	H	α-helix	trans	-63	-43.1	174.6	-78.8	-171.2	157.8	0	0	111.2	M781 W782 K787 M788 C789	M781-E785 PolarHBondContact O-N 3.45Å; W782-E785 PolarHBondContact O-N 3.32Å; E785-K787 PolarHBondContact O-N 2.98Å; E785-M788 CarbonylContact O-C 3.58Å; E785-M788 WeakPolarHBondContact O-CB 3.38Å; E785-M788 PolarHBondContact O-N 2.79Å; E785-M788 VanDerWaalsContact O-N 3.12Å; E785-C789 PolarHBondContact O-N 3.43Å
786	E	77.3	Confident	73	Confident	105 Å²	105	118.8 Å²	118.8	49%	0.491	55%	0.554	S	S	.	*	H	α-helix	trans	-61.2	-44.5	176.8	-170.2	179.3	-164.9	0	0	111.1	W782 M788 C789 E790	W782-E786 WeakPolarHBondContact O-CB 3.39Å; W782-E786 PolarHBondContact O-N 3.06Å; E786-M788 VanDerWaalsContact C-N 3.32Å; E786-M788 PolarHBondContact O-N 2.81Å; E786-C789 PolarHBondContact O-N 3.41Å; E786-E790 PolarHBondContact O-N 3.24Å
787	K	78.2	Confident	72.8	Confident	128 Å²	128	118.9 Å²	118.9	56%	0.557	55%	0.554	S	S	*	*	H	α-helix	trans	-61.3	-38.9	173.6	-76.5	167.7	-172.4	151.2	0	112.3	E783 Q784 E785 Q791	E783-K787 WeakPolarHBondContact O-CB 3.46Å; E783-K787 WeakPolarHBondContact O-CD 3.29Å; E783-K787 VanDerWaalsContact O-CG 3.25Å; E783-K787 WeakPolarHBondContact O-CG 3.49Å; E783-K787 PolarHBondContact O-N 3.18Å; E783-K787 VanDerWaalsContact O-N 3.13Å; E783-K787 IonicContact OE2-NZ 2.69Å; Q784-K787 PolarHBondContact O-N 3.12Å; E785-K787 PolarHBondContact O-N 2.98Å; K787-Q791 WeakPolarHBondContact O-CB 3.48Å; K787-Q791 PolarHBondContact O-N 3.08Å; K787-Q791 VanDerWaalsContact O-N 3.08Å
788	M	60.6	Low	72.7	Confident	127 Å²	127	119.4 Å²	119.4	63%	0.626	56%	0.557	S	S	*	*	H	α-helix	trans	-64.9	-46.2	173.4	-80.6	-121.5	-55.9	0	0	111.5	Q784 E785 E786 E790 Q791 E792	Q784-M788 PolarHBondContact O-N 3.22Å; E785-M788 CarbonylContact O-C 3.58Å; E785-M788 WeakPolarHBondContact O-CB 3.38Å; E785-M788 PolarHBondContact O-N 2.79Å; E785-M788 VanDerWaalsContact O-N 3.12Å; E786-M788 VanDerWaalsContact C-N 3.32Å; E786-M788 PolarHBondContact O-N 2.81Å; M788-E790 PolarHBondContact O-N 3.37Å; M788-Q791 CarbonylContact O-C 3.58Å; M788-Q791 WeakPolarHBondContact O-CA 3.4Å; M788-Q791 WeakPolarHBondContact O-CB 3.38Å; M788-Q791 PolarHBondContact O-N 2.78Å; M788-Q791 VanDerWaalsContact O-N 3.08Å; M788-E792 WeakPolarHBondContact O-CB 3.28Å; M788-E792 PolarHBondContact O-N 3.09Å
789	C	76	Confident	72.6	Confident	74 Å²	74	120.4 Å²	120.4	50%	0.5	56%	0.561	S	S	.	*	H	α-helix	trans	-60.5	-44	177.6	-77.1	0	0	0	0	111.7	E785 E786 Q791 E792 E793	E785-C789 PolarHBondContact O-N 3.43Å; E786-C789 PolarHBondContact O-N 3.41Å; C789-Q791 VanDerWaalsContact C-N 3.27Å; C789-Q791 PolarHBondContact O-N 3.48Å; C789-E792 PolarHBondContact O-N 2.86Å; C789-E793 WeakPolarHBondContact O-CB 3.48Å; C789-E793 PolarHBondContact O-N 2.81Å
790	E	73.5	Confident	72.4	Confident	96 Å²	96	118.1 Å²	118.1	45%	0.449	55%	0.551	S	S	.	*	H	α-helix	trans	-60.8	-37.6	173.3	-76.2	-167.8	171.2	0	0	112.2	E786 M788 K794	E786-E790 PolarHBondContact O-N 3.24Å; M788-E790 PolarHBondContact O-N 3.37Å; E790-K794 WeakPolarHBondContact O-CB 3.49Å; E790-K794 WeakPolarHBondContact O-CD 3.33Å; E790-K794 VanDerWaalsContact O-CG 3.28Å; E790-K794 WeakPolarHBondContact O-CG 3.39Å; E790-K794 PolarHBondContact O-N 3.08Å; E790-K794 VanDerWaalsContact O-N 3.09Å; E790-K794 IonicContact OE2-NZ 3.93Å
791	Q	72.9	Confident	72.1	Confident	135 Å²	135	118.3 Å²	118.3	63%	0.631	55%	0.551	S	S	*	*	H	α-helix	trans	-70.4	-37.4	178.4	-153.8	175.5	26	0	0	111.3	K787 M788 C789 M795	K787-Q791 WeakPolarHBondContact O-CB 3.48Å; K787-Q791 PolarHBondContact O-N 3.08Å; K787-Q791 VanDerWaalsContact O-N 3.08Å; M788-Q791 CarbonylContact O-C 3.58Å; M788-Q791 WeakPolarHBondContact O-CA 3.4Å; M788-Q791 WeakPolarHBondContact O-CB 3.38Å; M788-Q791 PolarHBondContact O-N 2.78Å; M788-Q791 VanDerWaalsContact O-N 3.08Å; C789-Q791 VanDerWaalsContact C-N 3.27Å; C789-Q791 PolarHBondContact O-N 3.48Å; Q791-M795 PolarHBondContact O-N 2.83Å; Q791-M795 VanDerWaalsContact O-N 3.11Å
792	E	73.2	Confident	72.5	Confident	105 Å²	105	118.3 Å²	118.3	49%	0.491	55%	0.552	S	S	.	*	H	α-helix	trans	-69.3	-42.3	175.6	-163.2	171.3	-157.3	0	0	111.4	M788 C789 K794 M795 Q796	M788-E792 WeakPolarHBondContact O-CB 3.28Å; M788-E792 PolarHBondContact O-N 3.09Å; C789-E792 PolarHBondContact O-N 2.86Å; E792-K794 PolarHBondContact O-N 3.49Å; E792-M795 CarbonylContact O-C 3.59Å; E792-M795 WeakPolarHBondContact O-CA 3.43Å; E792-M795 VanDerWaalsContact O-CB 3.28Å; E792-M795 WeakPolarHBondContact O-CB 3.46Å; E792-M795 PolarHBondContact O-N 3.26Å; E792-M795 VanDerWaalsContact O-N 3.08Å; E792-Q796 WeakPolarHBondContact O-CG 3.28Å; E792-Q796 PolarHBondContact O-N 3.36Å
793	E	72.7	Confident	73.3	Confident	138 Å²	138	117.6 Å²	117.6	65%	0.645	55%	0.549	S	S	*	.	H	α-helix	trans	-63.3	-42.2	175.6	-164.3	-178.3	-166	0	0	111.3	C789 M795 Q796 E797	C789-E793 WeakPolarHBondContact O-CB 3.48Å; C789-E793 PolarHBondContact O-N 2.81Å; E793-M795 VanDerWaalsContact C-N 3.26Å; E793-M795 PolarHBondContact O-N 2.84Å; E793-Q796 PolarHBondContact O-N 3.11Å; E793-E797 WeakPolarHBondContact O-CB 3.43Å; E793-E797 PolarHBondContact O-N 3.08Å
794	K	76.6	Confident	73.2	Confident	126 Å²	126	118.3 Å²	118.3	55%	0.548	55%	0.547	S	S	.	.	H	α-helix	trans	-60.6	-36.3	172	-76.2	167.9	-173.8	153.2	0	112.4	E790 E792 Q798	E790-K794 WeakPolarHBondContact O-CB 3.49Å; E790-K794 WeakPolarHBondContact O-CD 3.33Å; E790-K794 VanDerWaalsContact O-CG 3.28Å; E790-K794 WeakPolarHBondContact O-CG 3.39Å; E790-K794 PolarHBondContact O-N 3.08Å; E790-K794 VanDerWaalsContact O-N 3.09Å; E790-K794 IonicContact OE2-NZ 3.93Å; E792-K794 PolarHBondContact O-N 3.49Å; K794-Q798 PolarHBondContact O-N 2.81Å; K794-Q798 VanDerWaalsContact O-N 3.09Å
795	M	67.6	Low	73.1	Confident	116 Å²	116	118 Å²	118	57%	0.571	55%	0.545	S	S	*	.	H	α-helix	trans	-68.6	-45.5	176.6	-149.6	-171.8	-38.4	0	0	110.9	Q791 E792 E793 E797 Q798 E799	Q791-M795 PolarHBondContact O-N 2.83Å; Q791-M795 VanDerWaalsContact O-N 3.11Å; E792-M795 CarbonylContact O-C 3.59Å; E792-M795 WeakPolarHBondContact O-CA 3.43Å; E792-M795 VanDerWaalsContact O-CB 3.28Å; E792-M795 WeakPolarHBondContact O-CB 3.46Å; E792-M795 PolarHBondContact O-N 3.26Å; E792-M795 VanDerWaalsContact O-N 3.08Å; E793-M795 VanDerWaalsContact C-N 3.26Å; E793-M795 PolarHBondContact O-N 2.84Å; M795-E797 VanDerWaalsContact C-N 3.34Å; M795-E797 PolarHBondContact O-N 2.73Å; M795-Q798 WeakPolarHBondContact O-CB 3.46Å; M795-Q798 PolarHBondContact O-N 3.05Å; M795-E799 PolarHBondContact O-N 3.23Å
796	Q	73.1	Confident	73.1	Confident	112 Å²	112	117 Å²	117	52%	0.523	54%	0.541	S	S	.	.	H	α-helix	trans	-62.8	-39	175.5	-71.9	-177	7.9	0	0	111.9	E792 E793 Q798 E799 E800	E792-Q796 WeakPolarHBondContact O-CG 3.28Å; E792-Q796 PolarHBondContact O-N 3.36Å; E793-Q796 PolarHBondContact O-N 3.11Å; Q796-Q798 VanDerWaalsContact C-N 3.32Å; Q796-Q798 PolarHBondContact O-N 2.83Å; Q796-E799 CarbonylContact O-C 3.57Å; Q796-E799 PolarHBondContact O-N 3.21Å; Q796-E800 PolarHBondContact O-N 3.09Å
797	E	76.2	Confident	72.8	Confident	100 Å²	100	117 Å²	117	47%	0.467	54%	0.541	S	S	.	.	H	α-helix	trans	-66.5	-35.9	176.3	-153.2	-155.1	149.3	0	0	111.5	E793 M795 K801	E793-E797 WeakPolarHBondContact O-CB 3.43Å; E793-E797 PolarHBondContact O-N 3.08Å; M795-E797 VanDerWaalsContact C-N 3.34Å; M795-E797 PolarHBondContact O-N 2.73Å; E797-K801 WeakPolarHBondContact O-CG 3.43Å; E797-K801 PolarHBondContact O-N 3.4Å; E797-K801 IonicContact OE1-NZ 3.98Å; E797-K801 PolarHBondContact OE1-NZ 3.46Å
798	Q	72.8	Confident	72.6	Confident	141 Å²	141	117.7 Å²	117.7	66%	0.659	54%	0.544	S	S	*	.	H	α-helix	trans	-66.8	-42.8	169.6	-79.9	-151.8	3.2	0	0	112.3	K794 M795 Q796 K801 M802	K794-Q798 PolarHBondContact O-N 2.81Å; K794-Q798 VanDerWaalsContact O-N 3.09Å; M795-Q798 WeakPolarHBondContact O-CB 3.46Å; M795-Q798 PolarHBondContact O-N 3.05Å; Q796-Q798 VanDerWaalsContact C-N 3.32Å; Q796-Q798 PolarHBondContact O-N 2.83Å; Q798-K801 PolarHBondContact O-N 3.17Å; Q798-M802 PolarHBondContact O-N 2.83Å
799	E	74.7	Confident	72.9	Confident	133 Å²	133	117.7 Å²	117.7	62%	0.621	54%	0.544	S	S	*	.	H	α-helix	trans	-61.3	-43	174.6	-82.1	-166.8	148.5	0	0	111.7	M795 Q796 K801 M802 R803	M795-E799 PolarHBondContact O-N 3.23Å; Q796-E799 CarbonylContact O-C 3.57Å; Q796-E799 PolarHBondContact O-N 3.21Å; E799-K801 VanDerWaalsContact C-N 3.35Å; E799-K801 PolarHBondContact O-N 2.96Å; E799-M802 WeakPolarHBondContact O-CB 3.49Å; E799-M802 PolarHBondContact O-N 3.3Å; E799-R803 WeakPolarHBondContact O-CB 3.42Å; E799-R803 PolarHBondContact O-N 2.95Å
800	E	73.7	Confident	72.7	Confident	87 Å²	87	121.7 Å²	121.7	41%	0.407	55%	0.548	S	S	.	.	H	α-helix	trans	-62.7	-40.2	174.8	-94.7	-149	144.1	0	0	112	Q796 M802 R803 R804	Q796-E800 PolarHBondContact O-N 3.09Å; E800-M802 VanDerWaalsContact C-N 3.34Å; E800-R803 PolarHBondContact O-N 3.48Å; E800-R804 VanDerWaalsContact CD-NH2 3.35Å; E800-R804 WeakPolarHBondContact O-CB 3.38Å; E800-R804 WeakPolarHBondContact O-CG 3.44Å; E800-R804 PolarHBondContact O-N 3.47Å; E800-R804 IonicContact OE1-NH2 3.17Å; E800-R804 PolarHBondContact OE1-NH2 3.32Å; E800-R804 IonicContact OE2-CZ 3.41Å; E800-R804 VanDerWaalsContact OE2-CZ 3.28Å; E800-R804 IonicContact OE2-NH1 2.69Å; E800-R804 PolarHBondContact OE2-NH1 2.82Å; E800-R804 IonicContact OE2-NH2 3.55Å; E800-R804 PolarHBondContact OE2-NH2 3.12Å
801	K	74.7	Confident	72.6	Confident	113 Å²	113	121.8 Å²	121.8	49%	0.491	55%	0.549	S	S	.	.	H	α-helix	trans	-61.9	-44.2	175.3	-83.1	171.5	-175.7	146	0	111.1	E797 Q798 E799 R804 Q805	E797-K801 WeakPolarHBondContact O-CG 3.43Å; E797-K801 PolarHBondContact O-N 3.4Å; E797-K801 IonicContact OE1-NZ 3.98Å; E797-K801 PolarHBondContact OE1-NZ 3.46Å; Q798-K801 PolarHBondContact O-N 3.17Å; E799-K801 VanDerWaalsContact C-N 3.35Å; E799-K801 PolarHBondContact O-N 2.96Å; K801-R804 PolarHBondContact O-N 3.49Å; K801-Q805 WeakPolarHBondContact O-CB 3.35Å; K801-Q805 PolarHBondContact O-N 3.26Å
802	M	65.9	Low	72.4	Confident	114 Å²	114	121 Å²	121	56%	0.562	55%	0.545	S	S	*	.	H	α-helix	trans	-59.3	-48	172.4	-81.6	-79.6	-68.3	0	0	111.2	Q798 E799 E800 R804 Q805 E806	Q798-M802 PolarHBondContact O-N 2.83Å; E799-M802 WeakPolarHBondContact O-CB 3.49Å; E799-M802 PolarHBondContact O-N 3.3Å; E800-M802 VanDerWaalsContact C-N 3.34Å; M802-R804 PolarHBondContact O-N 2.78Å; M802-Q805 CarbonylContact O-C 3.58Å; M802-Q805 WeakPolarHBondContact O-CA 3.41Å; M802-Q805 WeakPolarHBondContact O-CB 3.33Å; M802-Q805 PolarHBondContact O-N 3.44Å; M802-Q805 VanDerWaalsContact O-N 3.12Å; M802-E806 PolarHBondContact O-N 2.78Å
803	R	77.3	Confident	72.2	Confident	156 Å²	156	121 Å²	121	59%	0.589	55%	0.545	S	S	*	.	H	α-helix	trans	-62.7	-41.9	179.8	-133.9	-173.4	98.2	-147.5	4	112.3	E799 E800 Q805 E806 E807	E799-R803 WeakPolarHBondContact O-CB 3.42Å; E799-R803 PolarHBondContact O-N 2.95Å; E800-R803 PolarHBondContact O-N 3.48Å; R803-Q805 VanDerWaalsContact C-N 3.33Å; R803-E806 PolarHBondContact O-N 2.91Å; R803-E807 WeakPolarHBondContact O-CB 3.39Å; R803-E807 PolarHBondContact O-N 3.28Å
804	R	74.3	Confident	72.1	Confident	124 Å²	124	118 Å²	118	47%	0.468	54%	0.536	S	S	.	.	H	α-helix	trans	-66	-35	174.2	-73.8	-176.7	-173.1	116.3	8.7	111.9	E800 K801 M802 K808	E800-R804 VanDerWaalsContact CD-NH2 3.35Å; E800-R804 WeakPolarHBondContact O-CB 3.38Å; E800-R804 WeakPolarHBondContact O-CG 3.44Å; E800-R804 PolarHBondContact O-N 3.47Å; E800-R804 IonicContact OE1-NH2 3.17Å; E800-R804 PolarHBondContact OE1-NH2 3.32Å; E800-R804 IonicContact OE2-CZ 3.41Å; E800-R804 VanDerWaalsContact OE2-CZ 3.28Å; E800-R804 IonicContact OE2-NH1 2.69Å; E800-R804 PolarHBondContact OE2-NH1 2.82Å; E800-R804 IonicContact OE2-NH2 3.55Å; E800-R804 PolarHBondContact OE2-NH2 3.12Å; K801-R804 PolarHBondContact O-N 3.49Å; M802-R804 PolarHBondContact O-N 2.78Å; R804-K808 WeakPolarHBondContact O-CB 3.27Å; R804-K808 VanDerWaalsContact O-CG 3.27Å; R804-K808 WeakPolarHBondContact O-CG 3.44Å; R804-K808 PolarHBondContact O-N 3.03Å
805	Q	71.8	Confident	71.7	Confident	130 Å²	130	119.2 Å²	119.2	61%	0.607	54%	0.537	S	S	*	.	H	α-helix	trans	-66.8	-44.7	172.1	-100.7	-174.4	-16.9	0	0	111.6	K801 M802 R803 E807 K808 M809	K801-Q805 WeakPolarHBondContact O-CB 3.35Å; K801-Q805 PolarHBondContact O-N 3.26Å; M802-Q805 CarbonylContact O-C 3.58Å; M802-Q805 WeakPolarHBondContact O-CA 3.41Å; M802-Q805 WeakPolarHBondContact O-CB 3.33Å; M802-Q805 PolarHBondContact O-N 3.44Å; M802-Q805 VanDerWaalsContact O-N 3.12Å; R803-Q805 VanDerWaalsContact C-N 3.33Å; Q805-E807 VanDerWaalsContact C-N 3.33Å; Q805-E807 PolarHBondContact O-N 2.82Å; Q805-K808 PolarHBondContact O-N 2.8Å; Q805-M809 WeakPolarHBondContact O-CG 3.35Å; Q805-M809 PolarHBondContact O-N 2.94Å
806	E	71.6	Confident	71.6	Confident	98 Å²	98	118.7 Å²	118.7	46%	0.458	54%	0.536	S	S	.	.	H	α-helix	trans	-61.6	-40.6	174.4	-77.1	-167.5	162.7	0	0	112	M802 R803 M809 R810	M802-E806 PolarHBondContact O-N 2.78Å; R803-E806 PolarHBondContact O-N 2.91Å; E806-M809 WeakPolarHBondContact O-CB 3.34Å; E806-M809 PolarHBondContact O-N 3.27Å; E806-R810 WeakPolarHBondContact O-CG 3.29Å; E806-R810 PolarHBondContact O-N 3.49Å; E806-R810 IonicContact OE2-NH2 2.91Å
807	E	71.5	Confident	71.3	Confident	104 Å²	104	120.6 Å²	120.6	49%	0.486	54%	0.539	S	S	.	.	H	α-helix	trans	-68.2	-40.1	179	-164.7	170.1	-146.1	0	0	111.4	R803 Q805 M809 R810 E811	R803-E807 WeakPolarHBondContact O-CB 3.39Å; R803-E807 PolarHBondContact O-N 3.28Å; Q805-E807 VanDerWaalsContact C-N 3.33Å; Q805-E807 PolarHBondContact O-N 2.82Å; E807-M809 VanDerWaalsContact C-N 3.33Å; E807-M809 PolarHBondContact O-N 2.92Å; E807-R810 PolarHBondContact O-N 3.48Å; E807-E811 PolarHBondContact O-N 3.38Å
808	K	74.1	Confident	70.9	Confident	143 Å²	143	120.7 Å²	120.7	62%	0.622	54%	0.539	S	S	*	.	H	α-helix	trans	-61	-40.8	170.4	-76.7	174.8	-178.9	179.3	0	112.4	R804 Q805 E811 Q812	R804-K808 WeakPolarHBondContact O-CB 3.27Å; R804-K808 VanDerWaalsContact O-CG 3.27Å; R804-K808 WeakPolarHBondContact O-CG 3.44Å; R804-K808 PolarHBondContact O-N 3.03Å; Q805-K808 PolarHBondContact O-N 2.8Å; K808-E811 PolarHBondContact O-N 3.25Å; K808-Q812 WeakPolarHBondContact O-CB 3.5Å; K808-Q812 WeakPolarHBondContact O-CG 3.44Å; K808-Q812 PolarHBondContact O-N 3.47Å
809	M	67.6	Low	70.6	Confident	127 Å²	127	120.4 Å²	120.4	63%	0.626	54%	0.538	S	S	*	.	H	α-helix	trans	-62.4	-45.8	173.8	-77.2	-78	-65.7	0	0	111	Q805 E806 E807 Q812 E813	Q805-M809 WeakPolarHBondContact O-CG 3.35Å; Q805-M809 PolarHBondContact O-N 2.94Å; E806-M809 WeakPolarHBondContact O-CB 3.34Å; E806-M809 PolarHBondContact O-N 3.27Å; E807-M809 VanDerWaalsContact C-N 3.33Å; E807-M809 PolarHBondContact O-N 2.92Å; M809-Q812 PolarHBondContact O-N 2.84Å; M809-E813 WeakPolarHBondContact O-CB 3.39Å; M809-E813 PolarHBondContact O-N 3.28Å
810	R	70.1	Confident	69.9	Low	157 Å²	157	120.3 Å²	120.3	59%	0.592	54%	0.537	S	S	*	.	H	α-helix	trans	-63.8	-40.5	176.1	-72.7	179.4	-169.8	178.6	7.7	112.2	E806 E807 E813 V814	E806-R810 WeakPolarHBondContact O-CG 3.29Å; E806-R810 PolarHBondContact O-N 3.49Å; E806-R810 IonicContact OE2-NH2 2.91Å; E807-R810 PolarHBondContact O-N 3.48Å; R810-E813 WeakPolarHBondContact O-CB 3.38Å; R810-E813 PolarHBondContact O-N 3.42Å; R810-V814 VanDerWaalsContact O-CG2 3.29Å; R810-V814 WeakPolarHBondContact O-CG2 3.44Å; R810-V814 PolarHBondContact O-N 2.81Å
811	E	71.6	Confident	69.2	Low	98 Å²	98	122.5 Å²	122.5	46%	0.458	55%	0.548	S	S	.	.	H	α-helix	trans	-64.9	-40.6	174.1	-81.9	-168.2	-173.3	0	0	112.4	E807 K808 E813 V814 R815	E807-E811 PolarHBondContact O-N 3.38Å; K808-E811 PolarHBondContact O-N 3.25Å; E811-E813 VanDerWaalsContact C-N 3.3Å; E811-V814 PolarHBondContact O-N 2.88Å; E811-R815 WeakPolarHBondContact O-CB 3.4Å; E811-R815 WeakPolarHBondContact O-CG 3.44Å; E811-R815 PolarHBondContact O-N 2.82Å; E811-R815 IonicContact OE2-NH2 2.82Å; E811-R815 PolarHBondContact OE2-NH2 2.89Å
812	Q	68.5	Low	68.5	Low	120 Å²	120	124.8 Å²	124.8	56%	0.561	56%	0.557	S	S	*	*	H	α-helix	trans	-61.8	-42	172.2	-81.6	-174.4	-13.4	0	0	110.5	K808 M809 R815 L816	K808-Q812 WeakPolarHBondContact O-CB 3.5Å; K808-Q812 WeakPolarHBondContact O-CG 3.44Å; K808-Q812 PolarHBondContact O-N 3.47Å; M809-Q812 PolarHBondContact O-N 2.84Å; Q812-R815 PolarHBondContact O-N 3.24Å; Q812-L816 WeakPolarHBondContact O-CB 3.41Å; Q812-L816 VanDerWaalsContact O-CG 3.27Å; Q812-L816 WeakPolarHBondContact O-CG 3.27Å; Q812-L816 PolarHBondContact O-N 3.4Å
813	E	70.2	Confident	68.1	Low	103 Å²	103	126.8 Å²	126.8	48%	0.481	57%	0.567	S	S	.	*	H	α-helix	trans	-63.8	-41.5	176.4	-156.5	-171.1	161.1	0	0	112	M809 R810 E811 L816 R817	M809-E813 WeakPolarHBondContact O-CB 3.39Å; M809-E813 PolarHBondContact O-N 3.28Å; R810-E813 WeakPolarHBondContact O-CB 3.38Å; R810-E813 PolarHBondContact O-N 3.42Å; E811-E813 VanDerWaalsContact C-N 3.3Å; E813-L816 PolarHBondContact O-N 3.35Å; E813-R817 WeakPolarHBondContact O-CG 3.41Å; E813-R817 PolarHBondContact O-N 2.87Å; E813-R817 IonicContact OE1-NH2 3.52Å
814	V	70.2	Confident	66.9	Low	76 Å²	76	127.2 Å²	127.2	46%	0.461	58%	0.576	S	S	.	*	H	α-helix	trans	-66.9	-41.1	175.2	170.6	0	0	0	0	111.4	R810 E811 L816 R817 Q818	R810-V814 VanDerWaalsContact O-CG2 3.29Å; R810-V814 WeakPolarHBondContact O-CG2 3.44Å; R810-V814 PolarHBondContact O-N 2.81Å; E811-V814 PolarHBondContact O-N 2.88Å; V814-L816 VanDerWaalsContact C-N 3.34Å; V814-R817 PolarHBondContact O-N 3.43Å; V814-Q818 WeakPolarHBondContact O-CG 3.46Å; V814-Q818 PolarHBondContact O-N 3.33Å
815	R	67.5	Low	65.7	Low	152 Å²	152	130 Å²	130	57%	0.574	59%	0.594	S	S	*	*	H	α-helix	trans	-64.4	-39.6	175.1	-78.4	-177	-126.7	-154	-1.4	112	E811 Q812 Q818 Q819	E811-R815 WeakPolarHBondContact O-CB 3.4Å; E811-R815 WeakPolarHBondContact O-CG 3.44Å; E811-R815 PolarHBondContact O-N 2.82Å; E811-R815 IonicContact OE2-NH2 2.82Å; E811-R815 PolarHBondContact OE2-NH2 2.89Å; Q812-R815 PolarHBondContact O-N 3.24Å; R815-Q818 PolarHBondContact O-N 2.93Å; R815-Q819 PolarHBondContact O-N 3.41Å
816	L	65.8	Low	64.5	Low	105 Å²	105	134.8 Å²	134.8	55%	0.55	62%	0.616	S	S	.	*	H	α-helix	trans	-63.8	-45.3	173.9	-74.7	169.6	0	0	0	110.8	Q812 E813 V814 Q818 Q819 E820	Q812-L816 WeakPolarHBondContact O-CB 3.41Å; Q812-L816 VanDerWaalsContact O-CG 3.27Å; Q812-L816 WeakPolarHBondContact O-CG 3.27Å; Q812-L816 PolarHBondContact O-N 3.4Å; E813-L816 PolarHBondContact O-N 3.35Å; V814-L816 VanDerWaalsContact C-N 3.34Å; L816-Q818 PolarHBondContact O-N 2.89Å; L816-Q819 PolarHBondContact O-N 3.18Å; L816-E820 PolarHBondContact O-N 2.82Å
817	R	66.9	Low	64.2	Low	152 Å²	152	136.7 Å²	136.7	57%	0.574	62%	0.624	S	S	*	*	H	α-helix	trans	-60.2	-41.2	173.7	-77.7	-175.1	-168	-134	4.3	112.9	E813 V814 Q819 E820 E821	E813-R817 WeakPolarHBondContact O-CG 3.41Å; E813-R817 PolarHBondContact O-N 2.87Å; E813-R817 IonicContact OE1-NH2 3.52Å; V814-R817 PolarHBondContact O-N 3.43Å; R817-Q819 VanDerWaalsContact C-N 3.35Å; R817-E820 PolarHBondContact O-N 3.25Å; R817-E821 PolarHBondContact O-N 2.85Å
818	Q	69.3	Low	63.8	Low	102 Å²	102	138.4 Å²	138.4	48%	0.477	63%	0.631	S	S	.	*	H	α-helix	trans	-68.1	-33.3	176	-75.8	180	0.5	0	0	112.6	V814 R815 L816 K822	V814-Q818 WeakPolarHBondContact O-CG 3.46Å; V814-Q818 PolarHBondContact O-N 3.33Å; R815-Q818 PolarHBondContact O-N 2.93Å; L816-Q818 PolarHBondContact O-N 2.89Å; Q818-K822 WeakPolarHBondContact O-CB 3.44Å; Q818-K822 WeakPolarHBondContact O-CG 3.26Å; Q818-K822 PolarHBondContact O-N 3.18Å; Q818-K822 VanDerWaalsContact O-N 3.1Å
819	Q	65.5	Low	63.2	Low	134 Å²	134	138.1 Å²	138.1	63%	0.626	63%	0.632	S	S	*	*	H	α-helix	trans	-68	-39.4	170.6	-91	-175.1	-25.1	0	0	111.6	R815 L816 R817 M823	R815-Q819 PolarHBondContact O-N 3.41Å; L816-Q819 PolarHBondContact O-N 3.18Å; R817-Q819 VanDerWaalsContact C-N 3.35Å; Q819-M823 VanDerWaalsContact O-CG 3.26Å; Q819-M823 WeakPolarHBondContact O-CG 3.32Å; Q819-M823 PolarHBondContact O-N 3.1Å
820	E	59.5	Low	62.9	Low	131 Å²	131	138.8 Å²	138.8	61%	0.612	63%	0.632	S	S	*	*	H	α-helix	trans	-65.8	-42.7	174.2	-81.5	-175.9	146.2	0	0	112.6	L816 R817 M823 Q824	L816-E820 PolarHBondContact O-N 2.82Å; R817-E820 PolarHBondContact O-N 3.25Å; E820-M823 WeakPolarHBondContact O-CB 3.45Å; E820-M823 PolarHBondContact O-N 3.24Å; E820-Q824 PolarHBondContact O-N 3.2Å
821	E	58.9	Low	62.5	Low	134 Å²	134	137.6 Å²	137.6	63%	0.626	64%	0.635	S	S	*	*	H	α-helix	trans	-64.9	-40.9	176.2	-82	-177.1	160.6	0	0	111.9	R817 M823 Q824 E825	R817-E821 PolarHBondContact O-N 2.85Å; E821-M823 PolarHBondContact O-N 2.96Å; E821-Q824 PolarHBondContact O-N 3.28Å; E821-E825 PolarHBondContact O-N 3.33Å
822	K	61.3	Low	61.9	Low	160 Å²	160	140.3 Å²	140.3	70%	0.696	65%	0.647	S	S	*	*	H	α-helix	trans	-64.3	-26.1	174.7	-77.4	179.5	179.9	179.2	0	113.3	Q818 Q824	Q818-K822 WeakPolarHBondContact O-CB 3.44Å; Q818-K822 WeakPolarHBondContact O-CG 3.26Å; Q818-K822 PolarHBondContact O-N 3.18Å; Q818-K822 VanDerWaalsContact O-N 3.1Å; K822-Q824 VanDerWaalsContact C-N 3.33Å
823	M	56	Low	61.4	Low	157 Å²	157	141.7 Å²	141.7	77%	0.773	65%	0.653	S	S	*	*	H	α-helix	trans	-77.9	-17.4	172.5	-71.9	-99	-65.6	0	0	112.7	Q819 E820 E821	Q819-M823 VanDerWaalsContact O-CG 3.26Å; Q819-M823 WeakPolarHBondContact O-CG 3.32Å; Q819-M823 PolarHBondContact O-N 3.1Å; E820-M823 WeakPolarHBondContact O-CB 3.45Å; E820-M823 PolarHBondContact O-N 3.24Å; E821-M823 PolarHBondContact O-N 2.96Å
824	Q	53.6	Low	60.7	Low	164 Å²	164	144.7 Å²	144.7	77%	0.766	67%	0.666	S	S	*	*	H	α-helix	trans	-89.7	-16.1	176.6	-71.4	-174.8	6.4	0	0	113.7	E820 E821 K822	E820-Q824 PolarHBondContact O-N 3.2Å; E821-Q824 PolarHBondContact O-N 3.28Å; K822-Q824 VanDerWaalsContact C-N 3.33Å
825	E	47.8	Very low	60	Low	183 Å²	183	150.4 Å²	150.4	86%	0.855	68%	0.683	S	S	*	*			trans	-92.3	11.9	177.9	-76.2	-168.5	155	0	0	114.9	E821	E821-E825 PolarHBondContact O-N 3.33Å
826	H	47.6	Very low	59.3	Low	231 Å²	231	150.3 Å²	150.3	100%	1.069	69%	0.693	S	S	*	*			trans	-129.7	0	177.1	-142.8	-44.6	0	0	0	112.5

Retrieved 826 of 826 residues in 710.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).