SYUA_RAT Loading...

Alpha-synuclein

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release (By similarity). Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores (By similarity). Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis (By similarity). Also acts as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5 (By similarity). This chaperone activity is important to sustain normal SNARE-complex assembly during aging (By similarity). Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity (By similarity).

AlphaFold DB , UniProt , Accession P37377, Species RAT (Rattus norvegicus, Rat), Gene Snca, Length 140 aa.

						>SYUA_RAT|P37377|Snca
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	87.8	Confident	91.5	Very high	187 Å²	187	117.5 Å²	117.5	92%	0.921	63%	0.625	S	S	*	*				0	-6.7	0	-76.2	178.4	-178.9	0	112.4	V3 F4 M5	M1-V3 PolarHBondContact O-N 3.15Å; M1-F4 WeakPolarHBondContact O-CB 3.37Å; M1-F4 PolarHBondContact O-N 3.32Å; M1-F4 VanDerWaalsContact O-N 3.11Å; M1-M5 PolarHBondContact O-N 3.02Å
2	D	91.4	Very high	91.4	Very high	133 Å²	133	120.1 Å²	120.1	71%	0.711	63%	0.627	S	S	*	*	H	α-helix	trans	-66.9	-37.6	-168.6	-47.9	-65.6	0	0	113.5	F4 M5 K6	D2-F4 VanDerWaalsContact C-N 3.29Å; D2-F4 PolarHBondContact O-N 2.83Å; D2-M5 PolarHBondContact O-N 3.21Å; D2-K6 WeakPolarHBondContact O-CB 3.08Å; D2-K6 PolarHBondContact O-N 3.23Å
3	V	93.5	Very high	91.4	Very high	128 Å²	128	121.2 Å²	121.2	78%	0.776	63%	0.627	S	S	*	*	H	α-helix	trans	-62.8	-38.3	175.5	-177.9	0	0	0	111.2	M1 G7	M1-V3 PolarHBondContact O-N 3.15Å; V3-G7 PolarHBondContact O-N 3.03Å
4	F	92	Very high	91.3	Very high	148 Å²	148	115.6 Å²	115.6	65%	0.649	61%	0.613	S	S	*	*	H	α-helix	trans	-67.3	-47	176.4	177.3	-93.8	0	0	111.3	M1 D2 K6 G7 L8	M1-F4 WeakPolarHBondContact O-CB 3.37Å; M1-F4 PolarHBondContact O-N 3.32Å; M1-F4 VanDerWaalsContact O-N 3.11Å; D2-F4 VanDerWaalsContact C-N 3.29Å; D2-F4 PolarHBondContact O-N 2.83Å; F4-K6 VanDerWaalsContact C-N 3.32Å; F4-K6 PolarHBondContact O-N 2.82Å; F4-G7 WeakPolarHBondContact O-CA 3.28Å; F4-G7 PolarHBondContact O-N 3.38Å; F4-G7 VanDerWaalsContact O-N 3.11Å; F4-L8 PolarHBondContact O-N 3.34Å
5	M	91.1	Very high	91.5	Very high	108 Å²	108	114.7 Å²	114.7	53%	0.532	61%	0.614	S	S	.	*	H	α-helix	trans	-59.2	-43.7	175.9	-71.3	-64.7	-161.4	0	111.6	M1 D2 G7 L8 S9	M1-M5 PolarHBondContact O-N 3.02Å; D2-M5 PolarHBondContact O-N 3.21Å; M5-G7 VanDerWaalsContact C-N 3.33Å; M5-G7 PolarHBondContact O-N 3.23Å; M5-L8 PolarHBondContact O-N 3.16Å; M5-S9 PolarHBondContact O-N 2.74Å; M5-S9 PolarHBondContact O-OG 3.32Å
6	K	92.1	Very high	91.6	Very high	168 Å²	168	111.8 Å²	111.8	73%	0.73	60%	0.601	S	S	*	*	H	α-helix	trans	-61.2	-41.2	174.3	-171.2	176.2	-176.4	174.4	111.8	D2 F4 K10	D2-K6 WeakPolarHBondContact O-CB 3.08Å; D2-K6 PolarHBondContact O-N 3.23Å; F4-K6 VanDerWaalsContact C-N 3.32Å; F4-K6 PolarHBondContact O-N 2.82Å; K6-K10 WeakPolarHBondContact O-CB 3.42Å; K6-K10 PolarHBondContact O-N 3.39Å
7	G	92	Very high	91.5	Very high	41 Å²	41	108.5 Å²	108.5	42%	0.423	59%	0.593	S	S	.	*	H	α-helix	trans	-63.3	-45.8	175.7	0	0	0	0	112.8	V3 F4 M5 K10 A11	V3-G7 PolarHBondContact O-N 3.03Å; F4-G7 WeakPolarHBondContact O-CA 3.28Å; F4-G7 PolarHBondContact O-N 3.38Å; F4-G7 VanDerWaalsContact O-N 3.11Å; M5-G7 VanDerWaalsContact C-N 3.33Å; M5-G7 PolarHBondContact O-N 3.23Å; G7-K10 PolarHBondContact O-N 2.99Å; G7-A11 WeakPolarHBondContact O-CB 3.26Å; G7-A11 PolarHBondContact O-N 2.98Å
8	L	91.9	Very high	91.4	Very high	99 Å²	99	105.5 Å²	105.5	52%	0.518	59%	0.585	S	S	.	*	H	α-helix	trans	-62.6	-45.3	177	-180	62.8	0	0	111.6	F4 M5 A11 K12	F4-L8 PolarHBondContact O-N 3.34Å; M5-L8 PolarHBondContact O-N 3.16Å; L8-A11 PolarHBondContact O-N 2.89Å; L8-K12 WeakPolarHBondContact O-CB 3.06Å; L8-K12 PolarHBondContact O-N 3.43Å
9	S	92.1	Very high	91.5	Very high	65 Å²	65	103.1 Å²	103.1	46%	0.455	58%	0.58	S	S	.	*	H	α-helix	trans	-62	-44.2	176.1	-70.6	0	0	0	111.9	M5 A11 K12 E13	M5-S9 PolarHBondContact O-N 2.74Å; M5-S9 PolarHBondContact O-OG 3.32Å; S9-A11 VanDerWaalsContact C-N 3.31Å; S9-A11 PolarHBondContact O-N 3.45Å; S9-K12 WeakPolarHBondContact O-CB 3.35Å; S9-K12 PolarHBondContact O-N 3.18Å; S9-E13 WeakPolarHBondContact O-CG 3.49Å; S9-E13 PolarHBondContact O-N 3.28Å
10	K	91.7	Very high	91.3	Very high	158 Å²	158	103.4 Å²	103.4	69%	0.687	58%	0.577	S	S	*	*	H	α-helix	trans	-61.6	-38.9	176	-172.3	175.3	-178.2	179.4	112.3	K6 G7 G14	K6-K10 WeakPolarHBondContact O-CB 3.42Å; K6-K10 PolarHBondContact O-N 3.39Å; G7-K10 PolarHBondContact O-N 2.99Å; K10-G14 PolarHBondContact O-N 3.3Å
11	A	90.4	Very high	91.3	Very high	57 Å²	57	106.2 Å²	106.2	47%	0.471	58%	0.583	S	S	.	*	H	α-helix	trans	-65.1	-44.3	174.9	0	0	0	0	111.5	G7 L8 S9 G14 V15	G7-A11 WeakPolarHBondContact O-CB 3.26Å; G7-A11 PolarHBondContact O-N 2.98Å; L8-A11 PolarHBondContact O-N 2.89Å; S9-A11 VanDerWaalsContact C-N 3.31Å; S9-A11 PolarHBondContact O-N 3.45Å; A11-G14 PolarHBondContact O-N 3.36Å; A11-V15 WeakPolarHBondContact O-CG2 3.36Å; A11-V15 PolarHBondContact O-N 2.87Å
12	K	90.3	Very high	91.4	Very high	149 Å²	149	101.7 Å²	101.7	65%	0.648	57%	0.566	S	S	*	*	H	α-helix	trans	-59.7	-46.7	175.6	-178.5	-178.4	176.6	-175.5	111.6	L8 S9 G14 V15 V16	L8-K12 WeakPolarHBondContact O-CB 3.06Å; L8-K12 PolarHBondContact O-N 3.43Å; S9-K12 WeakPolarHBondContact O-CB 3.35Å; S9-K12 PolarHBondContact O-N 3.18Å; K12-G14 VanDerWaalsContact C-N 3.32Å; K12-G14 PolarHBondContact O-N 3.17Å; K12-V15 PolarHBondContact O-N 2.89Å; K12-V16 WeakPolarHBondContact O-CG2 3.4Å; K12-V16 PolarHBondContact O-N 3.26Å
13	E	91.4	Very high	91.2	Very high	135 Å²	135	103.1 Å²	103.1	63%	0.631	57%	0.566	S	S	*	*	H	α-helix	trans	-58.3	-43.3	175.2	-74.5	172.1	-175.5	0	111.7	S9 V15 V16 A17	S9-E13 WeakPolarHBondContact O-CG 3.49Å; S9-E13 PolarHBondContact O-N 3.28Å; E13-V15 PolarHBondContact O-N 3.37Å; E13-V16 PolarHBondContact O-N 3.22Å; E13-A17 VanDerWaalsContact O-CB 3.3Å; E13-A17 WeakPolarHBondContact O-CB 3.44Å; E13-A17 PolarHBondContact O-N 3.12Å
14	G	91	Very high	90.8	Very high	42 Å²	42	103.2 Å²	103.2	43%	0.433	56%	0.558	S	S	.	*	H	α-helix	trans	-60.9	-42.1	175.8	0	0	0	0	113.3	K10 A11 K12 A18	K10-G14 PolarHBondContact O-N 3.3Å; A11-G14 PolarHBondContact O-N 3.36Å; K12-G14 VanDerWaalsContact C-N 3.32Å; K12-G14 PolarHBondContact O-N 3.17Å; G14-A18 WeakPolarHBondContact O-CB 3.39Å; G14-A18 PolarHBondContact O-N 3.07Å
15	V	94.4	Very high	90.5	Very high	103 Å²	103	98 Å²	98	62%	0.624	55%	0.545	S	S	*	.	H	α-helix	trans	-65.5	-44.5	176.4	173.1	0	0	0	111.1	A11 K12 E13 A18 A19	A11-V15 WeakPolarHBondContact O-CG2 3.36Å; A11-V15 PolarHBondContact O-N 2.87Å; K12-V15 PolarHBondContact O-N 2.89Å; E13-V15 PolarHBondContact O-N 3.37Å; V15-A18 PolarHBondContact O-N 3.41Å; V15-A19 WeakPolarHBondContact O-CB 3.49Å; V15-A19 PolarHBondContact O-N 3.05Å
16	V	92.9	Very high	90.4	Very high	67 Å²	67	97.3 Å²	97.3	41%	0.406	55%	0.547	S	S	.	.	H	α-helix	trans	-63.3	-47.5	177.9	173.5	0	0	0	110.5	K12 E13 A18 A19 E20	K12-V16 WeakPolarHBondContact O-CG2 3.4Å; K12-V16 PolarHBondContact O-N 3.26Å; E13-V16 PolarHBondContact O-N 3.22Å; V16-A18 VanDerWaalsContact C-N 3.33Å; V16-A18 PolarHBondContact O-N 3.31Å; V16-A19 PolarHBondContact O-N 3.38Å; V16-E20 HydrophobicContact CG1-CG 4.32Å; V16-E20 WeakPolarHBondContact O-CB 3.36Å; V16-E20 WeakPolarHBondContact O-CG 3.31Å; V16-E20 PolarHBondContact O-N 3.37Å
17	A	89.4	Confident	90	Very high	57 Å²	57	92.3 Å²	92.3	47%	0.471	54%	0.537	S	S	.	.	H	α-helix	trans	-61.4	-40.4	178.6	0	0	0	0	112.3	E13 K21	E13-A17 VanDerWaalsContact O-CB 3.3Å; E13-A17 WeakPolarHBondContact O-CB 3.44Å; E13-A17 PolarHBondContact O-N 3.12Å; A17-K21 VanDerWaalsContact O-CB 3.29Å; A17-K21 WeakPolarHBondContact O-CB 3.47Å; A17-K21 PolarHBondContact O-N 2.91Å
18	A	90.6	Very high	89.5	Confident	54 Å²	54	95.5 Å²	95.5	45%	0.446	54%	0.541	S	S	.	.	H	α-helix	trans	-64.6	-47.2	174.6	0	0	0	0	111.5	G14 V15 V16 E20 K21 T22	G14-A18 WeakPolarHBondContact O-CB 3.39Å; G14-A18 PolarHBondContact O-N 3.07Å; V15-A18 PolarHBondContact O-N 3.41Å; V16-A18 VanDerWaalsContact C-N 3.33Å; V16-A18 PolarHBondContact O-N 3.31Å; A18-E20 VanDerWaalsContact C-N 3.35Å; A18-E20 PolarHBondContact O-N 3.32Å; A18-K21 PolarHBondContact O-N 3Å; A18-T22 PolarHBondContact O-N 3.14Å; A18-T22 PolarHBondContact O-OG1 3.33Å; A18-T22 VanDerWaalsContact O-OG1 3.09Å
19	A	91.6	Very high	89.1	Confident	60 Å²	60	93.3 Å²	93.3	50%	0.496	54%	0.538	S	S	.	.	H	α-helix	trans	-61.8	-40.8	177.9	0	0	0	0	112.3	V15 V16 T22 K23	V15-A19 WeakPolarHBondContact O-CB 3.49Å; V15-A19 PolarHBondContact O-N 3.05Å; V16-A19 PolarHBondContact O-N 3.38Å; A19-T22 PolarHBondContact O-N 3.11Å; A19-K23 WeakPolarHBondContact O-CB 3.23Å; A19-K23 PolarHBondContact O-N 3.35Å
20	E	89.2	Confident	88.5	Confident	108 Å²	108	93.3 Å²	93.3	51%	0.505	54%	0.541	S	S	.	.	H	α-helix	trans	-66	-45.9	175.5	-76.7	-175.5	178.7	0	112.2	V16 A18 T22 K23 Q24	V16-E20 HydrophobicContact CG1-CG 4.32Å; V16-E20 WeakPolarHBondContact O-CB 3.36Å; V16-E20 WeakPolarHBondContact O-CG 3.31Å; V16-E20 PolarHBondContact O-N 3.37Å; A18-E20 VanDerWaalsContact C-N 3.35Å; A18-E20 PolarHBondContact O-N 3.32Å; E20-T22 VanDerWaalsContact C-N 3.27Å; E20-T22 PolarHBondContact O-N 3.45Å; E20-K23 PolarHBondContact O-N 2.93Å; E20-K23 VanDerWaalsContact O-N 3.16Å; E20-Q24 WeakPolarHBondContact O-CB 3.34Å; E20-Q24 WeakPolarHBondContact O-CG 3.34Å; E20-Q24 PolarHBondContact O-N 3.11Å
21	K	91.1	Very high	87.9	Confident	164 Å²	164	88.2 Å²	88.2	71%	0.713	53%	0.533	S	S	*	.	H	α-helix	trans	-58.9	-40.9	175.6	-174	174.9	-177.3	176.4	111.3	A17 A18 G25	A17-K21 VanDerWaalsContact O-CB 3.29Å; A17-K21 WeakPolarHBondContact O-CB 3.47Å; A17-K21 PolarHBondContact O-N 2.91Å; A18-K21 PolarHBondContact O-N 3Å; K21-G25 PolarHBondContact O-N 3.34Å
22	T	89	Confident	87.2	Confident	91 Å²	91	92.5 Å²	92.5	56%	0.558	54%	0.542	S	S	*	.	H	α-helix	trans	-66.6	-44.7	174.6	-61.1	0	0	0	111.6	A18 A19 E20 Q24 G25 V26	A18-T22 PolarHBondContact O-N 3.14Å; A18-T22 PolarHBondContact O-OG1 3.33Å; A18-T22 VanDerWaalsContact O-OG1 3.09Å; A19-T22 PolarHBondContact O-N 3.11Å; E20-T22 VanDerWaalsContact C-N 3.27Å; E20-T22 PolarHBondContact O-N 3.45Å; T22-Q24 VanDerWaalsContact C-N 3.34Å; T22-Q24 PolarHBondContact O-N 3.47Å; T22-G25 PolarHBondContact O-N 3.3Å; T22-V26 HydrophobicContact CG2-CG2 4.26Å; T22-V26 WeakPolarHBondContact O-CB 3.41Å; T22-V26 VanDerWaalsContact O-CG2 3.24Å; T22-V26 WeakPolarHBondContact O-CG2 3.23Å; T22-V26 PolarHBondContact O-N 3.42Å
23	K	87.3	Confident	86.4	Confident	163 Å²	163	89.4 Å²	89.4	71%	0.709	54%	0.535	S	S	*	.	H	α-helix	trans	-59.9	-44.1	177.1	-174.1	-178.1	179.6	-176.6	111.7	A19 E20 A27	A19-K23 WeakPolarHBondContact O-CB 3.23Å; A19-K23 PolarHBondContact O-N 3.35Å; E20-K23 PolarHBondContact O-N 2.93Å; E20-K23 VanDerWaalsContact O-N 3.16Å; K23-A27 WeakPolarHBondContact O-CB 3.49Å; K23-A27 PolarHBondContact O-N 2.84Å
24	Q	85.8	Confident	85	Confident	131 Å²	131	91 Å²	91	61%	0.612	54%	0.54	S	S	*	.	H	α-helix	trans	-64.3	-48.1	176	-73	178.6	-5.6	0	111.5	E20 T22 V26 A27 E28	E20-Q24 WeakPolarHBondContact O-CB 3.34Å; E20-Q24 WeakPolarHBondContact O-CG 3.34Å; E20-Q24 PolarHBondContact O-N 3.11Å; T22-Q24 VanDerWaalsContact C-N 3.34Å; T22-Q24 PolarHBondContact O-N 3.47Å; Q24-V26 VanDerWaalsContact C-N 3.35Å; Q24-V26 PolarHBondContact O-N 3.36Å; Q24-A27 PolarHBondContact O-N 2.92Å; Q24-E28 VanDerWaalsContact O-CB 3.31Å; Q24-E28 WeakPolarHBondContact O-CB 3.34Å; Q24-E28 PolarHBondContact O-N 2.87Å
25	G	85.7	Confident	83.4	Confident	37 Å²	37	97.6 Å²	97.6	38%	0.381	56%	0.56	S	S	.	*	H	α-helix	trans	-61.5	-41.5	179.2	0	0	0	0	112.9	K21 T22 A29	K21-G25 PolarHBondContact O-N 3.34Å; T22-G25 PolarHBondContact O-N 3.3Å; G25-A29 VanDerWaalsContact O-CB 3.3Å; G25-A29 WeakPolarHBondContact O-CB 3.48Å; G25-A29 PolarHBondContact O-N 2.86Å
26	V	89.1	Confident	81.7	Confident	95 Å²	95	94.7 Å²	94.7	58%	0.576	55%	0.55	S	S	*	*	H	α-helix	trans	-66.6	-44	175.6	173.1	0	0	0	111.1	T22 Q24 A29 A30	T22-V26 HydrophobicContact CG2-CG2 4.26Å; T22-V26 WeakPolarHBondContact O-CB 3.41Å; T22-V26 VanDerWaalsContact O-CG2 3.24Å; T22-V26 WeakPolarHBondContact O-CG2 3.23Å; T22-V26 PolarHBondContact O-N 3.42Å; Q24-V26 VanDerWaalsContact C-N 3.35Å; Q24-V26 PolarHBondContact O-N 3.36Å; V26-A29 PolarHBondContact O-N 3.35Å; V26-A30 WeakPolarHBondContact O-CB 3.5Å; V26-A30 PolarHBondContact O-N 3.4Å
27	A	83.7	Confident	79.8	Confident	63 Å²	63	96.4 Å²	96.4	52%	0.521	56%	0.561	S	S	.	*	H	α-helix	trans	-65.5	-41	178.3	0	0	0	0	112.5	K23 Q24 A30 G31	K23-A27 WeakPolarHBondContact O-CB 3.49Å; K23-A27 PolarHBondContact O-N 2.84Å; Q24-A27 PolarHBondContact O-N 2.92Å; A27-A30 PolarHBondContact O-N 3.48Å; A27-G31 PolarHBondContact O-N 2.86Å
28	E	81.7	Confident	78.3	Confident	107 Å²	107	101.1 Å²	101.1	50%	0.5	58%	0.577	S	S	.	*	H	α-helix	trans	-67.3	-42.6	177.7	-168.6	-175.7	165.4	0	111.4	Q24 G31 K32	Q24-E28 VanDerWaalsContact O-CB 3.31Å; Q24-E28 WeakPolarHBondContact O-CB 3.34Å; Q24-E28 PolarHBondContact O-N 2.87Å; E28-G31 PolarHBondContact O-N 2.91Å; E28-K32 HydrophobicContact CG-CD 4.13Å; E28-K32 WeakPolarHBondContact O-CB 3.29Å; E28-K32 WeakPolarHBondContact O-CG 3.41Å; E28-K32 PolarHBondContact O-N 2.92Å; E28-K32 WeakPolarHBondContact OE1-CE 3.42Å; E28-K32 IonicContact OE1-NZ 2.62Å; E28-K32 PolarHBondContact OE1-NZ 3.47Å
29	A	82.3	Confident	76.8	Confident	54 Å²	54	107.6 Å²	107.6	45%	0.446	59%	0.591	S	S	.	*	H	α-helix	trans	-60.1	-48.7	173.6	0	0	0	0	111.2	G25 V26 G31 K32 T33	G25-A29 VanDerWaalsContact O-CB 3.3Å; G25-A29 WeakPolarHBondContact O-CB 3.48Å; G25-A29 PolarHBondContact O-N 2.86Å; V26-A29 PolarHBondContact O-N 3.35Å; A29-G31 VanDerWaalsContact C-N 3.31Å; A29-G31 PolarHBondContact O-N 3.33Å; A29-K32 PolarHBondContact O-N 2.86Å; A29-T33 PolarHBondContact O-N 3.2Å; A29-T33 VanDerWaalsContact O-N 3.1Å; A29-T33 PolarHBondContact O-OG1 3.28Å
30	A	80.7	Confident	75.3	Confident	64 Å²	64	108.3 Å²	108.3	53%	0.529	59%	0.589	S	S	.	*	H	α-helix	trans	-59.6	-38.6	177.3	0	0	0	0	112.8	V26 A27	V26-A30 WeakPolarHBondContact O-CB 3.5Å; V26-A30 PolarHBondContact O-N 3.4Å; A27-A30 PolarHBondContact O-N 3.48Å
31	G	77.7	Confident	73.9	Confident	51 Å²	51	105 Å²	105	53%	0.526	58%	0.584	S	S	.	*	H	α-helix	trans	-74.7	-32.5	177.1	0	0	0	0	114.3	A27 E28 A29 T33	A27-G31 PolarHBondContact O-N 2.86Å; E28-G31 PolarHBondContact O-N 2.91Å; A29-G31 VanDerWaalsContact C-N 3.31Å; A29-G31 PolarHBondContact O-N 3.33Å; G31-T33 VanDerWaalsContact C-N 3.31Å
32	K	77	Confident	72.5	Confident	148 Å²	148	102.1 Å²	102.1	64%	0.643	59%	0.585	S	S	*	*	H	α-helix	trans	-71.1	-27	175.3	-79.3	176.6	170.5	172.6	112.1	E28 A29 K34	E28-K32 HydrophobicContact CG-CD 4.13Å; E28-K32 WeakPolarHBondContact O-CB 3.29Å; E28-K32 WeakPolarHBondContact O-CG 3.41Å; E28-K32 PolarHBondContact O-N 2.92Å; E28-K32 WeakPolarHBondContact OE1-CE 3.42Å; E28-K32 IonicContact OE1-NZ 2.62Å; E28-K32 PolarHBondContact OE1-NZ 3.47Å; A29-K32 PolarHBondContact O-N 2.86Å; K32-K34 PolarHBondContact O-N 2.95Å
33	T	73.1	Confident	71.2	Confident	83 Å²	83	106.3 Å²	106.3	51%	0.509	60%	0.595	S	S	.	*			trans	-75	58.3	174.1	-48	0	0	0	112.4	A29 G31 E35 G36	A29-T33 PolarHBondContact O-N 3.2Å; A29-T33 VanDerWaalsContact O-N 3.1Å; A29-T33 PolarHBondContact O-OG1 3.28Å; G31-T33 VanDerWaalsContact C-N 3.31Å; T33-E35 PolarHBondContact O-N 2.87Å; T33-E35 VanDerWaalsContact O-N 3.07Å; T33-G36 PolarHBondContact O-N 3.39Å
34	K	61	Low	70.3	Confident	168 Å²	168	101.5 Å²	101.5	73%	0.73	58%	0.579	S	S	*	*	H	α-helix	trans	-59.5	-17.3	175.4	-66.5	-173	-177	-176.7	113.5	K32	K32-K34 PolarHBondContact O-N 2.95Å
35	E	57	Low	69.4	Low	182 Å²	182	102.5 Å²	102.5	85%	0.85	58%	0.582	S	S	*	*	H	α-helix	trans	-76.4	-30.1	178.7	-98.8	175.9	157.8	0	114.6	T33	T33-E35 PolarHBondContact O-N 2.87Å; T33-E35 VanDerWaalsContact O-N 3.07Å
36	G	58.9	Low	68.5	Low	41 Å²	41	108.7 Å²	108.7	42%	0.423	60%	0.601	S	S	.	*	H	α-helix	trans	-76.3	-25.2	-178.9	0	0	0	0	113.8	T33	T33-G36 PolarHBondContact O-N 3.39Å
37	V	54.1	Low	67.7	Low	104 Å²	104	106.7 Å²	106.7	63%	0.63	60%	0.599	S	S	*	*	H	α-helix	trans	-93	-29.6	-161.5	-174.9	0	0	0	113.4
38	L	58.2	Low	67.4	Low	155 Å²	155	107.2 Å²	107.2	81%	0.812	60%	0.595	S	S	*	*	H	α-helix	trans	-76.8	-30	178.2	-85.4	157.9	0	0	113.3
39	Y	58	Low	67.1	Low	190 Å²	190	106.6 Å²	106.6	75%	0.745	60%	0.599	S	S	*	*	H	α-helix	trans	-89.9	-36	-169.6	-172.8	-107.5	0	0	114.3
40	V	60.2	Low	66.8	Low	76 Å²	76	110.7 Å²	110.7	46%	0.461	61%	0.609	S	S	.	*	H	α-helix	trans	-103	-28.4	-175	-176.9	0	0	0	112.1	S42 K43 T44	V40-S42 PolarHBondContact O-N 3.37Å; V40-K43 PolarHBondContact O-N 3.19Å; V40-T44 VanDerWaalsContact CG1-OG1 3.26Å; V40-T44 WeakPolarHBondContact CG1-OG1 3.3Å; V40-T44 PolarHBondContact O-N 2.88Å; V40-T44 PolarHBondContact O-OG1 3.02Å; V40-T44 VanDerWaalsContact O-OG1 3.14Å
41	G	60.6	Low	66.7	Low	37 Å²	37	109.1 Å²	109.1	38%	0.381	60%	0.598	S	S	.	*	H	α-helix	trans	-56.4	-44.4	-172.7	0	0	0	0	114.3	K45	G41-K45 VanDerWaalsContact O-CB 3.31Å; G41-K45 WeakPolarHBondContact O-CB 3.41Å; G41-K45 PolarHBondContact O-N 3.48Å; G41-K45 VanDerWaalsContact O-N 3.12Å
42	S	61.6	Low	66.9	Low	105 Å²	105	110.7 Å²	110.7	73%	0.734	60%	0.597	S	S	*	*	H	α-helix	trans	-73.9	-34.4	-178.4	-55.8	0	0	0	113.5	V40	V40-S42 PolarHBondContact O-N 3.37Å
43	K	61	Low	67.1	Low	178 Å²	178	107.5 Å²	107.5	77%	0.774	59%	0.59	S	S	*	*	H	α-helix	trans	-77.5	-31.2	180	-74.9	-168.3	177	-176.8	113	V40	V40-K43 PolarHBondContact O-N 3.19Å
44	T	68.1	Low	67.4	Low	62 Å²	62	106.3 Å²	106.3	38%	0.38	58%	0.583	S	S	.	*	H	α-helix	trans	-97	-13	-175.7	-43.7	0	0	0	112.2	V40 E46 G47 V48	V40-T44 VanDerWaalsContact CG1-OG1 3.26Å; V40-T44 WeakPolarHBondContact CG1-OG1 3.3Å; V40-T44 PolarHBondContact O-N 2.88Å; V40-T44 PolarHBondContact O-OG1 3.02Å; V40-T44 VanDerWaalsContact O-OG1 3.14Å; T44-E46 VanDerWaalsContact C-N 3.34Å; T44-E46 PolarHBondContact O-N 2.92Å; T44-G47 PolarHBondContact O-N 2.91Å; T44-V48 HydrophobicContact CG2-CG2 3.41Å; T44-V48 VanDerWaalsContact CG2-CG2 3.41Å; T44-V48 WeakPolarHBondContact O-CB 3.3Å; T44-V48 WeakPolarHBondContact O-CG2 3.33Å; T44-V48 PolarHBondContact O-N 3.36Å
45	K	67.1	Low	68.7	Low	152 Å²	152	102.2 Å²	102.2	66%	0.661	57%	0.572	S	S	*	*	H	α-helix	trans	-54.3	-47	-179.1	-167.6	176.3	-178.6	-176.1	112.9	G41 V49	G41-K45 VanDerWaalsContact O-CB 3.31Å; G41-K45 WeakPolarHBondContact O-CB 3.41Å; G41-K45 PolarHBondContact O-N 3.48Å; G41-K45 VanDerWaalsContact O-N 3.12Å; K45-V49 VanDerWaalsContact O-CG2 3.26Å; K45-V49 WeakPolarHBondContact O-CG2 3.34Å; K45-V49 PolarHBondContact O-N 3.29Å
46	E	66.7	Low	69.8	Low	168 Å²	168	96.2 Å²	96.2	79%	0.785	55%	0.553	S	S	*	*	H	α-helix	trans	-69.5	-42.4	179.6	-67.1	-178.6	171.5	0	112.1	T44 V48 V49 H50	T44-E46 VanDerWaalsContact C-N 3.34Å; T44-E46 PolarHBondContact O-N 2.92Å; E46-V48 PolarHBondContact O-N 3.04Å; E46-V49 PolarHBondContact O-N 2.89Å; E46-H50 PolarHBondContact O-N 3.36Å
47	G	72.7	Confident	71	Confident	52 Å²	52	100.5 Å²	100.5	54%	0.536	56%	0.562	S	S	.	*	H	α-helix	trans	-65.6	-36.2	176.2	0	0	0	0	113.5	T44 G51	T44-G47 PolarHBondContact O-N 2.91Å; G47-G51 PolarHBondContact O-N 3.44Å
48	V	78.5	Confident	72.6	Confident	74 Å²	74	101.8 Å²	101.8	45%	0.448	56%	0.56	S	S	.	*	H	α-helix	trans	-68.8	-41.4	174.8	171.3	0	0	0	110.4	T44 E46 H50 G51 V52	T44-V48 HydrophobicContact CG2-CG2 3.41Å; T44-V48 VanDerWaalsContact CG2-CG2 3.41Å; T44-V48 WeakPolarHBondContact O-CB 3.3Å; T44-V48 WeakPolarHBondContact O-CG2 3.33Å; T44-V48 PolarHBondContact O-N 3.36Å; E46-V48 PolarHBondContact O-N 3.04Å; V48-H50 VanDerWaalsContact C-N 3.32Å; V48-H50 PolarHBondContact O-N 2.81Å; V48-G51 CarbonylContact O-C 3.54Å; V48-G51 PolarHBondContact O-N 2.95Å; V48-V52 HydrophobicContact CG1-CG2 3.72Å; V48-V52 VanDerWaalsContact O-CB 3.27Å; V48-V52 WeakPolarHBondContact O-CB 3.18Å; V48-V52 WeakPolarHBondContact O-CG2 3.49Å; V48-V52 PolarHBondContact O-N 3.21Å
49	V	75.6	Confident	73.8	Confident	94 Å²	94	97.1 Å²	97.1	57%	0.57	54%	0.538	S	S	*	.	H	α-helix	trans	-60.1	-45	177.8	170	0	0	0	110.9	K45 E46 V52 T53	K45-V49 VanDerWaalsContact O-CG2 3.26Å; K45-V49 WeakPolarHBondContact O-CG2 3.34Å; K45-V49 PolarHBondContact O-N 3.29Å; E46-V49 PolarHBondContact O-N 2.89Å; V49-V52 PolarHBondContact O-N 2.95Å; V49-T53 PolarHBondContact O-N 2.85Å; V49-T53 PolarHBondContact O-OG1 3.24Å
50	H	74.6	Confident	75	Confident	141 Å²	141	95.7 Å²	95.7	65%	0.653	54%	0.535	S	S	*	.	H	α-helix	trans	-65.1	-43.1	175	-169.8	71.2	0	0	112.1	E46 V48 V52 T53 T54	E46-H50 PolarHBondContact O-N 3.36Å; V48-H50 VanDerWaalsContact C-N 3.32Å; V48-H50 PolarHBondContact O-N 2.81Å; H50-V52 VanDerWaalsContact C-N 3.33Å; H50-V52 PolarHBondContact O-N 2.84Å; H50-T53 PolarHBondContact O-N 3.34Å; H50-T54 PolarHBondContact O-N 3.01Å; H50-T54 PolarHBondContact O-OG1 2.75Å
51	G	79.3	Confident	76	Confident	30 Å²	30	98.6 Å²	98.6	31%	0.309	54%	0.544	S	S	.	.	H	α-helix	trans	-61.9	-38.1	175.8	0	0	0	0	113.2	G47 V48 T54 V55	G47-G51 PolarHBondContact O-N 3.44Å; V48-G51 CarbonylContact O-C 3.54Å; V48-G51 PolarHBondContact O-N 2.95Å; G51-T54 PolarHBondContact O-N 3.24Å; G51-V55 WeakPolarHBondContact O-CB 3.36Å; G51-V55 WeakPolarHBondContact O-CG2 3.48Å; G51-V55 PolarHBondContact O-N 3.3Å
52	V	82.6	Confident	76.9	Confident	84 Å²	84	102.7 Å²	102.7	51%	0.509	55%	0.553	S	S	.	*	H	α-helix	trans	-67.3	-36.7	179.4	166.8	0	0	0	110.7	V48 V49 H50 V55 A56	V48-V52 HydrophobicContact CG1-CG2 3.72Å; V48-V52 VanDerWaalsContact O-CB 3.27Å; V48-V52 WeakPolarHBondContact O-CB 3.18Å; V48-V52 WeakPolarHBondContact O-CG2 3.49Å; V48-V52 PolarHBondContact O-N 3.21Å; V49-V52 PolarHBondContact O-N 2.95Å; H50-V52 VanDerWaalsContact C-N 3.33Å; H50-V52 PolarHBondContact O-N 2.84Å; V52-V55 PolarHBondContact O-N 3.35Å; V52-A56 WeakPolarHBondContact O-CB 3.4Å; V52-A56 PolarHBondContact O-N 3.5Å
53	T	79.4	Confident	77.9	Confident	81 Å²	81	102 Å²	102	50%	0.497	54%	0.544	S	S	.	.	H	α-helix	trans	-61.5	-50.3	173	-55.6	0	0	0	111.1	V49 H50 V55 A56 E57	V49-T53 PolarHBondContact O-N 2.85Å; V49-T53 PolarHBondContact O-OG1 3.24Å; H50-T53 PolarHBondContact O-N 3.34Å; T53-V55 VanDerWaalsContact C-N 3.34Å; T53-V55 PolarHBondContact O-N 2.95Å; T53-A56 WeakPolarHBondContact O-CB 3.42Å; T53-A56 PolarHBondContact O-N 3.47Å; T53-E57 PolarHBondContact O-N 3.44Å; T53-E57 VanDerWaalsContact O-N 3.07Å
54	T	81.1	Confident	78.9	Confident	58 Å²	58	98 Å²	98	36%	0.356	54%	0.535	S	S	.	.	H	α-helix	trans	-62.2	-40.9	177.5	-56.8	0	0	0	112.3	H50 G51 K58	H50-T54 PolarHBondContact O-N 3.01Å; H50-T54 PolarHBondContact O-OG1 2.75Å; G51-T54 PolarHBondContact O-N 3.24Å; T54-K58 WeakPolarHBondContact O-CG 3.25Å; T54-K58 PolarHBondContact O-N 3.46Å; T54-K58 VanDerWaalsContact O-N 3.16Å
55	V	87.2	Confident	79.7	Confident	83 Å²	83	100.7 Å²	100.7	50%	0.503	55%	0.547	S	S	.	.	H	α-helix	trans	-66.6	-41	175.5	170.2	0	0	0	110	G51 V52 T53 E57 K58 T59	G51-V55 WeakPolarHBondContact O-CB 3.36Å; G51-V55 WeakPolarHBondContact O-CG2 3.48Å; G51-V55 PolarHBondContact O-N 3.3Å; V52-V55 PolarHBondContact O-N 3.35Å; T53-V55 VanDerWaalsContact C-N 3.34Å; T53-V55 PolarHBondContact O-N 2.95Å; V55-E57 VanDerWaalsContact C-N 3.31Å; V55-E57 PolarHBondContact O-N 3.42Å; V55-K58 CarbonylContact O-C 3.59Å; V55-K58 PolarHBondContact O-N 2.95Å; V55-T59 WeakPolarHBondContact O-CA 3.43Å; V55-T59 WeakPolarHBondContact O-CB 3.15Å; V55-T59 PolarHBondContact O-N 2.83Å; V55-T59 PolarHBondContact O-OG1 3.46Å
56	A	80.8	Confident	80.6	Confident	55 Å²	55	97.7 Å²	97.7	46%	0.455	54%	0.541	S	S	.	.	H	α-helix	trans	-60.9	-40.7	179.1	0	0	0	0	111.7	V52 T53 T59 K60	V52-A56 WeakPolarHBondContact O-CB 3.4Å; V52-A56 PolarHBondContact O-N 3.5Å; T53-A56 WeakPolarHBondContact O-CB 3.42Å; T53-A56 PolarHBondContact O-N 3.47Å; A56-T59 PolarHBondContact O-N 2.92Å; A56-K60 WeakPolarHBondContact O-CB 3.38Å; A56-K60 PolarHBondContact O-N 3.42Å
57	E	84.2	Confident	81.5	Confident	131 Å²	131	91.2 Å²	91.2	61%	0.612	52%	0.52	S	S	*	.	H	α-helix	trans	-62	-50.7	173.2	-69.9	-178	163.4	0	111.6	T53 V55 T59 K60 E61	T53-E57 PolarHBondContact O-N 3.44Å; T53-E57 VanDerWaalsContact O-N 3.07Å; V55-E57 VanDerWaalsContact C-N 3.31Å; V55-E57 PolarHBondContact O-N 3.42Å; E57-T59 VanDerWaalsContact C-N 3.31Å; E57-T59 PolarHBondContact O-N 3.45Å; E57-K60 WeakPolarHBondContact O-CB 3.29Å; E57-K60 PolarHBondContact O-N 2.89Å; E57-E61 PolarHBondContact O-N 3.37Å
58	K	86.8	Confident	82.2	Confident	132 Å²	132	90.5 Å²	90.5	57%	0.574	51%	0.512	S	S	*	.	H	α-helix	trans	-62	-37.9	176	-69.4	-178.8	179	-173.2	112.7	T54 V55 K60 E61 Q62	T54-K58 WeakPolarHBondContact O-CG 3.25Å; T54-K58 PolarHBondContact O-N 3.46Å; T54-K58 VanDerWaalsContact O-N 3.16Å; V55-K58 CarbonylContact O-C 3.59Å; V55-K58 PolarHBondContact O-N 2.95Å; K58-K60 VanDerWaalsContact C-N 3.33Å; K58-E61 PolarHBondContact O-N 3.39Å; K58-Q62 WeakPolarHBondContact O-CG 3.33Å; K58-Q62 PolarHBondContact O-N 3.43Å
59	T	83.3	Confident	82.6	Confident	57 Å²	57	89.8 Å²	89.8	35%	0.35	51%	0.514	S	S	.	.	H	α-helix	trans	-67.2	-35.7	178	-65.9	0	0	0	110.2	V55 A56 E57 E61 Q62 V63	V55-T59 WeakPolarHBondContact O-CA 3.43Å; V55-T59 WeakPolarHBondContact O-CB 3.15Å; V55-T59 PolarHBondContact O-N 2.83Å; V55-T59 PolarHBondContact O-OG1 3.46Å; A56-T59 PolarHBondContact O-N 2.92Å; E57-T59 VanDerWaalsContact C-N 3.31Å; E57-T59 PolarHBondContact O-N 3.45Å; T59-E61 VanDerWaalsContact C-N 3.34Å; T59-E61 PolarHBondContact O-N 3.21Å; T59-Q62 CarbonylContact O-C 3.59Å; T59-Q62 PolarHBondContact O-N 2.85Å; T59-V63 HydrophobicContact CG2-CG2 3.81Å; T59-V63 VanDerWaalsContact O-CB 3.28Å; T59-V63 WeakPolarHBondContact O-CB 3.46Å; T59-V63 WeakPolarHBondContact O-CG2 3.34Å; T59-V63 PolarHBondContact O-N 2.94Å
60	K	83.4	Confident	83.3	Confident	159 Å²	159	89.5 Å²	89.5	69%	0.691	51%	0.512	S	S	*	.	H	α-helix	trans	-60.5	-43.9	174.5	-174.4	-179.5	177.7	-177.3	111.7	A56 E57 K58 V63 T64	A56-K60 WeakPolarHBondContact O-CB 3.38Å; A56-K60 PolarHBondContact O-N 3.42Å; E57-K60 WeakPolarHBondContact O-CB 3.29Å; E57-K60 PolarHBondContact O-N 2.89Å; K58-K60 VanDerWaalsContact C-N 3.33Å; K60-V63 PolarHBondContact O-N 2.81Å; K60-T64 PolarHBondContact O-N 3.45Å; K60-T64 PolarHBondContact O-OG1 3.09Å
61	E	82	Confident	84	Confident	138 Å²	138	87.2 Å²	87.2	65%	0.645	51%	0.508	S	S	*	.	H	α-helix	trans	-63.5	-45.6	174.3	-65.8	-178.1	170.4	0	111.3	E57 K58 T59 V63 T64 N65	E57-E61 PolarHBondContact O-N 3.37Å; K58-E61 PolarHBondContact O-N 3.39Å; T59-E61 VanDerWaalsContact C-N 3.34Å; T59-E61 PolarHBondContact O-N 3.21Å; E61-V63 PolarHBondContact O-N 2.91Å; E61-T64 WeakPolarHBondContact O-CB 3.38Å; E61-T64 PolarHBondContact O-N 3.35Å; E61-N65 PolarHBondContact O-N 2.95Å
62	Q	78.6	Confident	84.5	Confident	123 Å²	123	90.2 Å²	90.2	58%	0.575	52%	0.52	S	S	*	.	H	α-helix	trans	-63.5	-41.8	176.7	-72.5	-174.8	-0.3	0	113	K58 T59 T64 N65 V66	K58-Q62 WeakPolarHBondContact O-CG 3.33Å; K58-Q62 PolarHBondContact O-N 3.43Å; T59-Q62 CarbonylContact O-C 3.59Å; T59-Q62 PolarHBondContact O-N 2.85Å; Q62-T64 VanDerWaalsContact C-N 3.25Å; Q62-T64 PolarHBondContact O-N 3.36Å; Q62-N65 PolarHBondContact O-N 2.99Å; Q62-V66 WeakPolarHBondContact O-CB 3.47Å; Q62-V66 VanDerWaalsContact O-CG2 3.24Å; Q62-V66 WeakPolarHBondContact O-CG2 3.3Å; Q62-V66 PolarHBondContact O-N 3.28Å
63	V	82.1	Confident	84.8	Confident	90 Å²	90	87.8 Å²	87.8	55%	0.545	51%	0.512	S	S	.	.	H	α-helix	trans	-63.9	-35.7	177.3	167.6	0	0	0	110.2	T59 K60 E61 G67	T59-V63 HydrophobicContact CG2-CG2 3.81Å; T59-V63 VanDerWaalsContact O-CB 3.28Å; T59-V63 WeakPolarHBondContact O-CB 3.46Å; T59-V63 WeakPolarHBondContact O-CG2 3.34Å; T59-V63 PolarHBondContact O-N 2.94Å; K60-V63 PolarHBondContact O-N 2.81Å; E61-V63 PolarHBondContact O-N 2.91Å; V63-G67 WeakPolarHBondContact O-CA 3.26Å; V63-G67 PolarHBondContact O-N 3.18Å
64	T	83.2	Confident	85.3	Confident	94 Å²	94	88.5 Å²	88.5	58%	0.577	52%	0.516	S	S	*	.	H	α-helix	trans	-65.1	-45.5	173.5	-54.4	0	0	0	110.8	K60 E61 Q62 G67 G68	K60-T64 PolarHBondContact O-N 3.45Å; K60-T64 PolarHBondContact O-OG1 3.09Å; E61-T64 WeakPolarHBondContact O-CB 3.38Å; E61-T64 PolarHBondContact O-N 3.35Å; Q62-T64 VanDerWaalsContact C-N 3.25Å; Q62-T64 PolarHBondContact O-N 3.36Å; T64-G67 PolarHBondContact O-N 2.84Å; T64-G68 PolarHBondContact O-N 3.3Å
65	N	83.9	Confident	85.7	Confident	119 Å²	119	88.9 Å²	88.9	64%	0.636	52%	0.519	S	S	*	.	H	α-helix	trans	-64.1	-44.2	176.7	-69.6	-19.8	0	0	112.5	E61 Q62 G67 G68 A69	E61-N65 PolarHBondContact O-N 2.95Å; Q62-N65 PolarHBondContact O-N 2.99Å; N65-G67 VanDerWaalsContact C-N 3.34Å; N65-G68 PolarHBondContact O-N 3.45Å; N65-A69 PolarHBondContact O-N 3.48Å
66	V	87.5	Confident	85.8	Confident	89 Å²	89	87.5 Å²	87.5	54%	0.539	52%	0.516	S	S	.	.	H	α-helix	trans	-64.5	-41.5	175.7	171.8	0	0	0	110.1	Q62 G68 A69 V70	Q62-V66 WeakPolarHBondContact O-CB 3.47Å; Q62-V66 VanDerWaalsContact O-CG2 3.24Å; Q62-V66 WeakPolarHBondContact O-CG2 3.3Å; Q62-V66 PolarHBondContact O-N 3.28Å; V66-G68 VanDerWaalsContact C-N 3.32Å; V66-G68 PolarHBondContact O-N 2.91Å; V66-A69 CarbonylContact O-C 3.56Å; V66-A69 PolarHBondContact O-N 3.45Å; V66-A69 VanDerWaalsContact O-N 3.14Å; V66-V70 HydrophobicContact CG1-CG2 4.28Å; V66-V70 VanDerWaalsContact O-CG2 3.3Å; V66-V70 WeakPolarHBondContact O-CG2 3.36Å; V66-V70 PolarHBondContact O-N 3.14Å
67	G	84.8	Confident	86.4	Confident	32 Å²	32	89.3 Å²	89.3	33%	0.33	52%	0.521	S	S	.	.	H	α-helix	trans	-57.9	-46.1	174	0	0	0	0	111.4	V63 T64 N65 A69 V70 V71	V63-G67 WeakPolarHBondContact O-CA 3.26Å; V63-G67 PolarHBondContact O-N 3.18Å; T64-G67 PolarHBondContact O-N 2.84Å; N65-G67 VanDerWaalsContact C-N 3.34Å; G67-A69 PolarHBondContact O-N 2.9Å; G67-V70 PolarHBondContact O-N 2.91Å; G67-V71 VanDerWaalsContact O-CG2 3.3Å; G67-V71 WeakPolarHBondContact O-CG2 3.24Å; G67-V71 PolarHBondContact O-N 2.87Å
68	G	86.5	Confident	86.6	Confident	37 Å²	37	85.6 Å²	85.6	38%	0.381	51%	0.512	S	S	.	.	H	α-helix	trans	-57.7	-47.1	171.9	0	0	0	0	112.5	T64 N65 V66 V70 V71 T72	T64-G68 PolarHBondContact O-N 3.3Å; N65-G68 PolarHBondContact O-N 3.45Å; V66-G68 VanDerWaalsContact C-N 3.32Å; V66-G68 PolarHBondContact O-N 2.91Å; G68-V70 PolarHBondContact O-N 2.76Å; G68-V71 PolarHBondContact O-N 2.98Å; G68-T72 WeakPolarHBondContact O-CG2 3.22Å; G68-T72 PolarHBondContact O-N 3.32Å; G68-T72 PolarHBondContact O-OG1 2.81Å
69	A	87.6	Confident	86.7	Confident	59 Å²	59	84.9 Å²	84.9	49%	0.488	51%	0.511	S	S	.	.	H	α-helix	trans	-64.3	-35.7	178.6	0	0	0	0	113.4	N65 V66 G67 T72 G73	N65-A69 PolarHBondContact O-N 3.48Å; V66-A69 CarbonylContact O-C 3.56Å; V66-A69 PolarHBondContact O-N 3.45Å; V66-A69 VanDerWaalsContact O-N 3.14Å; G67-A69 PolarHBondContact O-N 2.9Å; A69-T72 WeakPolarHBondContact CA-OG1 3.36Å; A69-T72 PolarHBondContact O-OG1 3.16Å; A69-G73 PolarHBondContact O-N 3.45Å
70	V	91.4	Very high	87.2	Confident	88 Å²	88	89.8 Å²	89.8	53%	0.533	53%	0.528	S	S	.	.	H	α-helix	trans	-67.5	-45.3	174.9	170.6	0	0	0	110	V66 G67 G68 G73 V74	V66-V70 HydrophobicContact CG1-CG2 4.28Å; V66-V70 VanDerWaalsContact O-CG2 3.3Å; V66-V70 WeakPolarHBondContact O-CG2 3.36Å; V66-V70 PolarHBondContact O-N 3.14Å; G67-V70 PolarHBondContact O-N 2.91Å; G68-V70 PolarHBondContact O-N 2.76Å; V70-G73 PolarHBondContact O-N 3Å; V70-V74 HydrophobicContact CG1-CG2 4.25Å; V70-V74 WeakPolarHBondContact O-CB 3.31Å; V70-V74 WeakPolarHBondContact O-CG2 3.45Å; V70-V74 PolarHBondContact O-N 2.94Å
71	V	87.4	Confident	87.5	Confident	93 Å²	93	86.5 Å²	86.5	56%	0.564	52%	0.521	S	S	*	.	H	α-helix	trans	-63.1	-45	178.1	172.5	0	0	0	111.3	G67 G68 G73 V74 T75	G67-V71 VanDerWaalsContact O-CG2 3.3Å; G67-V71 WeakPolarHBondContact O-CG2 3.24Å; G67-V71 PolarHBondContact O-N 2.87Å; G68-V71 PolarHBondContact O-N 2.98Å; V71-G73 VanDerWaalsContact C-N 3.34Å; V71-V74 PolarHBondContact O-N 3.25Å; V71-T75 WeakPolarHBondContact O-CB 3.15Å; V71-T75 PolarHBondContact O-N 2.82Å; V71-T75 PolarHBondContact O-OG1 2.62Å
72	T	89.7	Confident	87.9	Confident	93 Å²	93	85 Å²	85	57%	0.571	52%	0.521	S	S	*	.	H	α-helix	trans	-64.7	-40.2	176	55.9	0	0	0	111.3	G68 A69 T75 A76	G68-T72 WeakPolarHBondContact O-CG2 3.22Å; G68-T72 PolarHBondContact O-N 3.32Å; G68-T72 PolarHBondContact O-OG1 2.81Å; A69-T72 WeakPolarHBondContact CA-OG1 3.36Å; A69-T72 PolarHBondContact O-OG1 3.16Å; T72-T75 PolarHBondContact O-N 3.44Å; T72-A76 VanDerWaalsContact O-CB 3.26Å; T72-A76 WeakPolarHBondContact O-CB 3.18Å; T72-A76 PolarHBondContact O-N 2.79Å
73	G	89.3	Confident	88.4	Confident	32 Å²	32	85.2 Å²	85.2	33%	0.33	52%	0.522	S	S	.	.	H	α-helix	trans	-60.5	-50	174.7	0	0	0	0	112.7	A69 V70 V71 T75 A76 V77	A69-G73 PolarHBondContact O-N 3.45Å; V70-G73 PolarHBondContact O-N 3Å; V71-G73 VanDerWaalsContact C-N 3.34Å; G73-T75 VanDerWaalsContact C-N 3.33Å; G73-T75 PolarHBondContact O-N 2.9Å; G73-A76 PolarHBondContact O-N 3.33Å; G73-V77 WeakPolarHBondContact O-CB 3.4Å; G73-V77 VanDerWaalsContact O-CG2 3.25Å; G73-V77 WeakPolarHBondContact O-CG2 3.5Å; G73-V77 PolarHBondContact O-N 2.94Å
74	V	90.3	Very high	88.7	Confident	96 Å²	96	82.2 Å²	82.2	58%	0.582	51%	0.509	S	S	*	.	H	α-helix	trans	-60.9	-44.1	177.3	173.3	0	0	0	110.8	V70 V71 V77 A78	V70-V74 HydrophobicContact CG1-CG2 4.25Å; V70-V74 WeakPolarHBondContact O-CB 3.31Å; V70-V74 WeakPolarHBondContact O-CG2 3.45Å; V70-V74 PolarHBondContact O-N 2.94Å; V71-V74 PolarHBondContact O-N 3.25Å; V74-V77 PolarHBondContact O-N 3.42Å; V74-A78 WeakPolarHBondContact O-CB 3.39Å; V74-A78 PolarHBondContact O-N 3.26Å
75	T	89.1	Confident	88.9	Confident	67 Å²	67	80.5 Å²	80.5	41%	0.411	50%	0.504	S	S	.	.	H	α-helix	trans	-62.3	-48.2	178.2	-55.9	0	0	0	111.2	V71 T72 G73 V77 A78 Q79	V71-T75 WeakPolarHBondContact O-CB 3.15Å; V71-T75 PolarHBondContact O-N 2.82Å; V71-T75 PolarHBondContact O-OG1 2.62Å; T72-T75 PolarHBondContact O-N 3.44Å; G73-T75 VanDerWaalsContact C-N 3.33Å; G73-T75 PolarHBondContact O-N 2.9Å; T75-V77 PolarHBondContact O-N 3.02Å; T75-A78 PolarHBondContact O-N 3.41Å; T75-Q79 HydrophobicContact CG2-CG 4.49Å; T75-Q79 WeakPolarHBondContact O-CB 3.34Å; T75-Q79 WeakPolarHBondContact O-CG 3.41Å; T75-Q79 PolarHBondContact O-N 2.76Å
76	A	90.2	Very high	89	Confident	53 Å²	53	76.7 Å²	76.7	44%	0.438	49%	0.494	S	S	.	.	H	α-helix	trans	-63.4	-40.5	178.9	0	0	0	0	112.1	T72 G73 K80	T72-A76 VanDerWaalsContact O-CB 3.26Å; T72-A76 WeakPolarHBondContact O-CB 3.18Å; T72-A76 PolarHBondContact O-N 2.79Å; G73-A76 PolarHBondContact O-N 3.33Å; A76-K80 WeakPolarHBondContact O-CB 3.28Å; A76-K80 PolarHBondContact O-N 3.49Å
77	V	92.1	Very high	89.1	Confident	94 Å²	94	78 Å²	78	57%	0.57	50%	0.497	S	S	*	.	H	α-helix	trans	-63.9	-47.8	174.8	171.1	0	0	0	110.3	G73 V74 T75 Q79 K80 T81	G73-V77 WeakPolarHBondContact O-CB 3.4Å; G73-V77 VanDerWaalsContact O-CG2 3.25Å; G73-V77 WeakPolarHBondContact O-CG2 3.5Å; G73-V77 PolarHBondContact O-N 2.94Å; V74-V77 PolarHBondContact O-N 3.42Å; T75-V77 PolarHBondContact O-N 3.02Å; V77-Q79 PolarHBondContact O-N 2.9Å; V77-K80 PolarHBondContact O-N 3Å; V77-T81 VanDerWaalsContact O-CB 3.29Å; V77-T81 WeakPolarHBondContact O-CB 3.24Å; V77-T81 PolarHBondContact O-N 3.17Å; V77-T81 PolarHBondContact O-OG1 3.33Å
78	A	88.8	Confident	89.1	Confident	52 Å²	52	81.9 Å²	81.9	43%	0.43	51%	0.51	S	S	.	.	H	α-helix	trans	-59.9	-48.6	179.5	0	0	0	0	112.1	V74 T75 T81 V82	V74-A78 WeakPolarHBondContact O-CB 3.39Å; V74-A78 PolarHBondContact O-N 3.26Å; T75-A78 PolarHBondContact O-N 3.41Å; A78-T81 PolarHBondContact O-N 2.71Å; A78-V82 WeakPolarHBondContact O-CG2 3.34Å; A78-V82 PolarHBondContact O-N 3.26Å
79	Q	90.3	Very high	89	Confident	117 Å²	117	81.7 Å²	81.7	55%	0.547	50%	0.504	S	S	.	.	H	α-helix	trans	-59.5	-50.4	176.8	-72.7	178	-41.6	0	111.2	T75 V77 T81 V82 E83	T75-Q79 HydrophobicContact CG2-CG 4.49Å; T75-Q79 WeakPolarHBondContact O-CB 3.34Å; T75-Q79 WeakPolarHBondContact O-CG 3.41Å; T75-Q79 PolarHBondContact O-N 2.76Å; V77-Q79 PolarHBondContact O-N 2.9Å; Q79-T81 VanDerWaalsContact C-N 3.31Å; Q79-T81 PolarHBondContact O-N 2.87Å; Q79-V82 PolarHBondContact O-N 3.24Å; Q79-E83 WeakPolarHBondContact O-CG 3.3Å; Q79-E83 PolarHBondContact O-N 3.45Å
80	K	92.5	Very high	88.8	Confident	160 Å²	160	81.7 Å²	81.7	70%	0.696	50%	0.504	S	S	*	.	H	α-helix	trans	-65.8	-32	-179.4	-166.9	173.8	-173.4	176.6	113	A76 V77 G84	A76-K80 WeakPolarHBondContact O-CB 3.28Å; A76-K80 PolarHBondContact O-N 3.49Å; V77-K80 PolarHBondContact O-N 3Å; K80-G84 PolarHBondContact O-N 2.96Å
81	T	90.4	Very high	88.4	Confident	90 Å²	90	81.8 Å²	81.8	55%	0.552	51%	0.514	S	S	*	.	H	α-helix	trans	-68.9	-41.7	174.7	-66.5	0	0	0	111.3	V77 A78 Q79 G84 A85	V77-T81 VanDerWaalsContact O-CB 3.29Å; V77-T81 WeakPolarHBondContact O-CB 3.24Å; V77-T81 PolarHBondContact O-N 3.17Å; V77-T81 PolarHBondContact O-OG1 3.33Å; A78-T81 PolarHBondContact O-N 2.71Å; Q79-T81 VanDerWaalsContact C-N 3.31Å; Q79-T81 PolarHBondContact O-N 2.87Å; T81-G84 PolarHBondContact O-N 3.49Å; T81-A85 VanDerWaalsContact O-CB 3.31Å; T81-A85 WeakPolarHBondContact O-CB 3.48Å; T81-A85 PolarHBondContact O-N 2.98Å
82	V	90.5	Very high	88.3	Confident	107 Å²	107	81.3 Å²	81.3	65%	0.648	51%	0.512	S	S	*	.	H	α-helix	trans	-65.3	-47	175.9	173	0	0	0	110.8	A78 Q79 G84 A85 G86	A78-V82 WeakPolarHBondContact O-CG2 3.34Å; A78-V82 PolarHBondContact O-N 3.26Å; Q79-V82 PolarHBondContact O-N 3.24Å; V82-G84 VanDerWaalsContact C-N 3.35Å; V82-G84 PolarHBondContact O-N 3.34Å; V82-A85 PolarHBondContact O-N 2.95Å; V82-G86 PolarHBondContact O-N 3.35Å
83	E	89.4	Confident	87.9	Confident	128 Å²	128	79.1 Å²	79.1	60%	0.598	51%	0.507	S	S	*	.	H	α-helix	trans	-60.3	-43.8	174.8	-71.3	174.2	-170.6	0	111.8	Q79 G86 N87	Q79-E83 WeakPolarHBondContact O-CG 3.3Å; Q79-E83 PolarHBondContact O-N 3.45Å; E83-G86 PolarHBondContact O-N 3.18Å; E83-N87 WeakPolarHBondContact O-CB 3.35Å; E83-N87 VanDerWaalsContact O-CG 3.29Å; E83-N87 PolarHBondContact O-N 3.46Å; E83-N87 PolarHBondContact O-ND2 3.29Å
84	G	87.5	Confident	87.6	Confident	27 Å²	27	85.5 Å²	85.5	28%	0.278	53%	0.526	S	S	.	.	H	α-helix	trans	-62.8	-44.7	177.1	0	0	0	0	112.6	K80 T81 V82 N87 I88	K80-G84 PolarHBondContact O-N 2.96Å; T81-G84 PolarHBondContact O-N 3.49Å; V82-G84 VanDerWaalsContact C-N 3.35Å; V82-G84 PolarHBondContact O-N 3.34Å; G84-N87 PolarHBondContact O-N 3.5Å; G84-I88 WeakPolarHBondContact O-CD1 3.43Å; G84-I88 VanDerWaalsContact O-CG1 3.23Å; G84-I88 WeakPolarHBondContact O-CG1 3.48Å; G84-I88 PolarHBondContact O-N 3.43Å
85	A	86.8	Confident	87.1	Confident	57 Å²	57	85.6 Å²	85.6	47%	0.471	53%	0.527	S	S	.	.	H	α-helix	trans	-63.3	-41.9	175.7	0	0	0	0	111.7	T81 V82 I88 A89	T81-A85 VanDerWaalsContact O-CB 3.31Å; T81-A85 WeakPolarHBondContact O-CB 3.48Å; T81-A85 PolarHBondContact O-N 2.98Å; V82-A85 PolarHBondContact O-N 2.95Å; A85-I88 PolarHBondContact O-N 3.07Å; A85-A89 WeakPolarHBondContact O-CB 3.27Å; A85-A89 PolarHBondContact O-N 3.17Å
86	G	86.2	Confident	86.6	Confident	40 Å²	40	92.5 Å²	92.5	41%	0.412	55%	0.551	S	S	.	*	H	α-helix	trans	-61.1	-44.8	174.1	0	0	0	0	112.4	V82 E83 I88 A89 A90	V82-G86 PolarHBondContact O-N 3.35Å; E83-G86 PolarHBondContact O-N 3.18Å; G86-I88 PolarHBondContact O-N 3.38Å; G86-A89 PolarHBondContact O-N 3.36Å; G86-A90 WeakPolarHBondContact O-CB 3.13Å; G86-A90 PolarHBondContact O-N 3.37Å
87	N	89.5	Confident	85.9	Confident	115 Å²	115	97 Å²	97	62%	0.615	56%	0.561	S	S	*	*	H	α-helix	trans	-63.8	-39	176.3	-75.4	-17.3	0	0	112.3	E83 G84 A90 A91	E83-N87 WeakPolarHBondContact O-CB 3.35Å; E83-N87 VanDerWaalsContact O-CG 3.29Å; E83-N87 PolarHBondContact O-N 3.46Å; E83-N87 PolarHBondContact O-ND2 3.29Å; G84-N87 PolarHBondContact O-N 3.5Å; N87-A90 PolarHBondContact O-N 3.46Å; N87-A91 VanDerWaalsContact O-CB 3.23Å; N87-A91 WeakPolarHBondContact O-CB 3.44Å; N87-A91 PolarHBondContact O-N 3.21Å
88	I	86.2	Confident	85.1	Confident	115 Å²	115	100.5 Å²	100.5	59%	0.59	58%	0.577	S	S	*	*	H	α-helix	trans	-64.3	-48	174.8	-67.8	162.2	0	0	109.9	G84 A85 G86 A90 A91 T92	G84-I88 WeakPolarHBondContact O-CD1 3.43Å; G84-I88 VanDerWaalsContact O-CG1 3.23Å; G84-I88 WeakPolarHBondContact O-CG1 3.48Å; G84-I88 PolarHBondContact O-N 3.43Å; A85-I88 PolarHBondContact O-N 3.07Å; G86-I88 PolarHBondContact O-N 3.38Å; I88-A90 VanDerWaalsContact C-N 3.3Å; I88-A90 PolarHBondContact O-N 2.73Å; I88-A91 PolarHBondContact O-N 3.16Å; I88-T92 HydrophobicContact CG2-CG2 4.31Å; I88-T92 WeakPolarHBondContact O-CG2 3.19Å; I88-T92 PolarHBondContact O-N 3.38Å; I88-T92 PolarHBondContact O-OG1 2.9Å
89	A	83.7	Confident	84.3	Confident	32 Å²	32	104.4 Å²	104.4	26%	0.264	59%	0.586	S	S	.	*	H	α-helix	trans	-61.6	-38.2	178.5	0	0	0	0	112.6	A85 G86 T92 G93 F94	A85-A89 WeakPolarHBondContact O-CB 3.27Å; A85-A89 PolarHBondContact O-N 3.17Å; G86-A89 PolarHBondContact O-N 3.36Å; A89-T92 WeakPolarHBondContact CA-OG1 3.14Å; A89-T92 PolarHBondContact O-OG1 3.43Å; A89-T92 VanDerWaalsContact O-OG1 3.07Å; A89-G93 PolarHBondContact O-N 2.89Å; A89-F94 HydrophobicContact CB-CD1 4.41Å; A89-F94 HydrophobicContact CB-CE1 3.85Å; A89-F94 HydrophobicContact CB-CZ 4.12Å; A89-F94 PolarHBondContact O-N 2.85Å
90	A	83.9	Confident	82.8	Confident	59 Å²	59	108.6 Å²	108.6	49%	0.488	61%	0.608	S	S	.	*	H	α-helix	trans	-67.1	-43.1	174.1	0	0	0	0	111.8	G86 N87 I88 G93	G86-A90 WeakPolarHBondContact O-CB 3.13Å; G86-A90 PolarHBondContact O-N 3.37Å; N87-A90 PolarHBondContact O-N 3.46Å; I88-A90 VanDerWaalsContact C-N 3.3Å; I88-A90 PolarHBondContact O-N 2.73Å; A90-G93 PolarHBondContact O-N 2.68Å; A90-G93 VanDerWaalsContact O-N 3.12Å
91	A	83	Confident	81.6	Confident	90 Å²	90	103.7 Å²	103.7	74%	0.744	60%	0.603	S	S	*	*	H	α-helix	trans	-68.6	-33.8	178.8	0	0	0	0	112.9	N87 I88 G93	N87-A91 VanDerWaalsContact O-CB 3.23Å; N87-A91 WeakPolarHBondContact O-CB 3.44Å; N87-A91 PolarHBondContact O-N 3.21Å; I88-A91 PolarHBondContact O-N 3.16Å; A91-G93 PolarHBondContact O-N 2.99Å
92	T	84.1	Confident	80.4	Confident	83 Å²	83	109 Å²	109	51%	0.509	62%	0.619	S	S	.	*	T	Hydrogen-bonded Turn	trans	-76.8	-3.6	172.8	60.1	0	0	0	112.9	I88 A89 F94 V95	I88-T92 HydrophobicContact CG2-CG2 4.31Å; I88-T92 WeakPolarHBondContact O-CG2 3.19Å; I88-T92 PolarHBondContact O-N 3.38Å; I88-T92 PolarHBondContact O-OG1 2.9Å; A89-T92 WeakPolarHBondContact CA-OG1 3.14Å; A89-T92 PolarHBondContact O-OG1 3.43Å; A89-T92 VanDerWaalsContact O-OG1 3.07Å; T92-F94 PolarHBondContact O-N 3.26Å; T92-V95 WeakPolarHBondContact O-CG2 3.26Å; T92-V95 PolarHBondContact O-N 3.07Å
93	G	82.6	Confident	79.2	Confident	47 Å²	47	106.9 Å²	106.9	49%	0.485	62%	0.618	S	S	.	*	T	Hydrogen-bonded Turn	trans	65.3	22.3	177	0	0	0	0	114.2	A89 A90 A91 V95	A89-G93 PolarHBondContact O-N 2.89Å; A90-G93 PolarHBondContact O-N 2.68Å; A90-G93 VanDerWaalsContact O-N 3.12Å; A91-G93 PolarHBondContact O-N 2.99Å; G93-V95 PolarHBondContact O-N 2.96Å; G93-V95 VanDerWaalsContact O-N 3.17Å
94	F	82.7	Confident	77.8	Confident	166 Å²	166	110 Å²	110	73%	0.728	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	54.9	28.5	-175.5	-60.1	-89.2	0	0	114.3	A89 T92	A89-F94 HydrophobicContact CB-CD1 4.41Å; A89-F94 HydrophobicContact CB-CE1 3.85Å; A89-F94 HydrophobicContact CB-CZ 4.12Å; A89-F94 PolarHBondContact O-N 2.85Å; T92-F94 PolarHBondContact O-N 3.26Å
95	V	80.1	Confident	76.9	Confident	98 Å²	98	118 Å²	118	59%	0.594	66%	0.663	S	S	*	*			trans	-79.9	133	-177.4	-172.2	0	0	0	110.7	T92 G93 K97	T92-V95 WeakPolarHBondContact O-CG2 3.26Å; T92-V95 PolarHBondContact O-N 3.07Å; G93-V95 PolarHBondContact O-N 2.96Å; G93-V95 VanDerWaalsContact O-N 3.17Å; V95-K97 WeakPolarHBondContact CG1-O 3.21Å
96	K	78.3	Confident	76.1	Confident	212 Å²	212	118.3 Å²	118.3	92%	0.922	67%	0.672	S	S	*	*	S	Bend	trans	-71.8	-33.2	179.4	-68.1	-176.9	-178.7	179	113.8
97	K	75.8	Confident	75.5	Confident	147 Å²	147	127 Å²	127	64%	0.639	69%	0.694	S	S	*	*	S	Bend	trans	-138.9	127	177.8	-73.3	-176.9	-179	167.5	108.8	V95 Q99	V95-K97 WeakPolarHBondContact CG1-O 3.21Å; K97-Q99 VanDerWaalsContact C-N 3.29Å; K97-Q99 HydrophobicContact CB-CG 4.32Å; K97-Q99 PolarHBondContact O-N 3.1Å
98	D	75.2	Confident	74.6	Confident	168 Å²	168	127.6 Å²	127.6	90%	0.898	70%	0.704	S	S	*	*			trans	-70.1	88.3	171.3	-167.5	14.1	0	0	108.7
99	Q	71.5	Confident	74.1	Confident	135 Å²	135	131.2 Å²	131.2	63%	0.631	72%	0.718	S	S	*	*			trans	-119	114.3	175.2	-77.8	-172.6	34.8	0	108.9	K97 G101	K97-Q99 VanDerWaalsContact C-N 3.29Å; K97-Q99 HydrophobicContact CB-CG 4.32Å; K97-Q99 PolarHBondContact O-N 3.1Å; Q99-G101 PolarHBondContact O-N 3.46Å
100	M	59.8	Low	73.9	Confident	204 Å²	204	139.3 Å²	139.3	100%	1.005	75%	0.751	S	S	*	*			trans	-93.5	85.4	174	-153.5	166.8	-162.4	0	108.7
101	G	65.7	Low	73.8	Confident	57 Å²	57	140 Å²	140	59%	0.588	76%	0.763	S	S	*	*	S	Bend	trans	166.8	146.1	178.8	0	0	0	0	111.7	Q99 G103	Q99-G101 PolarHBondContact O-N 3.46Å; G101-G103 PolarHBondContact O-N 3.33Å
102	K	65.2	Low	73.7	Confident	203 Å²	203	143.4 Å²	143.4	88%	0.883	77%	0.767	S	S	*	*			trans	-71.1	124.7	162.8	-71.7	-178.5	175.3	-178.8	106	E104	K102-E104 PolarHBondContact O-N 3.35Å
103	G	67	Low	73.5	Confident	62 Å²	62	147 Å²	147	64%	0.639	78%	0.783	S	S	*	*			trans	-58.5	104.3	168.7	0	0	0	0	107.5	G101 E105	G101-G103 PolarHBondContact O-N 3.33Å; G103-E105 VanDerWaalsContact C-N 3.32Å; G103-E105 PolarHBondContact O-N 3.34Å
104	E	59.7	Low	73.5	Confident	192 Å²	192	154.1 Å²	154.1	90%	0.897	80%	0.803	S	S	*	*			trans	-69.6	98.4	171.7	-76.4	-173.4	131.7	0	106.8	K102 G106	K102-E104 PolarHBondContact O-N 3.35Å; E104-G106 PolarHBondContact O-N 3.21Å
105	E	68.1	Low	73.7	Confident	195 Å²	195	152.8 Å²	152.8	91%	0.911	80%	0.804	S	S	*	*			trans	-70.5	115.9	170.3	-67.6	-177.6	171.9	0	107.6	G103	G103-E105 VanDerWaalsContact C-N 3.32Å; G103-E105 PolarHBondContact O-N 3.34Å
106	G	70	Confident	73.8	Confident	65 Å²	65	155.9 Å²	155.9	67%	0.67	81%	0.814	S	S	*	*			trans	-68.7	179.3	176.7	0	0	0	0	112.5	E104	E104-G106 PolarHBondContact O-N 3.21Å
107	Y	74.1	Confident	74.1	Confident	222 Å²	222	151.4 Å²	151.4	87%	0.871	81%	0.806	S	S	*	*	S	Bend	trans	-55	143.6	-179.9	-60.3	-86.1	0	0	112.4	Q109	Y107-Q109 PolarHBondContact O-N 3.44Å
108	P	70.2	Confident	74.6	Confident	127 Å²	127	150.9 Å²	150.9	83%	0.825	82%	0.815	S	S	*	*			trans	-59	125	179.6	24.4	-33.3	0	0	110.3
109	Q	75.7	Confident	74.9	Confident	192 Å²	192	147 Å²	147	90%	0.897	79%	0.794	S	S	*	*			trans	-110.4	125.5	167.1	-73.7	-171.4	1.9	0	108.7	Y107	Y107-Q109 PolarHBondContact O-N 3.44Å
110	E	79.8	Confident	75.5	Confident	201 Å²	201	146.5 Å²	146.5	94%	0.939	80%	0.803	S	S	*	*			trans	-91.3	133.1	169	-67.9	-176.8	165.8	0	109.1
111	G	81.3	Confident	76.7	Confident	73 Å²	73	139.9 Å²	139.9	75%	0.753	78%	0.777	S	S	*	*			trans	-155.5	149.5	175.7	0	0	0	0	110
112	I	81.6	Confident	77.4	Confident	162 Å²	162	140.9 Å²	140.9	83%	0.831	78%	0.775	S	S	*	*			trans	-89.6	131.4	168.9	55.5	174.7	0	0	108.2
113	L	79.9	Confident	78.1	Confident	159 Å²	159	139.6 Å²	139.6	83%	0.832	77%	0.772	S	S	*	*			trans	-78.1	124	167.6	-62.7	176.4	0	0	107.3
114	E	82.2	Confident	78.8	Confident	197 Å²	197	139.7 Å²	139.7	92%	0.921	77%	0.767	S	S	*	*	S	Bend	trans	-69.1	-28	175.3	-68.8	-174.5	165.1	0	111.8
115	D	85.7	Confident	79.8	Confident	137 Å²	137	142.1 Å²	142.1	73%	0.733	77%	0.769	S	S	*	*	S	Bend	trans	-84.6	127.8	177.3	-156.8	17.1	0	0	110
116	M	82.1	Confident	80.4	Confident	163 Å²	163	140.8 Å²	140.8	80%	0.803	76%	0.763	S	S	*	*	P	Polyproline II helix	trans	-65.1	136.1	174.8	-78.4	-174.7	-73.9	0	109	V118	M116-V118 PolarHBondContact O-N 2.8Å
117	P	84.6	Confident	80.9	Confident	118 Å²	118	142.5 Å²	142.5	77%	0.766	76%	0.755	S	S	*	*	P	Polyproline II helix	trans	-60.9	136.3	177.2	26.4	-33.4	0	0	109.6	D119	P117-D119 PolarHBondContact O-N 3.21Å
118	V	87.1	Confident	81.3	Confident	137 Å²	137	135.6 Å²	135.6	83%	0.83	74%	0.737	S	S	*	*			trans	-66.9	106.4	168.5	-179.6	0	0	0	107.1	M116 P120	M116-V118 PolarHBondContact O-N 2.8Å; V118-P120 VanDerWaalsContact O-CD 3.26Å; V118-P120 WeakPolarHBondContact O-CD 3.35Å
119	D	81.7	Confident	82	Confident	85 Å²	85	134.8 Å²	134.8	46%	0.455	74%	0.735	S	S	.	*			trans	-77.4	112.2	167.2	-168.9	-14.5	0	0	108.3	P117 S121	P117-D119 PolarHBondContact O-N 3.21Å; D119-S121 VanDerWaalsContact CG-OG 3.22Å; D119-S121 PolarHBondContact O-N 3.41Å; D119-S121 WeakPolarHBondContact OD1-CA 3.31Å; D119-S121 VanDerWaalsContact OD1-CB 3.28Å; D119-S121 WeakPolarHBondContact OD1-CB 3.32Å; D119-S121 PolarHBondContact OD1-N 3.39Å; D119-S121 PolarHBondContact OD1-OG 3.33Å; D119-S121 PolarHBondContact OD2-OG 3.04Å
120	P	84.9	Confident	82.4	Confident	126 Å²	126	134.4 Å²	134.4	82%	0.818	73%	0.733	S	S	*	*	S	Bend	trans	-70.7	-17.6	176.8	31.4	-36	0	0	112	V118	V118-P120 VanDerWaalsContact O-CD 3.26Å; V118-P120 WeakPolarHBondContact O-CD 3.35Å
121	S	83.5	Confident	82.1	Confident	64 Å²	64	131.1 Å²	131.1	45%	0.448	72%	0.718	S	S	.	*	S	Bend	trans	-79.7	133.8	172.1	83.4	0	0	0	108.8	D119 E123	D119-S121 VanDerWaalsContact CG-OG 3.22Å; D119-S121 PolarHBondContact O-N 3.41Å; D119-S121 WeakPolarHBondContact OD1-CA 3.31Å; D119-S121 VanDerWaalsContact OD1-CB 3.28Å; D119-S121 WeakPolarHBondContact OD1-CB 3.32Å; D119-S121 PolarHBondContact OD1-N 3.39Å; D119-S121 PolarHBondContact OD1-OG 3.33Å; D119-S121 PolarHBondContact OD2-OG 3.04Å; S121-E123 PolarHBondContact O-N 3.48Å
122	S	80.3	Confident	81.8	Confident	79 Å²	79	129.9 Å²	129.9	55%	0.552	71%	0.705	S	S	*	*			trans	-73.7	-1.8	178.4	49.6	0	0	0	113.1	A124	S122-A124 WeakPolarHBondContact O-CB 3.17Å; S122-A124 PolarHBondContact O-N 2.7Å
123	E	79.6	Confident	81.7	Confident	175 Å²	175	130.2 Å²	130.2	82%	0.818	70%	0.697	S	S	*	*	S	Bend	trans	41.4	23	-168.8	-65.2	-163.1	128.2	0	114.4	S121	S121-E123 PolarHBondContact O-N 3.48Å
124	A	82.7	Confident	81.7	Confident	65 Å²	65	131 Å²	131	54%	0.537	70%	0.696	S	S	.	*	S	Bend	trans	-129.7	142	-174.5	0	0	0	0	109.3	S122 E126	S122-A124 WeakPolarHBondContact O-CB 3.17Å; S122-A124 PolarHBondContact O-N 2.7Å; A124-E126 PolarHBondContact O-N 3.2Å
125	Y	81.2	Confident	81.8	Confident	242 Å²	242	128.3 Å²	128.3	95%	0.949	69%	0.688	S	S	*	*			trans	-67.8	101.8	164.5	-81.3	-84.8	0	0	108.2
126	E	80.3	Confident	81.7	Confident	167 Å²	167	131.4 Å²	131.4	78%	0.78	69%	0.691	S	S	*	*	P	Polyproline II helix	trans	-79.2	122.7	171.3	-164.7	170.1	-174.6	0	108.6	A124	A124-E126 PolarHBondContact O-N 3.2Å
127	M	81.1	Confident	81.5	Confident	101 Å²	101	131.9 Å²	131.9	50%	0.498	69%	0.691	S	S	.	*	P	Polyproline II helix	trans	-62.7	135.2	175.3	-67.1	-112.8	-61.6	0	108.9	S129 E131	M127-S129 PolarHBondContact O-N 2.9Å; M127-E131 WeakPolarHBondContact CE-OE2 3.26Å
128	P	82.7	Confident	81.3	Confident	77 Å²	77	131.8 Å²	131.8	50%	0.5	69%	0.691	S	S	.	*	P	Polyproline II helix	trans	-58.9	134.5	177.3	25.4	-32.6	0	0	109.5	E130 E131	P128-E130 PolarHBondContact O-N 3.29Å; P128-E131 HydrophobicContact CG-CG 4.47Å; P128-E131 PolarHBondContact O-N 3.12Å
129	S	84.4	Confident	80.8	Confident	111 Å²	111	133.9 Å²	133.9	78%	0.776	69%	0.691	S	S	*	*	G	3₁₀ helix	trans	-61.9	-11.7	179.5	52.7	0	0	0	113.8	M127 E131 G132	M127-S129 PolarHBondContact O-N 2.9Å; S129-E131 VanDerWaalsContact C-N 3.29Å; S129-E131 PolarHBondContact O-N 3.22Å; S129-G132 PolarHBondContact O-N 3.29Å
130	E	83.4	Confident	80	Confident	183 Å²	183	137.7 Å²	137.7	86%	0.855	74%	0.735	S	S	*	*	G	3₁₀ helix	trans	-62.4	-29.6	173.9	-66.7	-169.2	160.6	0	113.5	P128 G132	P128-E130 PolarHBondContact O-N 3.29Å; E130-G132 PolarHBondContact O-N 2.75Å
131	E	74.7	Confident	79.7	Confident	133 Å²	133	138.3 Å²	138.3	62%	0.621	73%	0.73	S	S	*	*	G	3₁₀ helix	trans	-70.2	-18.3	-179.8	-69.4	-163.1	167.5	0	112.7	M127 P128 S129	M127-E131 WeakPolarHBondContact CE-OE2 3.26Å; P128-E131 HydrophobicContact CG-CG 4.47Å; P128-E131 PolarHBondContact O-N 3.12Å; S129-E131 VanDerWaalsContact C-N 3.29Å; S129-E131 PolarHBondContact O-N 3.22Å
132	G	74.8	Confident	79.5	Confident	46 Å²	46	142.2 Å²	142.2	47%	0.474	75%	0.745	S	S	.	*			trans	60.5	162.1	-175.6	0	0	0	0	112.4	S129 E130	S129-G132 PolarHBondContact O-N 3.29Å; E130-G132 PolarHBondContact O-N 2.75Å
133	Y	78	Confident	79.5	Confident	170 Å²	170	145.7 Å²	145.7	67%	0.667	76%	0.756	S	S	*	*			trans	-112.4	130.1	168.6	-65.5	-85.4	0	0	107.1	D135	Y133-D135 PolarHBondContact O-N 3.25Å
134	Q	80.4	Confident	79.5	Confident	176 Å²	176	144 Å²	144	82%	0.822	75%	0.752	S	S	*	*			trans	-75.7	105.3	170.7	-78.9	-176.8	2.3	0	108.3	Y136	Q134-Y136 PolarHBondContact O-N 3.14Å
135	D	85.2	Confident	79.3	Confident	140 Å²	140	148.9 Å²	148.9	75%	0.749	77%	0.766	S	S	*	*			trans	-79.4	4.7	178.6	-64.6	-28.4	0	0	113.6	Y133	Y133-D135 PolarHBondContact O-N 3.25Å
136	Y	83.6	Confident	79.1	Confident	202 Å²	202	142.7 Å²	142.7	79%	0.792	75%	0.754	S	S	*	*	S	Bend	trans	-131.4	134	-177.7	-58.6	-90	0	0	110.5	Q134	Q134-Y136 PolarHBondContact O-N 3.14Å
137	E	77	Confident	79	Confident	173 Å²	173	141 Å²	141	81%	0.808	75%	0.752	S	S	*	*			trans	-71.4	139.1	168.6	-86	-179	142.5	0	110.3	E139	E137-E139 PolarHBondContact O-N 3.04Å; E137-E139 VanDerWaalsContact O-N 3.15Å
138	P	81.5	Confident	78.9	Confident	116 Å²	116	144.1 Å²	144.1	75%	0.753	77%	0.771	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.5	-3.9	-178.5	26.9	-34	0	0	115.2
139	E	75.9	Confident	78.6	Confident	181 Å²	181	149.7 Å²	149.7	85%	0.846	79%	0.794	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111.4	35.8	-167.4	-69.8	-84.6	161	0	114.2	E137	E137-E139 PolarHBondContact O-N 3.04Å; E137-E139 VanDerWaalsContact O-N 3.15Å
140	A	63.9	Low	78	Confident	165 Å²	165	153.2 Å²	153.2	100%	1.364	80%	0.796	S	S	*	*			trans	-90	0	169.3	0	0	0	0	112.8

Retrieved 140 of 140 residues in 835.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).