PPLA_RABIT Loading...

Phospholamban

Reversibly inhibits the activity of ATP2A2/SERCA2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Binds preferentially to the ATP-bound E1 conformational form of ATP2A2 which predominates at low Ca(2+) concentrations during the diastolic phase of the cardiac cycle. Inhibits ATP2A2 Ca(2+) affinity by disrupting its allosteric activation by ATP. Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation. Also inhibits the activity of ATP2A3/SERCA3. Controls intracellular Ca(2+) levels in elongated spermatids and may play a role in germ cell differentiation. In the thalamic reticular nucleus of the brain, plays a role in the regulation of sleep patterns and executive functioning.

AlphaFold DB , UniProt , Accession P61015, Species RABIT (Oryctolagus cuniculus, Rabbit), Gene PLN, Length 52 aa.

						>PPLA_RABIT|P61015|PLN
MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	55.4	Low	66	Low	222 Å²	222	134.1 Å²	134.1	100%	1.094	65%	0.653	S	S	*	*				0	-15.3	0	-92.1	164.1	142	0	0	113.9	K3	M1-K3 PolarHBondContact O-N 3.43Å
2	E	61.8	Low	66	Low	163 Å²	163	131.8 Å²	131.8	76%	0.762	64%	0.644	S	S	*	*	H	α-helix	trans	-68.5	-30.6	-174.2	-68.3	164.5	97.7	0	0	115.7	V4 Q5	E2-V4 VanDerWaalsContact C-N 3.3Å; E2-V4 PolarHBondContact O-N 3.39Å; E2-Q5 PolarHBondContact O-N 3.45Å
3	K	62.7	Low	66	Low	188 Å²	188	136.6 Å²	136.6	82%	0.817	65%	0.651	S	S	*	*	H	α-helix	trans	-62.4	-32.9	-177.8	-82.6	-173.6	177.3	179	0	113.9	M1 L7	M1-K3 PolarHBondContact O-N 3.43Å; K3-L7 PolarHBondContact O-N 3.3Å
4	V	65.3	Low	65.7	Low	97 Å²	97	140.8 Å²	140.8	59%	0.588	66%	0.657	S	S	*	*	H	α-helix	trans	-72.2	-40.4	-177.1	-174.8	0	0	0	0	110.8	E2 Y6 L7 T8	E2-V4 VanDerWaalsContact C-N 3.3Å; E2-V4 PolarHBondContact O-N 3.39Å; V4-Y6 VanDerWaalsContact C-N 3.28Å; V4-Y6 PolarHBondContact O-N 3.09Å; V4-L7 PolarHBondContact O-N 3.29Å; V4-T8 PolarHBondContact O-N 3.44Å; V4-T8 PolarHBondContact O-OG1 3.3Å; V4-T8 VanDerWaalsContact O-OG1 3.09Å
5	Q	65.8	Low	65.6	Low	141 Å²	141	135.1 Å²	135.1	66%	0.659	64%	0.644	S	S	*	*	H	α-helix	trans	-62.3	-35.2	-179.7	-68.8	-177.4	-76	0	0	112.4	E2 R9	E2-Q5 PolarHBondContact O-N 3.45Å; Q5-R9 WeakPolarHBondContact O-CB 3.37Å; Q5-R9 PolarHBondContact O-N 2.96Å
6	Y	67.2	Low	65.4	Low	180 Å²	180	131.8 Å²	131.8	71%	0.706	64%	0.639	S	S	*	*	H	α-helix	trans	-66.4	-45.3	175.4	-175.5	-92.3	0	0	0	112.1	V4 T8 R9 S10	V4-Y6 VanDerWaalsContact C-N 3.28Å; V4-Y6 PolarHBondContact O-N 3.09Å; Y6-T8 PolarHBondContact O-N 2.94Å; Y6-R9 PolarHBondContact O-N 2.99Å; Y6-S10 PolarHBondContact O-N 3.48Å; Y6-S10 PolarHBondContact O-OG 3.18Å
7	L	68.6	Low	65.1	Low	115 Å²	115	129.7 Å²	129.7	60%	0.602	64%	0.636	S	S	*	*	H	α-helix	trans	-58.7	-48.5	176.2	-80.6	165.8	0	0	0	110.8	K3 V4 R9 S10 A11	K3-L7 PolarHBondContact O-N 3.3Å; V4-L7 PolarHBondContact O-N 3.29Å; L7-R9 PolarHBondContact O-N 2.91Å; L7-S10 PolarHBondContact O-N 2.75Å; L7-S10 PolarHBondContact O-OG 3.25Å; L7-A11 WeakPolarHBondContact O-CB 3.44Å; L7-A11 PolarHBondContact O-N 3.44Å
8	T	71.6	Confident	64.7	Low	72 Å²	72	128.8 Å²	128.8	44%	0.442	63%	0.634	S	S	.	*	H	α-helix	trans	-60.9	-44.3	177.9	-50.7	0	0	0	0	111.7	V4 Y6 S10 A11 I12	V4-T8 PolarHBondContact O-N 3.44Å; V4-T8 PolarHBondContact O-OG1 3.3Å; V4-T8 VanDerWaalsContact O-OG1 3.09Å; Y6-T8 PolarHBondContact O-N 2.94Å; T8-S10 VanDerWaalsContact C-N 3.34Å; T8-S10 PolarHBondContact O-N 3.28Å; T8-A11 PolarHBondContact O-N 3.42Å; T8-I12 HydrophobicContact CG2-CD1 3.79Å; T8-I12 HydrophobicContact CG2-CG1 4.34Å; T8-I12 WeakPolarHBondContact O-CB 3.48Å; T8-I12 VanDerWaalsContact O-CG1 3.23Å; T8-I12 WeakPolarHBondContact O-CG1 3.41Å; T8-I12 PolarHBondContact O-N 3.29Å
9	R	68.7	Low	64.4	Low	198 Å²	198	130.7 Å²	130.7	75%	0.747	64%	0.641	S	S	*	*	H	α-helix	trans	-62.9	-40.1	178.3	-165.2	177.6	-173.1	-163.5	2.5	112	Q5 Y6 L7 R13	Q5-R9 WeakPolarHBondContact O-CB 3.37Å; Q5-R9 PolarHBondContact O-N 2.96Å; Y6-R9 PolarHBondContact O-N 2.99Å; L7-R9 PolarHBondContact O-N 2.91Å; R9-R13 WeakPolarHBondContact O-CB 3.38Å; R9-R13 PolarHBondContact O-N 3.47Å
10	S	69.9	Low	64.2	Low	44 Å²	44	129.8 Å²	129.8	31%	0.308	64%	0.636	S	S	.	*	H	α-helix	trans	-67.4	-40	176.2	73.8	0	0	0	0	112.5	Y6 L7 T8 R13 R14	Y6-S10 PolarHBondContact O-N 3.48Å; Y6-S10 PolarHBondContact O-OG 3.18Å; L7-S10 PolarHBondContact O-N 2.75Å; L7-S10 PolarHBondContact O-OG 3.25Å; T8-S10 VanDerWaalsContact C-N 3.34Å; T8-S10 PolarHBondContact O-N 3.28Å; S10-R13 PolarHBondContact O-N 2.96Å; S10-R14 WeakPolarHBondContact O-CG 3.4Å; S10-R14 PolarHBondContact O-N 3.35Å
11	A	68.5	Low	64.5	Low	55 Å²	55	127.2 Å²	127.2	46%	0.455	63%	0.63	S	S	.	*	H	α-helix	trans	-67.1	-42.8	176.6	0	0	0	0	0	111.7	L7 T8 R13 R14 A15	L7-A11 WeakPolarHBondContact O-CB 3.44Å; L7-A11 PolarHBondContact O-N 3.44Å; T8-A11 PolarHBondContact O-N 3.42Å; A11-R13 VanDerWaalsContact C-N 3.32Å; A11-R13 PolarHBondContact O-N 2.86Å; A11-R14 PolarHBondContact O-N 3Å; A11-A15 WeakPolarHBondContact O-CB 3.23Å; A11-A15 PolarHBondContact O-N 2.84Å
12	I	66.6	Low	65.5	Low	107 Å²	107	124.5 Å²	124.5	55%	0.549	61%	0.614	S	S	.	*	H	α-helix	trans	-60.8	-43.9	173.8	-67.6	164.6	0	0	0	110.1	T8 R14 A15 S16	T8-I12 HydrophobicContact CG2-CD1 3.79Å; T8-I12 HydrophobicContact CG2-CG1 4.34Å; T8-I12 WeakPolarHBondContact O-CB 3.48Å; T8-I12 VanDerWaalsContact O-CG1 3.23Å; T8-I12 WeakPolarHBondContact O-CG1 3.41Å; T8-I12 PolarHBondContact O-N 3.29Å; I12-R14 VanDerWaalsContact C-N 3.33Å; I12-R14 PolarHBondContact O-N 3.49Å; I12-A15 CarbonylContact O-C 3.53Å; I12-A15 PolarHBondContact O-N 3.14Å; I12-S16 WeakPolarHBondContact O-CB 3.44Å; I12-S16 PolarHBondContact O-N 3.44Å; I12-S16 PolarHBondContact O-OG 2.83Å
13	R	65.5	Low	66.4	Low	194 Å²	194	123.1 Å²	123.1	73%	0.732	61%	0.608	S	S	*	*	H	α-helix	trans	-62.7	-41.5	178.8	-138.7	-179.8	-173.4	-166.8	0.2	111.7	R9 S10 A11 S16 T17	R9-R13 WeakPolarHBondContact O-CB 3.38Å; R9-R13 PolarHBondContact O-N 3.47Å; S10-R13 PolarHBondContact O-N 2.96Å; A11-R13 VanDerWaalsContact C-N 3.32Å; A11-R13 PolarHBondContact O-N 2.86Å; R13-S16 WeakPolarHBondContact CA-OG 3.44Å; R13-S16 PolarHBondContact O-N 3.05Å; R13-S16 PolarHBondContact O-OG 3.08Å; R13-T17 PolarHBondContact O-N 2.79Å; R13-T17 VanDerWaalsContact O-N 3.14Å; R13-T17 PolarHBondContact O-OG1 3.3Å; R13-T17 VanDerWaalsContact O-OG1 3.05Å
14	R	62.4	Low	67.4	Low	195 Å²	195	115.8 Å²	115.8	74%	0.736	58%	0.582	S	S	*	*	H	α-helix	trans	-62.1	-46.2	173.3	-73.6	-177.1	-179.9	-163.6	0.5	111.2	S10 A11 I12 S16 T17 I18	S10-R14 WeakPolarHBondContact O-CG 3.4Å; S10-R14 PolarHBondContact O-N 3.35Å; A11-R14 PolarHBondContact O-N 3Å; I12-R14 VanDerWaalsContact C-N 3.33Å; I12-R14 PolarHBondContact O-N 3.49Å; R14-S16 PolarHBondContact O-N 3.14Å; R14-T17 PolarHBondContact O-N 3.4Å; R14-T17 PolarHBondContact O-OG1 2.77Å; R14-I18 WeakPolarHBondContact O-CG1 3.34Å; R14-I18 PolarHBondContact O-N 3.21Å; R14-I18 VanDerWaalsContact O-N 3.14Å
15	A	64.1	Low	68.3	Low	56 Å²	56	118.8 Å²	118.8	46%	0.463	58%	0.583	S	S	.	*	H	α-helix	trans	-64.2	-37	177.2	0	0	0	0	0	112.8	A11 I12 T17 I18	A11-A15 WeakPolarHBondContact O-CB 3.23Å; A11-A15 PolarHBondContact O-N 2.84Å; I12-A15 CarbonylContact O-C 3.53Å; I12-A15 PolarHBondContact O-N 3.14Å; A15-T17 VanDerWaalsContact C-N 3.3Å; A15-T17 PolarHBondContact O-N 2.84Å; A15-I18 WeakPolarHBondContact O-CB 3.39Å; A15-I18 PolarHBondContact O-N 3.31Å; A15-I18 VanDerWaalsContact O-N 3.08Å
16	S	62	Low	69.5	Low	81 Å²	81	117.5 Å²	117.5	57%	0.566	58%	0.577	S	S	*	*	H	α-helix	trans	-69.1	-29.1	177.8	63.4	0	0	0	0	113	I12 R13 R14 I18	I12-S16 WeakPolarHBondContact O-CB 3.44Å; I12-S16 PolarHBondContact O-N 3.44Å; I12-S16 PolarHBondContact O-OG 2.83Å; R13-S16 WeakPolarHBondContact CA-OG 3.44Å; R13-S16 PolarHBondContact O-N 3.05Å; R13-S16 PolarHBondContact O-OG 3.08Å; R14-S16 PolarHBondContact O-N 3.14Å; S16-I18 VanDerWaalsContact C-N 3.32Å
17	T	60.3	Low	70.6	Confident	97 Å²	97	113.2 Å²	113.2	60%	0.595	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.5	-2	171.8	51.5	0	0	0	0	113	R13 R14 A15 E19	R13-T17 PolarHBondContact O-N 2.79Å; R13-T17 VanDerWaalsContact O-N 3.14Å; R13-T17 PolarHBondContact O-OG1 3.3Å; R13-T17 VanDerWaalsContact O-OG1 3.05Å; R14-T17 PolarHBondContact O-N 3.4Å; R14-T17 PolarHBondContact O-OG1 2.77Å; A15-T17 VanDerWaalsContact C-N 3.3Å; A15-T17 PolarHBondContact O-N 2.84Å; T17-E19 PolarHBondContact O-N 3.45Å
18	I	58.8	Low	71.7	Confident	114 Å²	114	113 Å²	113	59%	0.585	57%	0.565	S	S	*	*			trans	-73.7	66.3	157.2	-50.1	172	0	0	0	105.3	R14 A15 S16 M20	R14-I18 WeakPolarHBondContact O-CG1 3.34Å; R14-I18 PolarHBondContact O-N 3.21Å; R14-I18 VanDerWaalsContact O-N 3.14Å; A15-I18 WeakPolarHBondContact O-CB 3.39Å; A15-I18 PolarHBondContact O-N 3.31Å; A15-I18 VanDerWaalsContact O-N 3.08Å; S16-I18 VanDerWaalsContact C-N 3.32Å; I18-M20 PolarHBondContact O-N 2.8Å
19	E	57.9	Low	72.8	Confident	164 Å²	164	115.4 Å²	115.4	77%	0.766	57%	0.571	S	S	*	*			trans	-51.4	103.5	154.5	-66.4	-178.2	96.9	0	0	103.7	T17 P21	T17-E19 PolarHBondContact O-N 3.45Å; E19-P21 VanDerWaalsContact O-CD 3.22Å; E19-P21 WeakPolarHBondContact O-CD 3.22Å
20	M	61.6	Low	74.1	Confident	113 Å²	113	110.3 Å²	110.3	56%	0.557	56%	0.559	S	S	*	*			trans	-43.3	110.2	169.8	-85.6	-87.4	161	0	0	105.3	I18 Q22 R25	I18-M20 PolarHBondContact O-N 2.8Å; M20-Q22 PolarHBondContact O-N 3.04Å; M20-R25 HydrophobicContact CB-CG 4.46Å
21	P	70.2	Confident	75.3	Confident	76 Å²	76	113.8 Å²	113.8	49%	0.494	57%	0.573	S	S	.	*			trans	-55.3	126.7	-165.9	12.1	-23.1	0	0	0	105.8	E19 Q23 A24 R25	E19-P21 VanDerWaalsContact O-CD 3.22Å; E19-P21 WeakPolarHBondContact O-CD 3.22Å; P21-Q23 CarbonylContact O-C 3.58Å; P21-Q23 PolarHBondContact O-N 2.9Å; P21-A24 HydrophobicContact CB-CB 4.5Å; P21-A24 HydrophobicContact CG-CB 3.76Å; P21-A24 WeakPolarHBondContact O-CA 3.23Å; P21-A24 WeakPolarHBondContact O-CB 3.38Å; P21-A24 PolarHBondContact O-N 3.26Å; P21-R25 PolarHBondContact O-N 2.71Å
22	Q	76.6	Confident	76.6	Confident	165 Å²	165	117.7 Å²	117.7	77%	0.771	58%	0.58	S	S	*	*	H	α-helix	trans	-52.7	-31.1	-173.2	-66.5	-173.8	-69.6	0	0	110.8	M20 R25 Q26	M20-Q22 PolarHBondContact O-N 3.04Å; Q22-R25 WeakPolarHBondContact O-CB 3.41Å; Q22-R25 PolarHBondContact O-N 2.94Å; Q22-Q26 WeakPolarHBondContact O-CG 3.43Å; Q22-Q26 PolarHBondContact O-N 2.9Å
23	Q	81	Confident	78.1	Confident	134 Å²	134	117.1 Å²	117.1	63%	0.626	58%	0.577	S	S	*	*	H	α-helix	trans	-59	-43.3	170.1	-171.5	175.2	-6.3	0	0	114.3	P21 R25 Q26 N27	P21-Q23 CarbonylContact O-C 3.58Å; P21-Q23 PolarHBondContact O-N 2.9Å; Q23-R25 VanDerWaalsContact C-N 3.33Å; Q23-R25 PolarHBondContact O-N 3.43Å; Q23-Q26 PolarHBondContact O-N 3.4Å; Q23-N27 WeakPolarHBondContact O-CB 3.47Å; Q23-N27 PolarHBondContact O-N 3.22Å; Q23-N27 PolarHBondContact O-ND2 3.37Å; Q23-N27 PolarHBondContact O-OD1 3.4Å
24	A	82.5	Confident	79.5	Confident	33 Å²	33	112.4 Å²	112.4	27%	0.273	57%	0.566	S	S	.	*	H	α-helix	trans	-64	-38.8	174.6	0	0	0	0	0	111.7	P21 N27 L28	P21-A24 HydrophobicContact CB-CB 4.5Å; P21-A24 HydrophobicContact CG-CB 3.76Å; P21-A24 WeakPolarHBondContact O-CA 3.23Å; P21-A24 WeakPolarHBondContact O-CB 3.38Å; P21-A24 PolarHBondContact O-N 3.26Å; A24-N27 PolarHBondContact O-N 3.48Å; A24-L28 WeakPolarHBondContact O-CB 3.31Å; A24-L28 VanDerWaalsContact O-CG 3.23Å; A24-L28 WeakPolarHBondContact O-CG 3.35Å; A24-L28 PolarHBondContact O-N 3.26Å
25	R	85.4	Confident	81.2	Confident	160 Å²	160	108.9 Å²	108.9	60%	0.604	56%	0.557	S	S	*	*	H	α-helix	trans	-61.6	-46.3	173.5	-75.4	-171.1	168.1	-179.3	-1.3	111.7	M20 P21 Q22 Q23 L28 Q29	M20-R25 HydrophobicContact CB-CG 4.46Å; P21-R25 PolarHBondContact O-N 2.71Å; Q22-R25 WeakPolarHBondContact O-CB 3.41Å; Q22-R25 PolarHBondContact O-N 2.94Å; Q23-R25 VanDerWaalsContact C-N 3.33Å; Q23-R25 PolarHBondContact O-N 3.43Å; R25-L28 PolarHBondContact O-N 2.9Å; R25-Q29 WeakPolarHBondContact O-CB 3.25Å; R25-Q29 VanDerWaalsContact O-CG 3.32Å; R25-Q29 WeakPolarHBondContact O-CG 3.49Å; R25-Q29 PolarHBondContact O-N 3.32Å
26	Q	89.6	Confident	82.8	Confident	115 Å²	115	108.1 Å²	108.1	54%	0.537	55%	0.548	S	S	.	.	H	α-helix	trans	-62.4	-43.3	176.6	-72.8	175.8	-20.8	0	0	112	Q22 Q23 L28 Q29 N30	Q22-Q26 WeakPolarHBondContact O-CG 3.43Å; Q22-Q26 PolarHBondContact O-N 2.9Å; Q23-Q26 PolarHBondContact O-N 3.4Å; Q26-L28 PolarHBondContact O-N 2.83Å; Q26-Q29 PolarHBondContact O-N 3.27Å; Q26-N30 PolarHBondContact O-N 3.48Å
27	N	90.9	Very high	84.5	Confident	89 Å²	89	109.3 Å²	109.3	48%	0.476	55%	0.547	S	S	.	.	H	α-helix	trans	-61.6	-44.4	176.7	-71.5	-13	0	0	0	111.6	Q23 A24 N30 L31	Q23-N27 WeakPolarHBondContact O-CB 3.47Å; Q23-N27 PolarHBondContact O-N 3.22Å; Q23-N27 PolarHBondContact O-ND2 3.37Å; Q23-N27 PolarHBondContact O-OD1 3.4Å; A24-N27 PolarHBondContact O-N 3.48Å; N27-N30 PolarHBondContact O-N 3.47Å; N27-L31 VanDerWaalsContact O-CB 3.31Å; N27-L31 WeakPolarHBondContact O-CB 3.45Å; N27-L31 PolarHBondContact O-N 3.48Å
28	L	92	Very high	86.3	Confident	112 Å²	112	109.4 Å²	109.4	59%	0.586	54%	0.543	S	S	*	.	H	α-helix	trans	-64.3	-39.9	176.2	-72.4	172.4	0	0	0	111.9	A24 R25 Q26 L31 F32	A24-L28 WeakPolarHBondContact O-CB 3.31Å; A24-L28 VanDerWaalsContact O-CG 3.23Å; A24-L28 WeakPolarHBondContact O-CG 3.35Å; A24-L28 PolarHBondContact O-N 3.26Å; R25-L28 PolarHBondContact O-N 2.9Å; Q26-L28 PolarHBondContact O-N 2.83Å; L28-L31 PolarHBondContact O-N 3.45Å; L28-F32 VanDerWaalsContact O-CB 3.28Å; L28-F32 WeakPolarHBondContact O-CB 3.28Å; L28-F32 PolarHBondContact O-N 3.32Å
29	Q	94.5	Very high	88.2	Confident	122 Å²	122	108.1 Å²	108.1	57%	0.57	54%	0.537	S	S	*	.	H	α-helix	trans	-62	-48.8	174.4	-76.3	176.7	-5.1	0	0	111.5	R25 Q26 L31 F32 I33	R25-Q29 WeakPolarHBondContact O-CB 3.25Å; R25-Q29 VanDerWaalsContact O-CG 3.32Å; R25-Q29 WeakPolarHBondContact O-CG 3.49Å; R25-Q29 PolarHBondContact O-N 3.32Å; Q26-Q29 PolarHBondContact O-N 3.27Å; Q29-L31 VanDerWaalsContact C-N 3.34Å; Q29-L31 PolarHBondContact O-N 2.98Å; Q29-F32 PolarHBondContact O-N 2.92Å; Q29-I33 VanDerWaalsContact O-CG1 3.25Å; Q29-I33 WeakPolarHBondContact O-CG1 3.32Å; Q29-I33 PolarHBondContact O-N 2.86Å
30	N	95.5	Very high	90.1	Very high	91 Å²	91	105.1 Å²	105.1	49%	0.487	53%	0.525	S	S	.	.	H	α-helix	trans	-61.4	-42.9	177.9	-73.3	-14.3	0	0	0	111.8	Q26 N27 F32 I33 N34	Q26-N30 PolarHBondContact O-N 3.48Å; N27-N30 PolarHBondContact O-N 3.47Å; N30-F32 VanDerWaalsContact C-N 3.33Å; N30-F32 PolarHBondContact O-N 3.03Å; N30-I33 PolarHBondContact O-N 3.27Å; N30-N34 WeakPolarHBondContact O-CB 3.33Å; N30-N34 VanDerWaalsContact O-CG 3.24Å; N30-N34 PolarHBondContact O-N 2.92Å; N30-N34 PolarHBondContact O-ND2 2.89Å
31	L	95.1	Very high	91.8	Very high	117 Å²	117	102.6 Å²	102.6	61%	0.613	52%	0.518	S	S	*	.	H	α-helix	trans	-61.6	-43.1	176.2	-173	67.7	0	0	0	111.4	N27 L28 Q29 N34 F35	N27-L31 VanDerWaalsContact O-CB 3.31Å; N27-L31 WeakPolarHBondContact O-CB 3.45Å; N27-L31 PolarHBondContact O-N 3.48Å; L28-L31 PolarHBondContact O-N 3.45Å; Q29-L31 VanDerWaalsContact C-N 3.34Å; Q29-L31 PolarHBondContact O-N 2.98Å; L31-N34 PolarHBondContact O-N 3.45Å; L31-F35 WeakPolarHBondContact O-CB 3.46Å; L31-F35 PolarHBondContact O-N 3.38Å
32	F	96.6	Very high	93.1	Very high	137 Å²	137	103.5 Å²	103.5	60%	0.601	52%	0.518	S	S	*	.	H	α-helix	trans	-65.4	-43.9	177.8	-174.4	-101.2	0	0	0	112	L28 Q29 N30 N34 F35 C36	L28-F32 VanDerWaalsContact O-CB 3.28Å; L28-F32 WeakPolarHBondContact O-CB 3.28Å; L28-F32 PolarHBondContact O-N 3.32Å; Q29-F32 PolarHBondContact O-N 2.92Å; N30-F32 VanDerWaalsContact C-N 3.33Å; N30-F32 PolarHBondContact O-N 3.03Å; F32-N34 PolarHBondContact O-N 3.29Å; F32-F35 PolarHBondContact O-N 2.95Å; F32-C36 VanDerWaalsContact CE1-SG 3.6Å; F32-C36 WeakPolarHBondContact O-CB 3.3Å; F32-C36 PolarHBondContact O-N 3.05Å; F32-C36 PolarHBondContact O-SG 2.89Å
33	I	97.4	Very high	94.1	Very high	94 Å²	94	101 Å²	101	48%	0.482	51%	0.509	S	S	.	.	H	α-helix	trans	-59.9	-48	176	-68.8	164.3	0	0	0	110.3	Q29 N30 F35 C36 L37	Q29-I33 VanDerWaalsContact O-CG1 3.25Å; Q29-I33 WeakPolarHBondContact O-CG1 3.32Å; Q29-I33 PolarHBondContact O-N 2.86Å; N30-I33 PolarHBondContact O-N 3.27Å; I33-F35 VanDerWaalsContact C-N 3.34Å; I33-F35 PolarHBondContact O-N 3.4Å; I33-C36 PolarHBondContact O-N 2.96Å; I33-L37 WeakPolarHBondContact O-CB 3.32Å; I33-L37 PolarHBondContact O-N 3.3Å
34	N	96.1	Very high	94.9	Very high	95 Å²	95	99.1 Å²	99.1	51%	0.508	50%	0.503	S	S	.	.	H	α-helix	trans	-61.3	-43.2	178.2	-72.1	-18.2	0	0	0	111.9	N30 L31 F32 L37 I38	N30-N34 WeakPolarHBondContact O-CB 3.33Å; N30-N34 VanDerWaalsContact O-CG 3.24Å; N30-N34 PolarHBondContact O-N 2.92Å; N30-N34 PolarHBondContact O-ND2 2.89Å; L31-N34 PolarHBondContact O-N 3.45Å; F32-N34 PolarHBondContact O-N 3.29Å; N34-L37 PolarHBondContact O-N 3.45Å; N34-I38 WeakPolarHBondContact O-CG1 3.43Å; N34-I38 PolarHBondContact O-N 3.44Å
35	F	97.7	Very high	95.6	Very high	122 Å²	122	102.2 Å²	102.2	54%	0.535	51%	0.514	S	S	.	.	H	α-helix	trans	-60.4	-47	176.2	179.3	-103.3	0	0	0	111.9	L31 F32 I33 L37 I38 L39	L31-F35 WeakPolarHBondContact O-CB 3.46Å; L31-F35 PolarHBondContact O-N 3.38Å; F32-F35 PolarHBondContact O-N 2.95Å; I33-F35 VanDerWaalsContact C-N 3.34Å; I33-F35 PolarHBondContact O-N 3.4Å; F35-L37 VanDerWaalsContact C-N 3.33Å; F35-L37 PolarHBondContact O-N 2.9Å; F35-I38 PolarHBondContact O-N 3.27Å; F35-L39 HydrophobicContact CD1-CD1 3.89Å; F35-L39 HydrophobicContact CE1-CD1 3.36Å; F35-L39 HydrophobicContact CE1-CG 4.17Å; F35-L39 HydrophobicContact CZ-CD1 3.76Å; F35-L39 HydrophobicContact CZ-CD2 4.44Å; F35-L39 HydrophobicContact CZ-CG 4.22Å; F35-L39 WeakPolarHBondContact O-CG 3.39Å; F35-L39 PolarHBondContact O-N 3.49Å
36	C	97.9	Very high	96.2	Very high	40 Å²	40	98.3 Å²	98.3	27%	0.27	51%	0.51	S	S	.	.	H	α-helix	trans	-60.7	-41.2	175.4	-72	0	0	0	0	112.3	F32 I33 I38 L39 I40	F32-C36 VanDerWaalsContact CE1-SG 3.6Å; F32-C36 WeakPolarHBondContact O-CB 3.3Å; F32-C36 PolarHBondContact O-N 3.05Å; F32-C36 PolarHBondContact O-SG 2.89Å; I33-C36 PolarHBondContact O-N 2.96Å; C36-I38 PolarHBondContact O-N 3.5Å; C36-L39 PolarHBondContact O-N 3.4Å; C36-I40 VanDerWaalsContact O-CG1 3.3Å; C36-I40 WeakPolarHBondContact O-CG1 3.43Å; C36-I40 PolarHBondContact O-N 3.44Å
37	L	97.8	Very high	96.5	Very high	105 Å²	105	97.2 Å²	97.2	55%	0.55	51%	0.507	S	S	.	.	H	α-helix	trans	-64.1	-42.2	-180	-160	141.1	0	0	0	111.3	I33 N34 F35 I40 C41	I33-L37 WeakPolarHBondContact O-CB 3.32Å; I33-L37 PolarHBondContact O-N 3.3Å; N34-L37 PolarHBondContact O-N 3.45Å; F35-L37 VanDerWaalsContact C-N 3.33Å; F35-L37 PolarHBondContact O-N 2.9Å; L37-I40 PolarHBondContact O-N 3.25Å; L37-C41 PolarHBondContact O-N 3.34Å; L37-C41 PolarHBondContact O-SG 3.36Å
38	I	97.4	Very high	96.8	Very high	100 Å²	100	98.1 Å²	98.1	51%	0.513	51%	0.511	S	S	.	.	H	α-helix	trans	-61.3	-46.1	173.7	-66.5	164	0	0	0	111	N34 F35 C36 I40 C41 L42	N34-I38 WeakPolarHBondContact O-CG1 3.43Å; N34-I38 PolarHBondContact O-N 3.44Å; F35-I38 PolarHBondContact O-N 3.27Å; C36-I38 PolarHBondContact O-N 3.5Å; I38-I40 VanDerWaalsContact C-N 3.34Å; I38-I40 PolarHBondContact O-N 2.96Å; I38-C41 PolarHBondContact O-N 3.44Å; I38-L42 HydrophobicContact CG2-CD1 4.13Å; I38-L42 HydrophobicContact CG2-CG 4.42Å; I38-L42 WeakPolarHBondContact O-CG 3.24Å; I38-L42 PolarHBondContact O-N 3.37Å
39	L	97.8	Very high	97	Very high	86 Å²	86	97.2 Å²	97.2	45%	0.45	51%	0.51	S	S	.	.	H	α-helix	trans	-59.9	-43.1	178.5	-74.5	178.3	0	0	0	112.3	F35 C36 L42 L43	F35-L39 HydrophobicContact CD1-CD1 3.89Å; F35-L39 HydrophobicContact CE1-CD1 3.36Å; F35-L39 HydrophobicContact CE1-CG 4.17Å; F35-L39 HydrophobicContact CZ-CD1 3.76Å; F35-L39 HydrophobicContact CZ-CD2 4.44Å; F35-L39 HydrophobicContact CZ-CG 4.22Å; F35-L39 WeakPolarHBondContact O-CG 3.39Å; F35-L39 PolarHBondContact O-N 3.49Å; C36-L39 PolarHBondContact O-N 3.4Å; L39-L42 PolarHBondContact O-N 2.94Å; L39-L43 WeakPolarHBondContact O-CB 3.31Å; L39-L43 PolarHBondContact O-N 3.28Å
40	I	97.9	Very high	97	Very high	101 Å²	101	99.1 Å²	99.1	52%	0.518	52%	0.52	S	S	.	.	H	α-helix	trans	-64.2	-44.6	177.1	-67.4	164.4	0	0	0	110.4	C36 L37 I38 L42 L43 L44	C36-I40 VanDerWaalsContact O-CG1 3.3Å; C36-I40 WeakPolarHBondContact O-CG1 3.43Å; C36-I40 PolarHBondContact O-N 3.44Å; L37-I40 PolarHBondContact O-N 3.25Å; I38-I40 VanDerWaalsContact C-N 3.34Å; I38-I40 PolarHBondContact O-N 2.96Å; I40-L42 VanDerWaalsContact C-N 3.35Å; I40-L42 PolarHBondContact O-N 3.28Å; I40-L43 PolarHBondContact O-N 2.96Å; I40-L44 HydrophobicContact CG2-CD1 4.09Å; I40-L44 HydrophobicContact CG2-CG 4.46Å; I40-L44 WeakPolarHBondContact O-CG 3.4Å; I40-L44 PolarHBondContact O-N 3.45Å
41	C	98.1	Very high	96.9	Very high	60 Å²	60	102 Å²	102	41%	0.405	54%	0.535	S	S	.	.	H	α-helix	trans	-58.8	-45.3	176.2	-71.7	0	0	0	0	112	L37 I38 L44 I45	L37-C41 PolarHBondContact O-N 3.34Å; L37-C41 PolarHBondContact O-SG 3.36Å; I38-C41 PolarHBondContact O-N 3.44Å; C41-L44 PolarHBondContact O-N 2.92Å; C41-I45 WeakPolarHBondContact O-CG1 3.35Å; C41-I45 PolarHBondContact O-N 2.98Å
42	L	97.5	Very high	96.5	Very high	96 Å²	96	105.9 Å²	105.9	50%	0.503	56%	0.555	S	S	.	*	H	α-helix	trans	-62	-44.1	176.4	-73.1	176.6	0	0	0	111.9	I38 L39 I40 L44 I45 C46	I38-L42 HydrophobicContact CG2-CD1 4.13Å; I38-L42 HydrophobicContact CG2-CG 4.42Å; I38-L42 WeakPolarHBondContact O-CG 3.24Å; I38-L42 PolarHBondContact O-N 3.37Å; L39-L42 PolarHBondContact O-N 2.94Å; I40-L42 VanDerWaalsContact C-N 3.35Å; I40-L42 PolarHBondContact O-N 3.28Å; L42-L44 VanDerWaalsContact C-N 3.33Å; L42-L44 PolarHBondContact O-N 3.25Å; L42-I45 PolarHBondContact O-N 2.94Å; L42-C46 PolarHBondContact O-N 3.27Å; L42-C46 PolarHBondContact O-SG 3.27Å; L42-C46 VanDerWaalsContact O-SG 3.34Å
43	L	97.3	Very high	96.5	Very high	111 Å²	111	104.3 Å²	104.3	58%	0.581	55%	0.553	S	S	*	*	H	α-helix	trans	-60.6	-43.7	178	-171.2	71.7	0	0	0	111.4	L39 I40 C46 I47	L39-L43 WeakPolarHBondContact O-CB 3.31Å; L39-L43 PolarHBondContact O-N 3.28Å; I40-L43 PolarHBondContact O-N 2.96Å; L43-C46 PolarHBondContact O-N 3.4Å; L43-I47 HydrophobicContact CG-CD1 4.16Å; L43-I47 VanDerWaalsContact O-CG1 3.31Å; L43-I47 WeakPolarHBondContact O-CG1 3.41Å; L43-I47 PolarHBondContact O-N 3.25Å
44	L	97.5	Very high	96.4	Very high	95 Å²	95	104.8 Å²	104.8	50%	0.497	56%	0.557	S	S	.	*	H	α-helix	trans	-61.1	-44.8	176.8	-73.5	170.9	0	0	0	111.9	I40 C41 L42 C46 I47 I48	I40-L44 HydrophobicContact CG2-CD1 4.09Å; I40-L44 HydrophobicContact CG2-CG 4.46Å; I40-L44 WeakPolarHBondContact O-CG 3.4Å; I40-L44 PolarHBondContact O-N 3.45Å; C41-L44 PolarHBondContact O-N 2.92Å; L42-L44 VanDerWaalsContact C-N 3.33Å; L42-L44 PolarHBondContact O-N 3.25Å; L44-C46 VanDerWaalsContact C-N 3.34Å; L44-C46 PolarHBondContact O-N 3.37Å; L44-I47 PolarHBondContact O-N 2.95Å; L44-I48 VanDerWaalsContact O-CG1 3.26Å; L44-I48 WeakPolarHBondContact O-CG1 3.45Å; L44-I48 PolarHBondContact O-N 2.92Å
45	I	97.4	Very high	96.5	Very high	99 Å²	99	105.4 Å²	105.4	51%	0.508	56%	0.56	S	S	.	*	H	α-helix	trans	-60.9	-44.9	176.4	-66.5	165	0	0	0	110.3	C41 L42 I47 I48 V49	C41-I45 WeakPolarHBondContact O-CG1 3.35Å; C41-I45 PolarHBondContact O-N 2.98Å; L42-I45 PolarHBondContact O-N 2.94Å; I45-I47 VanDerWaalsContact C-N 3.32Å; I45-I47 PolarHBondContact O-N 3.43Å; I45-I48 PolarHBondContact O-N 3.43Å; I45-V49 HydrophobicContact CG2-CG2 4.35Å; I45-V49 WeakPolarHBondContact O-CG2 3.35Å; I45-V49 PolarHBondContact O-N 3.46Å
46	C	97.3	Very high	96.4	Very high	77 Å²	77	104.4 Å²	104.4	52%	0.52	56%	0.561	S	S	.	*	H	α-helix	trans	-59.4	-41.6	176.5	-70.8	0	0	0	0	112.4	L42 L43 L44 V49 M50	L42-C46 PolarHBondContact O-N 3.27Å; L42-C46 PolarHBondContact O-SG 3.27Å; L42-C46 VanDerWaalsContact O-SG 3.34Å; L43-C46 PolarHBondContact O-N 3.4Å; L44-C46 VanDerWaalsContact C-N 3.34Å; L44-C46 PolarHBondContact O-N 3.37Å; C46-V49 PolarHBondContact O-N 3.47Å; C46-M50 WeakPolarHBondContact O-CB 3.32Å; C46-M50 VanDerWaalsContact O-CG 3.24Å; C46-M50 WeakPolarHBondContact O-CG 3.34Å; C46-M50 PolarHBondContact O-N 3.06Å
47	I	96.9	Very high	96.3	Very high	93 Å²	93	108.4 Å²	108.4	48%	0.477	58%	0.579	S	S	.	*	H	α-helix	trans	-65.1	-44.1	176.9	-67.6	165.9	0	0	0	110.7	L43 L44 I45 V49 M50 L51	L43-I47 HydrophobicContact CG-CD1 4.16Å; L43-I47 VanDerWaalsContact O-CG1 3.31Å; L43-I47 WeakPolarHBondContact O-CG1 3.41Å; L43-I47 PolarHBondContact O-N 3.25Å; L44-I47 PolarHBondContact O-N 2.95Å; I45-I47 VanDerWaalsContact C-N 3.32Å; I45-I47 PolarHBondContact O-N 3.43Å; I47-V49 VanDerWaalsContact C-N 3.32Å; I47-V49 PolarHBondContact O-N 3.24Å; I47-M50 PolarHBondContact O-N 3.34Å; I47-L51 WeakPolarHBondContact O-CB 3.26Å; I47-L51 PolarHBondContact O-N 2.98Å
48	I	96.8	Very high	96.2	Very high	107 Å²	107	108.7 Å²	108.7	55%	0.549	58%	0.581	S	S	.	*	H	α-helix	trans	-60.5	-44.2	177.6	-68.2	164.1	0	0	0	110.4	L44 I45 M50 L51 L52	L44-I48 VanDerWaalsContact O-CG1 3.26Å; L44-I48 WeakPolarHBondContact O-CG1 3.45Å; L44-I48 PolarHBondContact O-N 2.92Å; I45-I48 PolarHBondContact O-N 3.43Å; I48-M50 VanDerWaalsContact C-N 3.35Å; I48-L51 PolarHBondContact O-N 2.93Å; I48-L52 VanDerWaalsContact O-CB 3.29Å; I48-L52 WeakPolarHBondContact O-CB 3.29Å; I48-L52 PolarHBondContact O-N 3.01Å
49	V	97.1	Very high	96.1	Very high	94 Å²	94	109.3 Å²	109.3	57%	0.57	59%	0.586	S	S	*	*	H	α-helix	trans	-68	-32.1	178.3	172.2	0	0	0	0	112.5	I45 C46 I47	I45-V49 HydrophobicContact CG2-CG2 4.35Å; I45-V49 WeakPolarHBondContact O-CG2 3.35Å; I45-V49 PolarHBondContact O-N 3.46Å; C46-V49 PolarHBondContact O-N 3.47Å; I47-V49 VanDerWaalsContact C-N 3.32Å; I47-V49 PolarHBondContact O-N 3.24Å
50	M	94.9	Very high	96	Very high	161 Å²	161	111.1 Å²	111.1	79%	0.793	60%	0.596	S	S	*	*	H	α-helix	trans	-77.7	-24.8	176.6	-72.2	-88.7	77.7	0	0	113.2	C46 I47 I48	C46-M50 WeakPolarHBondContact O-CB 3.32Å; C46-M50 VanDerWaalsContact O-CG 3.24Å; C46-M50 WeakPolarHBondContact O-CG 3.34Å; C46-M50 PolarHBondContact O-N 3.06Å; I47-M50 PolarHBondContact O-N 3.34Å; I48-M50 VanDerWaalsContact C-N 3.35Å
51	L	92.2	Very high	95.8	Very high	153 Å²	153	111.9 Å²	111.9	80%	0.801	60%	0.603	S	S	*	*	H	α-helix	trans	-89.5	-29.1	-178.8	-170.5	66	0	0	0	112.8	I47 I48	I47-L51 WeakPolarHBondContact O-CB 3.26Å; I47-L51 PolarHBondContact O-N 2.98Å; I48-L51 PolarHBondContact O-N 2.93Å
52	L	86.9	Confident	95.6	Very high	197 Å²	197	116.6 Å²	116.6	100%	1.031	62%	0.621	S	S	*	*			trans	-81.2	0	176.4	-169.2	115.1	0	0	0	111.3	I48	I48-L52 VanDerWaalsContact O-CB 3.29Å; I48-L52 WeakPolarHBondContact O-CB 3.29Å; I48-L52 PolarHBondContact O-N 3.01Å

Retrieved 52 of 52 residues in 11.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).