TIM10_RAT Loading...

Mitochondrial import inner membrane translocase subunit Tim10

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

AlphaFold DB , UniProt , Accession P62074, Species RAT (Rattus norvegicus, Rat), Gene Timm10, Length 90 aa.

						>TIM10_RAT|P62074|Timm10
MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	64.2	Low	90.1	Very high	210 Å²	210	102.1 Å²	102.1	100%	1.034	56%	0.555	S	S	*	*				0	133.9	0	-76.6	-63.3	-170.6	0	0	107.6
2	D	89.4	Confident	90.5	Very high	103 Å²	103	101.3 Å²	101.3	55%	0.551	54%	0.544	S	S	*	.			trans	-62.4	130.2	170.1	-174.4	-29.7	0	0	0	108.9	L4 R5 A6	D2-L4 PolarHBondContact O-N 3.09Å; D2-L4 PolarHBondContact OD1-N 2.76Å; D2-R5 HydrophobicContact CB-CB 4.22Å; D2-R5 WeakPolarHBondContact O-CB 3.34Å; D2-R5 PolarHBondContact O-N 2.06Å; D2-A6 PolarHBondContact O-N 2.98Å; D2-A6 VanDerWaalsContact O-N 3.13Å
3	P	88.9	Confident	90.9	Very high	104 Å²	104	100.9 Å²	100.9	68%	0.675	54%	0.541	S	S	*	.	H	α-helix	trans	-49.9	-37.4	176.3	-28.2	34.9	0	0	0	113.8	R5 A6 Q7	P3-R5 VanDerWaalsContact C-N 3.34Å; P3-R5 PolarHBondContact O-N 3.36Å; P3-A6 PolarHBondContact O-N 2.76Å; P3-Q7 PolarHBondContact O-N 3.2Å
4	L	91.2	Very high	91.3	Very high	101 Å²	101	102.7 Å²	102.7	53%	0.529	55%	0.545	S	S	.	.	H	α-helix	trans	-64.9	-39.5	178.5	-178.7	63.6	0	0	0	111.5	D2 Q7 Q8	D2-L4 PolarHBondContact O-N 3.09Å; D2-L4 PolarHBondContact OD1-N 2.76Å; L4-Q7 PolarHBondContact O-N 3.08Å; L4-Q8 WeakPolarHBondContact O-CG 3.28Å; L4-Q8 PolarHBondContact O-N 3.19Å
5	R	92.6	Very high	91.6	Very high	126 Å²	126	102.5 Å²	102.5	48%	0.475	55%	0.548	S	S	.	.	H	α-helix	trans	-68.6	-37	178.1	-175.4	59.9	176.7	160	6.2	111.8	D2 P3 Q8 L9	D2-R5 HydrophobicContact CB-CB 4.22Å; D2-R5 WeakPolarHBondContact O-CB 3.34Å; D2-R5 PolarHBondContact O-N 2.06Å; P3-R5 VanDerWaalsContact C-N 3.34Å; P3-R5 PolarHBondContact O-N 3.36Å; R5-Q8 PolarHBondContact O-N 2.95Å; R5-L9 PolarHBondContact O-N 2.93Å
6	A	93.1	Very high	92	Very high	53 Å²	53	104.4 Å²	104.4	44%	0.438	55%	0.553	S	S	.	*	H	α-helix	trans	-64.9	-42.4	175.5	0	0	0	0	0	111.6	D2 P3 L9 A10	D2-A6 PolarHBondContact O-N 2.98Å; D2-A6 VanDerWaalsContact O-N 3.13Å; P3-A6 PolarHBondContact O-N 2.76Å; A6-L9 PolarHBondContact O-N 3.04Å; A6-A10 PolarHBondContact O-N 3.4Å
7	Q	93.1	Very high	92.1	Very high	140 Å²	140	105.5 Å²	105.5	65%	0.654	56%	0.556	S	S	*	*	H	α-helix	trans	-64.9	-41	176.4	-173.6	177.5	0.3	0	0	112.3	P3 L4 A10 A11	P3-Q7 PolarHBondContact O-N 3.2Å; L4-Q7 PolarHBondContact O-N 3.08Å; Q7-A10 PolarHBondContact O-N 3.22Å; Q7-A11 PolarHBondContact O-N 3.13Å
8	Q	94.5	Very high	92.3	Very high	86 Å²	86	106.8 Å²	106.8	40%	0.402	56%	0.561	S	S	.	*	H	α-helix	trans	-59.5	-46.3	174.3	-75.7	174.7	-16.4	0	0	111.8	L4 R5 A10 A11 E12	L4-Q8 WeakPolarHBondContact O-CG 3.28Å; L4-Q8 PolarHBondContact O-N 3.19Å; R5-Q8 PolarHBondContact O-N 2.95Å; Q8-A10 VanDerWaalsContact C-N 3.33Å; Q8-A10 PolarHBondContact O-N 3.24Å; Q8-A11 PolarHBondContact O-N 3.24Å; Q8-E12 WeakPolarHBondContact O-CG 3.24Å; Q8-E12 PolarHBondContact O-N 3.38Å
9	L	94.2	Very high	92.6	Very high	103 Å²	103	103.7 Å²	103.7	54%	0.539	55%	0.552	S	S	.	*	H	α-helix	trans	-63.7	-39.4	179.3	-176.6	65.5	0	0	0	112	R5 A6 E12 L13	R5-L9 PolarHBondContact O-N 2.93Å; A6-L9 PolarHBondContact O-N 3.04Å; L9-E12 PolarHBondContact O-N 2.87Å; L9-L13 WeakPolarHBondContact O-CB 3.24Å; L9-L13 PolarHBondContact O-N 3.03Å
10	A	94	Very high	92.8	Very high	49 Å²	49	102.4 Å²	102.4	41%	0.405	55%	0.545	S	S	.	.	H	α-helix	trans	-62.3	-43.5	174.6	0	0	0	0	0	111.6	A6 Q7 Q8 L13 E14	A6-A10 PolarHBondContact O-N 3.4Å; Q7-A10 PolarHBondContact O-N 3.22Å; Q8-A10 VanDerWaalsContact C-N 3.33Å; Q8-A10 PolarHBondContact O-N 3.24Å; A10-L13 PolarHBondContact O-N 3.17Å; A10-E14 WeakPolarHBondContact O-CG 3.46Å; A10-E14 PolarHBondContact O-N 3.1Å
11	A	95.5	Very high	93	Very high	48 Å²	48	99.2 Å²	99.2	40%	0.397	53%	0.527	S	S	.	.	H	α-helix	trans	-65.7	-40.5	177.2	0	0	0	0	0	112.7	Q7 Q8 L13 E14 V15	Q7-A11 PolarHBondContact O-N 3.13Å; Q8-A11 PolarHBondContact O-N 3.24Å; A11-L13 VanDerWaalsContact C-N 3.33Å; A11-L13 PolarHBondContact O-N 2.97Å; A11-E14 PolarHBondContact O-N 2.79Å; A11-V15 WeakPolarHBondContact O-CG2 3.38Å; A11-V15 PolarHBondContact O-N 3.29Å
12	E	95.5	Very high	94.6	Very high	92 Å²	92	95.8 Å²	95.8	43%	0.43	50%	0.504	S	S	.	.	H	α-helix	trans	-58.3	-46.7	173.9	-74	168.4	-170.9	0	0	110.7	Q8 L9 E14 V15 E16	Q8-E12 WeakPolarHBondContact O-CG 3.24Å; Q8-E12 PolarHBondContact O-N 3.38Å; L9-E12 PolarHBondContact O-N 2.87Å; E12-E14 PolarHBondContact O-N 3.38Å; E12-V15 PolarHBondContact O-N 3.23Å; E12-E16 WeakPolarHBondContact O-CG 3.04Å; E12-E16 PolarHBondContact O-N 3.5Å; E12-E16 VanDerWaalsContact O-N 3.07Å
13	L	95.7	Very high	95	Very high	97 Å²	97	95.7 Å²	95.7	51%	0.508	50%	0.504	S	S	.	.	H	α-helix	trans	-62.5	-42.8	177.1	-176.9	66.4	0	0	0	112.2	L9 A10 A11 V15 E16 M17	L9-L13 WeakPolarHBondContact O-CB 3.24Å; L9-L13 PolarHBondContact O-N 3.03Å; A10-L13 PolarHBondContact O-N 3.17Å; A11-L13 VanDerWaalsContact C-N 3.33Å; A11-L13 PolarHBondContact O-N 2.97Å; L13-V15 VanDerWaalsContact C-N 3.31Å; L13-V15 PolarHBondContact O-N 3.46Å; L13-E16 PolarHBondContact O-N 3.02Å; L13-M17 HydrophobicContact CG-CG 4.49Å; L13-M17 HydrophobicContact CG-SD 4.18Å; L13-M17 WeakPolarHBondContact O-CB 3.46Å; L13-M17 VanDerWaalsContact O-CG 3.28Å; L13-M17 WeakPolarHBondContact O-CG 3.33Å; L13-M17 PolarHBondContact O-N 2.82Å
14	E	95.6	Very high	95.5	Very high	126 Å²	126	98 Å²	98	59%	0.589	50%	0.499	S	S	*	.	H	α-helix	trans	-59	-43	176.7	-77	176.3	-175.3	0	0	111.8	A10 A11 E12 M17 M18	A10-E14 WeakPolarHBondContact O-CG 3.46Å; A10-E14 PolarHBondContact O-N 3.1Å; A11-E14 PolarHBondContact O-N 2.79Å; E12-E14 PolarHBondContact O-N 3.38Å; E14-M17 PolarHBondContact O-N 3.22Å; E14-M18 WeakPolarHBondContact O-CB 3.45Å; E14-M18 VanDerWaalsContact O-CG 3.31Å; E14-M18 WeakPolarHBondContact O-CG 3.12Å; E14-M18 PolarHBondContact O-N 3.46Å
15	V	97	Very high	95.8	Very high	99 Å²	99	94.1 Å²	94.1	60%	0.6	48%	0.478	S	S	*	.	H	α-helix	trans	-63.9	-44.4	177.6	172.4	0	0	0	0	111.2	A11 E12 L13 M17 M18 A19	A11-V15 WeakPolarHBondContact O-CG2 3.38Å; A11-V15 PolarHBondContact O-N 3.29Å; E12-V15 PolarHBondContact O-N 3.23Å; L13-V15 VanDerWaalsContact C-N 3.31Å; L13-V15 PolarHBondContact O-N 3.46Å; V15-M17 PolarHBondContact O-N 3.27Å; V15-M18 PolarHBondContact O-N 2.05Å; V15-A19 WeakPolarHBondContact O-CB 3.29Å; V15-A19 PolarHBondContact O-N 3.46Å
16	E	96.7	Very high	96.1	Very high	133 Å²	133	91 Å²	91	62%	0.621	47%	0.473	S	S	*	.	H	α-helix	trans	-61.6	-44	177.3	-72.3	-179.3	-178.6	0	0	111.9	E12 L13 A19 D20	E12-E16 WeakPolarHBondContact O-CG 3.04Å; E12-E16 PolarHBondContact O-N 3.5Å; E12-E16 VanDerWaalsContact O-N 3.07Å; L13-E16 PolarHBondContact O-N 3.02Å; E16-A19 PolarHBondContact O-N 2.89Å; E16-D20 PolarHBondContact O-N 2.86Å
17	M	94.4	Very high	96.3	Very high	123 Å²	123	92 Å²	92	61%	0.606	48%	0.477	S	S	*	.	H	α-helix	trans	-62.4	-43.9	176.3	-71.3	-179.3	69.5	0	0	111.8	L13 E14 V15 A19 D20 M21	L13-M17 HydrophobicContact CG-CG 4.49Å; L13-M17 HydrophobicContact CG-SD 4.18Å; L13-M17 WeakPolarHBondContact O-CB 3.46Å; L13-M17 VanDerWaalsContact O-CG 3.28Å; L13-M17 WeakPolarHBondContact O-CG 3.33Å; L13-M17 PolarHBondContact O-N 2.82Å; E14-M17 PolarHBondContact O-N 3.22Å; V15-M17 PolarHBondContact O-N 3.27Å; M17-A19 VanDerWaalsContact C-N 3.32Å; M17-A19 PolarHBondContact O-N 3.16Å; M17-D20 PolarHBondContact O-N 3.36Å; M17-M21 WeakPolarHBondContact O-CB 3.44Å; M17-M21 PolarHBondContact O-N 2.9Å
18	M	96	Very high	96.6	Very high	129 Å²	129	86 Å²	86	64%	0.635	45%	0.451	S	S	*	.	H	α-helix	trans	-63	-38.6	176.2	-74.4	-176.8	68.4	0	0	111.9	E14 V15 Y22	E14-M18 WeakPolarHBondContact O-CB 3.45Å; E14-M18 VanDerWaalsContact O-CG 3.31Å; E14-M18 WeakPolarHBondContact O-CG 3.12Å; E14-M18 PolarHBondContact O-N 3.46Å; V15-M18 PolarHBondContact O-N 2.05Å; M18-Y22 VanDerWaalsContact O-CB 3.27Å; M18-Y22 WeakPolarHBondContact O-CB 3.42Å; M18-Y22 PolarHBondContact O-N 3.45Å
19	A	97.5	Very high	96.8	Very high	48 Å²	48	82.1 Å²	82.1	40%	0.397	43%	0.434	S	S	.	.	H	α-helix	trans	-66.5	-45.5	177.6	0	0	0	0	0	112.1	V15 E16 M17 Y22 N23	V15-A19 WeakPolarHBondContact O-CB 3.29Å; V15-A19 PolarHBondContact O-N 3.46Å; E16-A19 PolarHBondContact O-N 2.89Å; M17-A19 VanDerWaalsContact C-N 3.32Å; M17-A19 PolarHBondContact O-N 3.16Å; A19-Y22 PolarHBondContact O-N 2.85Å; A19-N23 WeakPolarHBondContact O-CB 3.3Å; A19-N23 VanDerWaalsContact O-CG 3.29Å; A19-N23 PolarHBondContact O-N 2.96Å; A19-N23 PolarHBondContact O-ND2 3.48Å; A19-N23 VanDerWaalsContact O-ND2 3.09Å
20	D	97.2	Very high	97	Very high	77 Å²	77	81.4 Å²	81.4	41%	0.412	43%	0.427	S	S	.	.	H	α-helix	trans	-61.4	-46.2	174.8	176.7	74.1	0	0	0	111.2	E16 M17 Y22 N23 R24	E16-D20 PolarHBondContact O-N 2.86Å; M17-D20 PolarHBondContact O-N 3.36Å; D20-Y22 VanDerWaalsContact C-N 3.35Å; D20-Y22 PolarHBondContact O-N 3.48Å; D20-N23 PolarHBondContact O-N 3.41Å; D20-R24 WeakPolarHBondContact O-CG 3.44Å; D20-R24 PolarHBondContact O-N 3.04Å; D20-R24 IonicContact OD1-CZ 3.57Å; D20-R24 IonicContact OD1-NE 2.94Å; D20-R24 PolarHBondContact OD1-NE 2.84Å; D20-R24 IonicContact OD1-NH2 3.25Å; D20-R24 PolarHBondContact OD1-NH2 3.32Å; D20-R24 WeakPolarHBondContact OD2-CD 3.31Å; D20-R24 IonicContact OD2-CZ 3.5Å; D20-R24 IonicContact OD2-NE 2.79Å; D20-R24 PolarHBondContact OD2-NE 3.37Å; D20-R24 IonicContact OD2-NH2 3.57Å
21	M	96.8	Very high	97.2	Very high	36 Å²	36	87.6 Å²	87.6	18%	0.177	44%	0.44	C	S	.	.	H	α-helix	trans	-57.3	-47.8	175.9	-174	-159.7	73.6	0	0	111.4	M17 N23 R24 M25 Y58 L59	M17-M21 WeakPolarHBondContact O-CB 3.44Å; M17-M21 PolarHBondContact O-N 2.9Å; M21-N23 PolarHBondContact O-N 3.27Å; M21-R24 PolarHBondContact O-N 3.14Å; M21-M25 VanDerWaalsContact O-CB 3.26Å; M21-M25 WeakPolarHBondContact O-CB 3.28Å; M21-M25 PolarHBondContact O-N 3.03Å; M21-Y58 HydrophobicContact CG-CE1 4.05Å; M21-L59 HydrophobicContact CE-CD2 4.04Å; M21-L59 HydrophobicContact SD-CD2 4.26Å
22	Y	98.1	Very high	97.3	Very high	138 Å²	138	92 Å²	92	54%	0.541	45%	0.45	S	S	.	.	H	α-helix	trans	-60.4	-45.1	179.7	178	-95.5	0	0	0	112.1	M18 A19 D20 M25 T26	M18-Y22 VanDerWaalsContact O-CB 3.27Å; M18-Y22 WeakPolarHBondContact O-CB 3.42Å; M18-Y22 PolarHBondContact O-N 3.45Å; A19-Y22 PolarHBondContact O-N 2.85Å; D20-Y22 VanDerWaalsContact C-N 3.35Å; D20-Y22 PolarHBondContact O-N 3.48Å; Y22-M25 HydrophobicContact CD2-CE 4.18Å; Y22-M25 PolarHBondContact O-N 3.03Å; Y22-T26 VanDerWaalsContact O-CB 3.28Å; Y22-T26 WeakPolarHBondContact O-CB 3.3Å; Y22-T26 PolarHBondContact O-N 2.98Å; Y22-T26 PolarHBondContact O-OG1 2.87Å
23	N	98.1	Very high	97.4	Very high	102 Å²	102	88.1 Å²	88.1	55%	0.545	43%	0.434	S	S	.	.	H	α-helix	trans	-63.4	-44.7	178.9	-73.5	-34.6	0	0	0	111.8	A19 D20 M21 S27	A19-N23 WeakPolarHBondContact O-CB 3.3Å; A19-N23 VanDerWaalsContact O-CG 3.29Å; A19-N23 PolarHBondContact O-N 2.96Å; A19-N23 PolarHBondContact O-ND2 3.48Å; A19-N23 VanDerWaalsContact O-ND2 3.09Å; D20-N23 PolarHBondContact O-N 3.41Å; M21-N23 PolarHBondContact O-N 3.27Å; N23-S27 WeakPolarHBondContact O-CB 3.06Å; N23-S27 PolarHBondContact O-N 3.43Å
24	R	98	Very high	97.5	Very high	152 Å²	152	84.1 Å²	84.1	57%	0.574	41%	0.413	S	S	*	.	H	α-helix	trans	-65.4	-44	177.2	-69.8	175.7	-172.5	-118.7	1.3	112.1	D20 M21 S27 A28 Y58	D20-R24 WeakPolarHBondContact O-CG 3.44Å; D20-R24 PolarHBondContact O-N 3.04Å; D20-R24 IonicContact OD1-CZ 3.57Å; D20-R24 IonicContact OD1-NE 2.94Å; D20-R24 PolarHBondContact OD1-NE 2.84Å; D20-R24 IonicContact OD1-NH2 3.25Å; D20-R24 PolarHBondContact OD1-NH2 3.32Å; D20-R24 WeakPolarHBondContact OD2-CD 3.31Å; D20-R24 IonicContact OD2-CZ 3.5Å; D20-R24 IonicContact OD2-NE 2.79Å; D20-R24 PolarHBondContact OD2-NE 3.37Å; D20-R24 IonicContact OD2-NH2 3.57Å; M21-R24 PolarHBondContact O-N 3.14Å; R24-S27 PolarHBondContact O-N 3.39Å; R24-A28 VanDerWaalsContact O-CB 3.24Å; R24-A28 WeakPolarHBondContact O-CB 3.48Å; R24-A28 PolarHBondContact O-N 2.78Å; R24-Y58 WeakPolarHBondContact CB-OH 3.46Å
25	M	98.6	Very high	97.5	Very high	19 Å²	19	81.5 Å²	81.5	9%	0.094	41%	0.407	C	S	.	.	H	α-helix	trans	-60.1	-50	176.8	-177.4	176.7	64.9	0	0	110.9	M21 Y22 S27 A28 C29 V55 Y58 L59	M21-M25 VanDerWaalsContact O-CB 3.26Å; M21-M25 WeakPolarHBondContact O-CB 3.28Å; M21-M25 PolarHBondContact O-N 3.03Å; Y22-M25 HydrophobicContact CD2-CE 4.18Å; Y22-M25 PolarHBondContact O-N 3.03Å; M25-S27 PolarHBondContact O-N 3Å; M25-A28 PolarHBondContact O-N 2.88Å; M25-C29 WeakPolarHBondContact O-CB 3.3Å; M25-C29 PolarHBondContact O-N 3.01Å; M25-V55 HydrophobicContact CE-CG1 4.48Å; M25-V55 HydrophobicContact SD-CB 4.49Å; M25-V55 HydrophobicContact SD-CG1 3.96Å; M25-V55 HydrophobicContact SD-CG2 4.37Å; M25-Y58 HydrophobicContact CB-CD1 3.7Å; M25-Y58 HydrophobicContact CB-CD2 4.24Å; M25-Y58 HydrophobicContact CB-CE1 3.57Å; M25-Y58 HydrophobicContact CB-CE2 4.11Å; M25-Y58 HydrophobicContact CB-CG 4.05Å; M25-Y58 HydrophobicContact CG-CD1 3.56Å; M25-Y58 HydrophobicContact CG-CD2 4.11Å; M25-Y58 HydrophobicContact CG-CE1 4Å; M25-Y58 HydrophobicContact CG-CE2 4.49Å; M25-Y58 HydrophobicContact CG-CG 3.63Å; M25-Y58 HydrophobicContact SD-CD1 3.8Å; M25-Y58 HydrophobicContact SD-CE1 4.46Å; M25-Y58 HydrophobicContact SD-CG 4.23Å; M25-L59 HydrophobicContact SD-CD2 4.09Å; M25-L59 HydrophobicContact SD-CG 4.23Å
26	T	98.3	Very high	97.3	Very high	61 Å²	61	81.8 Å²	81.8	37%	0.374	41%	0.411	S	S	.	.	H	α-helix	trans	-59.9	-48.4	179.9	-59	0	0	0	0	110.7	Y22 A28 C29 H30	Y22-T26 VanDerWaalsContact O-CB 3.28Å; Y22-T26 WeakPolarHBondContact O-CB 3.3Å; Y22-T26 PolarHBondContact O-N 2.98Å; Y22-T26 PolarHBondContact O-OG1 2.87Å; T26-A28 PolarHBondContact O-N 2.82Å; T26-C29 PolarHBondContact O-N 3.46Å; T26-H30 WeakPolarHBondContact O-CB 3.41Å; T26-H30 PolarHBondContact O-N 2.89Å
27	S	98.2	Very high	97.2	Very high	73 Å²	73	83 Å²	83	51%	0.51	42%	0.416	S	S	.	.	H	α-helix	trans	-60.2	-44.8	176.7	-177.7	0	0	0	0	112.4	N23 R24 M25 R31	N23-S27 WeakPolarHBondContact O-CB 3.06Å; N23-S27 PolarHBondContact O-N 3.43Å; R24-S27 PolarHBondContact O-N 3.39Å; M25-S27 PolarHBondContact O-N 3Å; S27-R31 VanDerWaalsContact O-CB 3.31Å; S27-R31 WeakPolarHBondContact O-CB 3.21Å; S27-R31 PolarHBondContact O-N 3.25Å
28	A	98.6	Very high	97.1	Very high	15 Å²	15	83.9 Å²	83.9	12%	0.124	41%	0.414	C	S	.	.	H	α-helix	trans	-65.3	-43.7	179.7	0	0	0	0	0	112.3	R24 M25 T26 K32 Y58	R24-A28 VanDerWaalsContact O-CB 3.24Å; R24-A28 WeakPolarHBondContact O-CB 3.48Å; R24-A28 PolarHBondContact O-N 2.78Å; M25-A28 PolarHBondContact O-N 2.88Å; T26-A28 PolarHBondContact O-N 2.82Å; A28-K32 WeakPolarHBondContact O-CB 3.24Å; A28-K32 WeakPolarHBondContact O-CG 3.04Å; A28-K32 PolarHBondContact O-N 2.87Å; A28-K32 VanDerWaalsContact O-N 3.13Å; A28-Y58 HydrophobicContact CB-CE2 4.32Å
29	C	98.8	Very high	96.9	Very high	4 Å²	4	87.7 Å²	87.7	3%	0.027	43%	0.427	C	S	.	.	H	α-helix	trans	-75.2	-38.6	-179	-70.2	0	0	0	0	112.6	M25 T26 R31 K32 C33 L51 C54	M25-C29 WeakPolarHBondContact O-CB 3.3Å; M25-C29 PolarHBondContact O-N 3.01Å; T26-C29 PolarHBondContact O-N 3.46Å; C29-R31 PolarHBondContact O-N 2.79Å; C29-K32 PolarHBondContact O-N 3.47Å; C29-C33 VanDerWaalsContact O-CB 3.29Å; C29-C33 WeakPolarHBondContact O-CB 3.3Å; C29-C33 PolarHBondContact O-N 3.07Å; C29-L51 HydrophobicContact CB-CD2 4.13Å; C29-C54 WeakPolarHBondContact CA-SG 3.27Å; C29-C54 HydrophobicContact CB-CB 3.84Å; C29-C54 WeakPolarHBondContact CB-SG 3.35Å; C29-C54 VanDerWaalsContact SG-C 3.5Å; C29-C54 WeakPolarHBondContact SG-CB 3.5Å; C29-C54 CovalentContact SG-SG 2.05Å; C29-C54 PolarHBondContact SG-SG 2.94Å
30	H	97.8	Very high	96.7	Very high	88 Å²	88	90.9 Å²	90.9	41%	0.407	43%	0.433	S	S	.	.	H	α-helix	trans	-56.5	-50.5	170.5	-177.7	-95	0	0	0	110.7	T26 K32 C33 V34 Y38	T26-H30 WeakPolarHBondContact O-CB 3.41Å; T26-H30 PolarHBondContact O-N 2.89Å; H30-K32 VanDerWaalsContact C-N 3.27Å; H30-K32 PolarHBondContact O-N 3.46Å; H30-C33 PolarHBondContact O-N 3.47Å; H30-V34 PolarHBondContact O-N 2.9Å; H30-Y38 PolarHBondContact CE1-OH 3.28Å; H30-Y38 PolarHBondContact NE2-OH 3.43Å
31	R	97.9	Very high	96.5	Very high	180 Å²	180	92.3 Å²	92.3	68%	0.679	46%	0.456	S	S	*	.	H	α-helix	trans	-60	-33.6	178.6	-170	-179.9	77.7	-127.1	8.4	113.7	S27 C29	S27-R31 VanDerWaalsContact O-CB 3.31Å; S27-R31 WeakPolarHBondContact O-CB 3.21Å; S27-R31 PolarHBondContact O-N 3.25Å; C29-R31 PolarHBondContact O-N 2.79Å
32	K	98.4	Very high	96.4	Very high	139 Å²	139	97.9 Å²	97.9	60%	0.604	48%	0.482	S	S	*	.	H	α-helix	trans	-84.8	-33.9	-176.9	-74.5	173.4	-176.6	-179	0	113.2	A28 C29 H30	A28-K32 WeakPolarHBondContact O-CB 3.24Å; A28-K32 WeakPolarHBondContact O-CG 3.04Å; A28-K32 PolarHBondContact O-N 2.87Å; A28-K32 VanDerWaalsContact O-N 3.13Å; C29-K32 PolarHBondContact O-N 3.47Å; H30-K32 VanDerWaalsContact C-N 3.27Å; H30-K32 PolarHBondContact O-N 3.46Å
33	C	98.4	Very high	96.4	Very high	12 Å²	12	95.5 Å²	95.5	8%	0.081	48%	0.478	C	S	.	.	H	α-helix	trans	-111	-23.4	-166.9	-68.6	0	0	0	0	114.1	C29 H30 E47 C50 L51	C29-C33 VanDerWaalsContact O-CB 3.29Å; C29-C33 WeakPolarHBondContact O-CB 3.3Å; C29-C33 PolarHBondContact O-N 3.07Å; H30-C33 PolarHBondContact O-N 3.47Å; C33-E47 WeakPolarHBondContact O-CG 3.42Å; C33-C50 WeakPolarHBondContact CA-SG 3.49Å; C33-C50 HydrophobicContact CB-CB 3.63Å; C33-C50 WeakPolarHBondContact CB-SG 3.47Å; C33-C50 WeakPolarHBondContact SG-CB 3.32Å; C33-C50 PolarHBondContact SG-O 3.25Å; C33-C50 CovalentContact SG-SG 2.06Å; C33-C50 PolarHBondContact SG-SG 2.97Å; C33-L51 HydrophobicContact CB-CD2 3.8Å; C33-L51 HydrophobicContact CB-CG 3.9Å
34	V	97.4	Very high	96.3	Very high	13 Å²	13	92.3 Å²	92.3	8%	0.079	46%	0.463	C	S	.	.	S	Bend	trans	-114.7	106.7	-176	-174.7	0	0	0	0	109.1	H30 Y38 L43 L51	H30-V34 PolarHBondContact O-N 2.9Å; V34-Y38 HydrophobicContact CG1-CD1 4.26Å; V34-Y38 HydrophobicContact CG1-CE1 3.47Å; V34-Y38 VanDerWaalsContact CG1-CE1 3.47Å; V34-L43 HydrophobicContact CG2-CD2 4.19Å; V34-L51 HydrophobicContact CG2-CD1 4.37Å; V34-L51 HydrophobicContact CG2-CD2 4.43Å
35	P	94.4	Very high	96.2	Very high	70 Å²	70	93.8 Å²	93.8	46%	0.455	47%	0.474	S	S	.	.			trans	-60.9	148.6	177.6	-21.8	33.9	0	0	0	111.6	H37 E47	P35-H37 PolarHBondContact O-N 3.06Å; P35-H37 VanDerWaalsContact O-N 3.09Å; P35-E47 WeakPolarHBondContact CD-OE1 3.44Å
36	P	93.8	Very high	96.1	Very high	105 Å²	105	95.3 Å²	95.3	68%	0.682	50%	0.495	S	S	*	.	S	Bend	trans	-66.6	-13.8	-179.8	27.7	-35.7	0	0	0	113.7	Y38	P36-Y38 WeakPolarHBondContact O-CD2 3.44Å; P36-Y38 WeakPolarHBondContact O-CE2 3.34Å
37	H	94.1	Very high	96.1	Very high	159 Å²	159	93.9 Å²	93.9	74%	0.736	48%	0.484	S	S	*	.	S	Bend	trans	-98.8	92.1	176.9	-63.5	-62.4	0	0	0	110.5	P35 K39	P35-H37 PolarHBondContact O-N 3.06Å; P35-H37 VanDerWaalsContact O-N 3.09Å; H37-K39 PolarHBondContact O-N 3.5Å
38	Y	93.5	Very high	96.1	Very high	142 Å²	142	92.4 Å²	92.4	56%	0.557	47%	0.474	S	S	*	.			trans	-73.5	114.1	177.1	-56.2	-91.1	0	0	0	110.2	H30 V34 P36	H30-Y38 PolarHBondContact CE1-OH 3.28Å; H30-Y38 PolarHBondContact NE2-OH 3.43Å; V34-Y38 HydrophobicContact CG1-CD1 4.26Å; V34-Y38 HydrophobicContact CG1-CE1 3.47Å; V34-Y38 VanDerWaalsContact CG1-CE1 3.47Å; P36-Y38 WeakPolarHBondContact O-CD2 3.44Å; P36-Y38 WeakPolarHBondContact O-CE2 3.34Å
39	K	91.4	Very high	96.1	Very high	208 Å²	208	94.5 Å²	94.5	90%	0.904	49%	0.485	S	S	*	.	S	Bend	trans	-90.7	-24.3	176.1	-65.9	-176.4	-179.8	179.6	0	112.6	H37	H37-K39 PolarHBondContact O-N 3.5Å
40	E	92.4	Very high	96.1	Very high	115 Å²	115	96.5 Å²	96.5	54%	0.537	50%	0.498	S	S	.	.	S	Bend	trans	-141.1	157.1	-177.1	48	-172.5	-169.8	0	0	109.3	S44	E40-S44 VanDerWaalsContact OE1-CB 3.24Å; E40-S44 WeakPolarHBondContact OE1-CB 3.2Å
41	A	92.9	Very high	96.2	Very high	107 Å²	107	94 Å²	94	88%	0.884	49%	0.488	S	S	*	.	S	Bend	trans	-77.9	-25.6	-177.8	0	0	0	0	0	112.8
42	E	96.1	Very high	96.2	Very high	154 Å²	154	91 Å²	91	72%	0.72	49%	0.485	S	S	*	.	S	Bend	trans	-98.1	157.6	-178.8	-64.7	-60	149.9	0	0	111	S44	E42-S44 PolarHBondContact O-N 3.49Å
43	L	96.4	Very high	96.2	Very high	87 Å²	87	92.3 Å²	92.3	46%	0.455	49%	0.486	S	S	.	.	P	Polyproline II helix	trans	-67.8	127.1	172.4	-65.8	171.4	0	0	0	110.2	V34 E47 S48 L51	V34-L43 HydrophobicContact CG2-CD2 4.19Å; L43-E47 HydrophobicContact CB-CB 4.38Å; L43-E47 HydrophobicContact CD2-CB 4.01Å; L43-S48 WeakPolarHBondContact CB-OG 3.4Å; L43-L51 HydrophobicContact CD1-CD1 3.63Å; L43-L51 HydrophobicContact CD2-CD1 3.95Å; L43-L51 HydrophobicContact CG-CD1 4.44Å
44	S	96.5	Very high	96.2	Very high	35 Å²	35	92.4 Å²	92.4	25%	0.245	49%	0.487	C	S	.	.	P	Polyproline II helix	trans	-62.5	155.9	167.5	69.9	0	0	0	0	110.3	E40 E42 G46 E47 S48	E40-S44 VanDerWaalsContact OE1-CB 3.24Å; E40-S44 WeakPolarHBondContact OE1-CB 3.2Å; E42-S44 PolarHBondContact O-N 3.49Å; S44-G46 PolarHBondContact O-N 2.89Å; S44-G46 VanDerWaalsContact O-N 3.08Å; S44-E47 VanDerWaalsContact CB-OE2 3.28Å; S44-E47 WeakPolarHBondContact CB-OE2 3.34Å; S44-E47 PolarHBondContact N-OE2 2.79Å; S44-E47 PolarHBondContact O-N 3.41Å; S44-E47 VanDerWaalsContact OG-CD 3.28Å; S44-E47 VanDerWaalsContact OG-CG 3.24Å; S44-E47 WeakPolarHBondContact OG-CG 3.26Å; S44-E47 PolarHBondContact OG-N 3.25Å; S44-E47 PolarHBondContact OG-OE2 2.94Å; S44-S48 PolarHBondContact O-N 3.31Å; S44-S48 PolarHBondContact O-OG 2.97Å
45	K	96.6	Very high	96.3	Very high	183 Å²	183	94.3 Å²	94.3	80%	0.796	50%	0.498	S	S	*	.	H	α-helix	trans	-52.8	-34.8	174.3	-175.1	177.3	-179.3	178.6	0	112.6	V49	K45-V49 VanDerWaalsContact O-CG2 3.3Å; K45-V49 WeakPolarHBondContact O-CG2 3.34Å; K45-V49 PolarHBondContact O-N 2.95Å
46	G	96.7	Very high	96.5	Very high	52 Å²	52	94.7 Å²	94.7	54%	0.536	50%	0.503	S	S	.	.	H	α-helix	trans	-67.8	-44.8	177.8	0	0	0	0	0	112.5	S44 C50	S44-G46 PolarHBondContact O-N 2.89Å; S44-G46 VanDerWaalsContact O-N 3.08Å; G46-C50 WeakPolarHBondContact O-CB 3.28Å; G46-C50 PolarHBondContact O-N 3.36Å
47	E	98.2	Very high	96.8	Very high	30 Å²	30	96.4 Å²	96.4	14%	0.14	50%	0.499	C	S	.	.	H	α-helix	trans	-64.1	-45.9	177.4	-69.8	162.6	141	0	0	111.1	C33 P35 L43 S44 V49 C50 L51	C33-E47 WeakPolarHBondContact O-CG 3.42Å; P35-E47 WeakPolarHBondContact CD-OE1 3.44Å; L43-E47 HydrophobicContact CB-CB 4.38Å; L43-E47 HydrophobicContact CD2-CB 4.01Å; S44-E47 VanDerWaalsContact CB-OE2 3.28Å; S44-E47 WeakPolarHBondContact CB-OE2 3.34Å; S44-E47 PolarHBondContact N-OE2 2.79Å; S44-E47 PolarHBondContact O-N 3.41Å; S44-E47 VanDerWaalsContact OG-CD 3.28Å; S44-E47 VanDerWaalsContact OG-CG 3.24Å; S44-E47 WeakPolarHBondContact OG-CG 3.26Å; S44-E47 PolarHBondContact OG-N 3.25Å; S44-E47 PolarHBondContact OG-OE2 2.94Å; E47-V49 PolarHBondContact O-N 3.09Å; E47-C50 WeakPolarHBondContact O-CB 3.26Å; E47-C50 PolarHBondContact O-N 2.99Å; E47-C50 VanDerWaalsContact O-N 3.16Å; E47-L51 WeakPolarHBondContact O-CB 3.34Å; E47-L51 VanDerWaalsContact O-CG 3.3Å; E47-L51 WeakPolarHBondContact O-CG 3.48Å; E47-L51 PolarHBondContact O-N 3.4Å
48	S	98.1	Very high	97	Very high	43 Å²	43	91.3 Å²	91.3	30%	0.301	47%	0.474	S	S	.	.	H	α-helix	trans	-58.2	-50	177.9	-55.8	0	0	0	0	112	L43 S44 C50 L51 D52	L43-S48 WeakPolarHBondContact CB-OG 3.4Å; S44-S48 PolarHBondContact O-N 3.31Å; S44-S48 PolarHBondContact O-OG 2.97Å; S48-C50 VanDerWaalsContact C-N 3.3Å; S48-C50 PolarHBondContact O-N 2.98Å; S48-L51 PolarHBondContact O-N 3.23Å; S48-D52 PolarHBondContact O-N 2.87Å
49	V	98.7	Very high	97.2	Very high	58 Å²	58	88.1 Å²	88.1	35%	0.352	47%	0.467	S	S	.	.	H	α-helix	trans	-64.8	-34.9	177.7	173.5	0	0	0	0	111.8	K45 E47 R53	K45-V49 VanDerWaalsContact O-CG2 3.3Å; K45-V49 WeakPolarHBondContact O-CG2 3.34Å; K45-V49 PolarHBondContact O-N 2.95Å; E47-V49 PolarHBondContact O-N 3.09Å; V49-R53 VanDerWaalsContact O-CG 3.28Å; V49-R53 WeakPolarHBondContact O-CG 3.46Å; V49-R53 PolarHBondContact O-N 3.39Å
50	C	98.8	Very high	97.6	Very high	46 Å²	46	81 Å²	81	31%	0.311	44%	0.439	S	S	.	.	H	α-helix	trans	-64.8	-47.1	174.3	-176.8	0	0	0	0	111.3	C33 G46 E47 S48 D52 R53 C54	C33-C50 WeakPolarHBondContact CA-SG 3.49Å; C33-C50 HydrophobicContact CB-CB 3.63Å; C33-C50 WeakPolarHBondContact CB-SG 3.47Å; C33-C50 WeakPolarHBondContact SG-CB 3.32Å; C33-C50 PolarHBondContact SG-O 3.25Å; C33-C50 CovalentContact SG-SG 2.06Å; C33-C50 PolarHBondContact SG-SG 2.97Å; G46-C50 WeakPolarHBondContact O-CB 3.28Å; G46-C50 PolarHBondContact O-N 3.36Å; E47-C50 WeakPolarHBondContact O-CB 3.26Å; E47-C50 PolarHBondContact O-N 2.99Å; E47-C50 VanDerWaalsContact O-N 3.16Å; S48-C50 VanDerWaalsContact C-N 3.3Å; S48-C50 PolarHBondContact O-N 2.98Å; C50-D52 PolarHBondContact O-N 3.44Å; C50-R53 PolarHBondContact O-N 2.93Å; C50-C54 VanDerWaalsContact O-CB 3.3Å; C50-C54 WeakPolarHBondContact O-CB 3.29Å; C50-C54 PolarHBondContact O-N 3.46Å
51	L	98.8	Very high	97.8	Very high	37 Å²	37	79.9 Å²	79.9	19%	0.194	44%	0.435	C	S	.	.	H	α-helix	trans	-59.3	-47.6	-179.8	-74.3	167.4	0	0	0	110.9	C29 C33 V34 L43 E47 S48 R53 C54 V55	C29-L51 HydrophobicContact CB-CD2 4.13Å; C33-L51 HydrophobicContact CB-CD2 3.8Å; C33-L51 HydrophobicContact CB-CG 3.9Å; V34-L51 HydrophobicContact CG2-CD1 4.37Å; V34-L51 HydrophobicContact CG2-CD2 4.43Å; L43-L51 HydrophobicContact CD1-CD1 3.63Å; L43-L51 HydrophobicContact CD2-CD1 3.95Å; L43-L51 HydrophobicContact CG-CD1 4.44Å; E47-L51 WeakPolarHBondContact O-CB 3.34Å; E47-L51 VanDerWaalsContact O-CG 3.3Å; E47-L51 WeakPolarHBondContact O-CG 3.48Å; E47-L51 PolarHBondContact O-N 3.4Å; S48-L51 PolarHBondContact O-N 3.23Å; L51-R53 VanDerWaalsContact C-N 3.35Å; L51-R53 PolarHBondContact O-N 3.45Å; L51-C54 WeakPolarHBondContact O-CB 3.41Å; L51-C54 PolarHBondContact O-N 2.92Å; L51-C54 VanDerWaalsContact O-N 3.1Å; L51-V55 WeakPolarHBondContact O-CG2 3.25Å; L51-V55 PolarHBondContact O-N 2.91Å
52	D	98.8	Very high	97.9	Very high	116 Å²	116	79.3 Å²	79.3	62%	0.62	41%	0.414	S	S	*	.	H	α-helix	trans	-55.8	-48.8	176.5	-68	-25.3	0	0	0	111.8	S48 C50 C54 S56	S48-D52 PolarHBondContact O-N 2.87Å; C50-D52 PolarHBondContact O-N 3.44Å; D52-C54 VanDerWaalsContact C-N 3.33Å; D52-C54 PolarHBondContact O-N 3.33Å; D52-S56 WeakPolarHBondContact O-CB 3.39Å; D52-S56 PolarHBondContact O-N 3.5Å
53	R	98.8	Very high	98	Very high	166 Å²	166	76.9 Å²	76.9	63%	0.626	40%	0.403	S	S	*	.	H	α-helix	trans	-65.4	-37.1	177.6	-71.6	172.6	175	-177.8	-0.8	112.1	V49 C50 L51 K57	V49-R53 VanDerWaalsContact O-CG 3.28Å; V49-R53 WeakPolarHBondContact O-CG 3.46Å; V49-R53 PolarHBondContact O-N 3.39Å; C50-R53 PolarHBondContact O-N 2.93Å; L51-R53 VanDerWaalsContact C-N 3.35Å; L51-R53 PolarHBondContact O-N 3.45Å; R53-K57 WeakPolarHBondContact O-CB 3.41Å; R53-K57 VanDerWaalsContact O-CG 3.26Å; R53-K57 WeakPolarHBondContact O-CG 3.49Å; R53-K57 PolarHBondContact O-N 3.27Å
54	C	98.9	Very high	98.1	Very high	15 Å²	15	79.3 Å²	79.3	10%	0.101	41%	0.406	C	S	.	.	H	α-helix	trans	-66	-48.6	179.8	-178.4	0	0	0	0	110.9	C29 C50 L51 D52 K57 Y58	C29-C54 WeakPolarHBondContact CA-SG 3.27Å; C29-C54 HydrophobicContact CB-CB 3.84Å; C29-C54 WeakPolarHBondContact CB-SG 3.35Å; C29-C54 VanDerWaalsContact SG-C 3.5Å; C29-C54 WeakPolarHBondContact SG-CB 3.5Å; C29-C54 CovalentContact SG-SG 2.05Å; C29-C54 PolarHBondContact SG-SG 2.94Å; C50-C54 VanDerWaalsContact O-CB 3.3Å; C50-C54 WeakPolarHBondContact O-CB 3.29Å; C50-C54 PolarHBondContact O-N 3.46Å; L51-C54 WeakPolarHBondContact O-CB 3.41Å; L51-C54 PolarHBondContact O-N 2.92Å; L51-C54 VanDerWaalsContact O-N 3.1Å; D52-C54 VanDerWaalsContact C-N 3.33Å; D52-C54 PolarHBondContact O-N 3.33Å; C54-K57 PolarHBondContact O-N 2.92Å; C54-Y58 WeakPolarHBondContact O-CB 3.37Å; C54-Y58 PolarHBondContact O-N 2.94Å
55	V	98.8	Very high	98	Very high	52 Å²	52	83.1 Å²	83.1	32%	0.315	42%	0.421	S	S	.	.	H	α-helix	trans	-60	-48.3	177.3	171	0	0	0	0	110.4	M25 L51 K57 Y58 L59	M25-V55 HydrophobicContact CE-CG1 4.48Å; M25-V55 HydrophobicContact SD-CB 4.49Å; M25-V55 HydrophobicContact SD-CG1 3.96Å; M25-V55 HydrophobicContact SD-CG2 4.37Å; L51-V55 WeakPolarHBondContact O-CG2 3.25Å; L51-V55 PolarHBondContact O-N 2.91Å; V55-K57 PolarHBondContact O-N 2.63Å; V55-Y58 PolarHBondContact O-N 2.93Å; V55-Y58 VanDerWaalsContact O-N 3.14Å; V55-L59 HydrophobicContact CG1-CD1 4.01Å; V55-L59 HydrophobicContact CG1-CG 4.48Å; V55-L59 WeakPolarHBondContact O-CG 3.29Å; V55-L59 PolarHBondContact O-N 3.4Å
56	S	98.8	Very high	98	Very high	78 Å²	78	76 Å²	76	55%	0.545	40%	0.4	S	S	.	.	H	α-helix	trans	-55.7	-47.8	177.1	172.5	0	0	0	0	112.3	D52 L59 D60	D52-S56 WeakPolarHBondContact O-CB 3.39Å; D52-S56 PolarHBondContact O-N 3.5Å; S56-L59 PolarHBondContact O-N 3.16Å; S56-D60 WeakPolarHBondContact O-CB 3.43Å; S56-D60 PolarHBondContact O-N 3.11Å
57	K	98.8	Very high	98	Very high	141 Å²	141	79.1 Å²	79.1	61%	0.613	40%	0.398	S	S	*	.	H	α-helix	trans	-66.4	-37.3	177.2	-72.7	176.2	-177.7	-174.1	0	112.9	R53 C54 V55 I61	R53-K57 WeakPolarHBondContact O-CB 3.41Å; R53-K57 VanDerWaalsContact O-CG 3.26Å; R53-K57 WeakPolarHBondContact O-CG 3.49Å; R53-K57 PolarHBondContact O-N 3.27Å; C54-K57 PolarHBondContact O-N 2.92Å; V55-K57 PolarHBondContact O-N 2.63Å; K57-I61 WeakPolarHBondContact O-CB 3.48Å; K57-I61 WeakPolarHBondContact O-CG1 3.17Å; K57-I61 PolarHBondContact O-N 3.29Å
58	Y	98.7	Very high	98	Very high	52 Å²	52	82 Å²	82	20%	0.204	41%	0.411	C	S	.	.	H	α-helix	trans	-62.7	-46.9	179.5	-170.9	-80.8	0	0	0	110.4	M21 R24 M25 A28 C54 V55 I61 H62	M21-Y58 HydrophobicContact CG-CE1 4.05Å; R24-Y58 WeakPolarHBondContact CB-OH 3.46Å; M25-Y58 HydrophobicContact CB-CD1 3.7Å; M25-Y58 HydrophobicContact CB-CD2 4.24Å; M25-Y58 HydrophobicContact CB-CE1 3.57Å; M25-Y58 HydrophobicContact CB-CE2 4.11Å; M25-Y58 HydrophobicContact CB-CG 4.05Å; M25-Y58 HydrophobicContact CG-CD1 3.56Å; M25-Y58 HydrophobicContact CG-CD2 4.11Å; M25-Y58 HydrophobicContact CG-CE1 4Å; M25-Y58 HydrophobicContact CG-CE2 4.49Å; M25-Y58 HydrophobicContact CG-CG 3.63Å; M25-Y58 HydrophobicContact SD-CD1 3.8Å; M25-Y58 HydrophobicContact SD-CE1 4.46Å; M25-Y58 HydrophobicContact SD-CG 4.23Å; A28-Y58 HydrophobicContact CB-CE2 4.32Å; C54-Y58 WeakPolarHBondContact O-CB 3.37Å; C54-Y58 PolarHBondContact O-N 2.94Å; V55-Y58 PolarHBondContact O-N 2.93Å; V55-Y58 VanDerWaalsContact O-N 3.14Å; Y58-I61 PolarHBondContact O-N 3.09Å; Y58-H62 VanDerWaalsContact O-CB 3.29Å; Y58-H62 WeakPolarHBondContact O-CB 3.31Å; Y58-H62 PolarHBondContact O-N 3.28Å
59	L	98.4	Very high	97.9	Very high	76 Å²	76	85.4 Å²	85.4	40%	0.398	43%	0.425	S	S	.	.	H	α-helix	trans	-67.4	-41.5	179.3	-65.6	175.8	0	0	0	112.4	M21 M25 V55 S56 I61 H62 E63	M21-L59 HydrophobicContact CE-CD2 4.04Å; M21-L59 HydrophobicContact SD-CD2 4.26Å; M25-L59 HydrophobicContact SD-CD2 4.09Å; M25-L59 HydrophobicContact SD-CG 4.23Å; V55-L59 HydrophobicContact CG1-CD1 4.01Å; V55-L59 HydrophobicContact CG1-CG 4.48Å; V55-L59 WeakPolarHBondContact O-CG 3.29Å; V55-L59 PolarHBondContact O-N 3.4Å; S56-L59 PolarHBondContact O-N 3.16Å; L59-I61 PolarHBondContact O-N 3.4Å; L59-H62 WeakPolarHBondContact O-CB 3.47Å; L59-H62 PolarHBondContact O-N 3.06Å; L59-E63 PolarHBondContact O-N 3.36Å
60	D	98.4	Very high	97.8	Very high	59 Å²	59	86.7 Å²	86.7	32%	0.316	43%	0.433	S	S	.	.	H	α-helix	trans	-59.3	-46	175	176	36.2	0	0	0	111.6	S56 E63 R64	S56-D60 WeakPolarHBondContact O-CB 3.43Å; S56-D60 PolarHBondContact O-N 3.11Å; D60-E63 PolarHBondContact O-N 3.42Å; D60-R64 VanDerWaalsContact CG-NH2 3.33Å; D60-R64 VanDerWaalsContact O-CG 3.29Å; D60-R64 WeakPolarHBondContact O-CG 3.5Å; D60-R64 PolarHBondContact O-N 3.19Å; D60-R64 VanDerWaalsContact O-N 3.07Å; D60-R64 IonicContact OD1-CZ 3.32Å; D60-R64 VanDerWaalsContact OD1-CZ 3.32Å; D60-R64 IonicContact OD1-NE 2.79Å; D60-R64 PolarHBondContact OD1-NE 3.43Å; D60-R64 IonicContact OD1-NH2 3.01Å; D60-R64 PolarHBondContact OD1-NH2 3.16Å; D60-R64 IonicContact OD2-CZ 3.34Å; D60-R64 IonicContact OD2-NE 3.46Å; D60-R64 PolarHBondContact OD2-NE 3.28Å; D60-R64 IonicContact OD2-NH2 2.82Å; D60-R64 PolarHBondContact OD2-NH2 3.29Å
61	I	97.3	Very high	97.7	Very high	91 Å²	91	88.8 Å²	88.8	47%	0.467	44%	0.438	S	S	.	.	H	α-helix	trans	-66.8	-41.6	176.2	-68	-67.3	0	0	0	111.2	K57 Y58 L59 E63 R64 M65	K57-I61 WeakPolarHBondContact O-CB 3.48Å; K57-I61 WeakPolarHBondContact O-CG1 3.17Å; K57-I61 PolarHBondContact O-N 3.29Å; Y58-I61 PolarHBondContact O-N 3.09Å; L59-I61 PolarHBondContact O-N 3.4Å; I61-E63 VanDerWaalsContact C-N 3.34Å; I61-E63 PolarHBondContact O-N 3.45Å; I61-R64 PolarHBondContact O-N 3.45Å; I61-M65 HydrophobicContact CG2-CG 4.11Å; I61-M65 WeakPolarHBondContact O-CB 3.42Å; I61-M65 VanDerWaalsContact O-CG 3.25Å; I61-M65 WeakPolarHBondContact O-CG 3.46Å; I61-M65 PolarHBondContact O-N 2.98Å
62	H	96.1	Very high	97.6	Very high	95 Å²	95	90.5 Å²	90.5	44%	0.44	45%	0.447	S	S	.	.	H	α-helix	trans	-57.5	-46	176.9	-179.4	-93.4	0	0	0	111.6	Y58 L59 M65 G66	Y58-H62 VanDerWaalsContact O-CB 3.29Å; Y58-H62 WeakPolarHBondContact O-CB 3.31Å; Y58-H62 PolarHBondContact O-N 3.28Å; L59-H62 WeakPolarHBondContact O-CB 3.47Å; L59-H62 PolarHBondContact O-N 3.06Å; H62-M65 PolarHBondContact O-N 3.07Å; H62-G66 PolarHBondContact O-N 3.32Å
63	E	97.5	Very high	97.5	Very high	103 Å²	103	88 Å²	88	48%	0.481	44%	0.439	S	S	.	.	H	α-helix	trans	-61.3	-47.2	176.4	-174.7	-173.5	168.7	0	0	111.9	L59 D60 I61 M65 G66 K67	L59-E63 PolarHBondContact O-N 3.36Å; D60-E63 PolarHBondContact O-N 3.42Å; I61-E63 VanDerWaalsContact C-N 3.34Å; I61-E63 PolarHBondContact O-N 3.45Å; E63-M65 VanDerWaalsContact C-N 3.33Å; E63-M65 PolarHBondContact O-N 2.94Å; E63-G66 PolarHBondContact O-N 3.42Å; E63-K67 WeakPolarHBondContact O-CG 3.31Å; E63-K67 PolarHBondContact O-N 3.13Å; E63-K67 WeakPolarHBondContact OE1-CE 3.38Å; E63-K67 IonicContact OE1-NZ 2.63Å; E63-K67 PolarHBondContact OE1-NZ 3.34Å
64	R	97.9	Very high	97.3	Very high	138 Å²	138	86.2 Å²	86.2	52%	0.521	44%	0.439	S	S	.	.	H	α-helix	trans	-61.6	-41.6	178.6	-70	174.1	-164.9	-154.2	7.5	112.1	D60 I61 K68	D60-R64 VanDerWaalsContact CG-NH2 3.33Å; D60-R64 VanDerWaalsContact O-CG 3.29Å; D60-R64 WeakPolarHBondContact O-CG 3.5Å; D60-R64 PolarHBondContact O-N 3.19Å; D60-R64 VanDerWaalsContact O-N 3.07Å; D60-R64 IonicContact OD1-CZ 3.32Å; D60-R64 VanDerWaalsContact OD1-CZ 3.32Å; D60-R64 IonicContact OD1-NE 2.79Å; D60-R64 PolarHBondContact OD1-NE 3.43Å; D60-R64 IonicContact OD1-NH2 3.01Å; D60-R64 PolarHBondContact OD1-NH2 3.16Å; D60-R64 IonicContact OD2-CZ 3.34Å; D60-R64 IonicContact OD2-NE 3.46Å; D60-R64 PolarHBondContact OD2-NE 3.28Å; D60-R64 IonicContact OD2-NH2 2.82Å; D60-R64 PolarHBondContact OD2-NH2 3.29Å; I61-R64 PolarHBondContact O-N 3.45Å; R64-K68 WeakPolarHBondContact O-CB 3.49Å; R64-K68 PolarHBondContact O-N 3.03Å
65	M	95.6	Very high	97.1	Very high	114 Å²	114	90.5 Å²	90.5	56%	0.562	46%	0.458	S	S	*	.	H	α-helix	trans	-65.5	-41.9	176.1	-68.3	-59.3	97	0	0	111.2	I61 H62 E63 K68 L69	I61-M65 HydrophobicContact CG2-CG 4.11Å; I61-M65 WeakPolarHBondContact O-CB 3.42Å; I61-M65 VanDerWaalsContact O-CG 3.25Å; I61-M65 WeakPolarHBondContact O-CG 3.46Å; I61-M65 PolarHBondContact O-N 2.98Å; H62-M65 PolarHBondContact O-N 3.07Å; E63-M65 VanDerWaalsContact C-N 3.33Å; E63-M65 PolarHBondContact O-N 2.94Å; M65-K68 PolarHBondContact O-N 3.49Å; M65-L69 WeakPolarHBondContact O-CB 3.28Å; M65-L69 PolarHBondContact O-N 3.48Å
66	G	95.6	Very high	96.9	Very high	34 Å²	34	92.5 Å²	92.5	35%	0.351	47%	0.466	S	S	.	.	H	α-helix	trans	-58.3	-49.6	174.8	0	0	0	0	0	112.2	H62 E63 K68 L69 T70	H62-G66 PolarHBondContact O-N 3.32Å; E63-G66 PolarHBondContact O-N 3.42Å; G66-K68 VanDerWaalsContact C-N 3.32Å; G66-K68 PolarHBondContact O-N 3.06Å; G66-L69 PolarHBondContact O-N 2.91Å; G66-T70 PolarHBondContact O-N 3.47Å; G66-T70 PolarHBondContact O-OG1 3.05Å
67	K	97.7	Very high	96.7	Very high	117 Å²	117	93.6 Å²	93.6	51%	0.509	46%	0.463	S	S	.	.	H	α-helix	trans	-58.1	-45.3	175	-71.1	177	-175.1	169.5	0	111.7	E63 L69 T70 E71	E63-K67 WeakPolarHBondContact O-CG 3.31Å; E63-K67 PolarHBondContact O-N 3.13Å; E63-K67 WeakPolarHBondContact OE1-CE 3.38Å; E63-K67 IonicContact OE1-NZ 2.63Å; E63-K67 PolarHBondContact OE1-NZ 3.34Å; K67-L69 VanDerWaalsContact C-N 3.32Å; K67-L69 PolarHBondContact O-N 3.39Å; K67-T70 PolarHBondContact O-N 3.44Å; K67-E71 WeakPolarHBondContact O-CG 3.38Å; K67-E71 PolarHBondContact O-N 3.04Å
68	K	97.5	Very high	96.4	Very high	92 Å²	92	91.6 Å²	91.6	40%	0.4	46%	0.456	S	S	.	.	H	α-helix	trans	-64.5	-38.9	-178.6	-172.2	57.9	-177	174	0	112.3	R64 M65 G66 E71 L72	R64-K68 WeakPolarHBondContact O-CB 3.49Å; R64-K68 PolarHBondContact O-N 3.03Å; M65-K68 PolarHBondContact O-N 3.49Å; G66-K68 VanDerWaalsContact C-N 3.32Å; G66-K68 PolarHBondContact O-N 3.06Å; K68-E71 WeakPolarHBondContact CD-OE2 3.33Å; K68-E71 IonicContact NZ-OE2 2.98Å; K68-E71 PolarHBondContact NZ-OE2 3.29Å; K68-E71 PolarHBondContact O-N 3.05Å; K68-L72 HydrophobicContact CG-CD1 4.37Å; K68-L72 VanDerWaalsContact O-CG 3.31Å; K68-L72 WeakPolarHBondContact O-CG 3.37Å; K68-L72 PolarHBondContact O-N 3Å; K68-L72 VanDerWaalsContact O-N 3.09Å
69	L	96.9	Very high	96.2	Very high	114 Å²	114	94.1 Å²	94.1	60%	0.597	47%	0.472	S	S	*	.	H	α-helix	trans	-63.2	-46	176.1	-177.7	60.7	0	0	0	111	M65 G66 K67 E71 L72 S73	M65-L69 WeakPolarHBondContact O-CB 3.28Å; M65-L69 PolarHBondContact O-N 3.48Å; G66-L69 PolarHBondContact O-N 2.91Å; K67-L69 VanDerWaalsContact C-N 3.32Å; K67-L69 PolarHBondContact O-N 3.39Å; L69-E71 PolarHBondContact O-N 3.02Å; L69-L72 PolarHBondContact O-N 3.22Å; L69-S73 PolarHBondContact O-N 2.77Å; L69-S73 PolarHBondContact O-OG 3.34Å; L69-S73 VanDerWaalsContact O-OG 3.13Å
70	T	95.8	Very high	95.9	Very high	84 Å²	84	96 Å²	96	52%	0.515	48%	0.48	S	S	.	.	H	α-helix	trans	-59.4	-44.8	176.2	-57	0	0	0	0	112.1	G66 K67 L72 S73 M74	G66-T70 PolarHBondContact O-N 3.47Å; G66-T70 PolarHBondContact O-OG1 3.05Å; K67-T70 PolarHBondContact O-N 3.44Å; T70-L72 VanDerWaalsContact C-N 3.31Å; T70-L72 PolarHBondContact O-N 3.45Å; T70-S73 PolarHBondContact O-N 3.47Å; T70-M74 HydrophobicContact CG2-SD 4.33Å; T70-M74 WeakPolarHBondContact O-CG 3.47Å; T70-M74 PolarHBondContact O-N 2.98Å
71	E	97.1	Very high	95.6	Very high	91 Å²	91	98.2 Å²	98.2	43%	0.425	49%	0.487	S	S	.	.	H	α-helix	trans	-56.5	-45.3	175.3	-73.3	171	-165.7	0	0	112.1	K67 K68 L69 M74 Q75	K67-E71 WeakPolarHBondContact O-CG 3.38Å; K67-E71 PolarHBondContact O-N 3.04Å; K68-E71 WeakPolarHBondContact CD-OE2 3.33Å; K68-E71 IonicContact NZ-OE2 2.98Å; K68-E71 PolarHBondContact NZ-OE2 3.29Å; K68-E71 PolarHBondContact O-N 3.05Å; L69-E71 PolarHBondContact O-N 3.02Å; E71-M74 PolarHBondContact O-N 3.36Å; E71-Q75 WeakPolarHBondContact O-CG 3.38Å; E71-Q75 PolarHBondContact O-N 3.44Å; E71-Q75 VanDerWaalsContact O-N 3.11Å
72	L	96.8	Very high	95.3	Very high	73 Å²	73	101.1 Å²	101.1	38%	0.382	49%	0.492	S	S	.	.	H	α-helix	trans	-65.3	-43.5	179.4	-70.3	170.7	0	0	0	111.2	K68 L69 T70 M74 Q75 D76	K68-L72 HydrophobicContact CG-CD1 4.37Å; K68-L72 VanDerWaalsContact O-CG 3.31Å; K68-L72 WeakPolarHBondContact O-CG 3.37Å; K68-L72 PolarHBondContact O-N 3Å; K68-L72 VanDerWaalsContact O-N 3.09Å; L69-L72 PolarHBondContact O-N 3.22Å; T70-L72 VanDerWaalsContact C-N 3.31Å; T70-L72 PolarHBondContact O-N 3.45Å; L72-M74 VanDerWaalsContact C-N 3.3Å; L72-M74 PolarHBondContact O-N 2.89Å; L72-Q75 WeakPolarHBondContact O-CB 3.42Å; L72-Q75 PolarHBondContact O-N 2.65Å; L72-Q75 VanDerWaalsContact O-N 3.16Å; L72-D76 PolarHBondContact O-N 3.48Å
73	S	95.9	Very high	95	Very high	64 Å²	64	100.4 Å²	100.4	45%	0.448	50%	0.495	S	S	.	.	H	α-helix	trans	-60.8	-38.5	177.1	-58.8	0	0	0	0	112.7	L69 T70 D76 E77	L69-S73 PolarHBondContact O-N 2.77Å; L69-S73 PolarHBondContact O-OG 3.34Å; L69-S73 VanDerWaalsContact O-OG 3.13Å; T70-S73 PolarHBondContact O-N 3.47Å; S73-D76 PolarHBondContact O-N 3.22Å; S73-E77 PolarHBondContact O-N 3.47Å
74	M	95	Very high	94.5	Very high	128 Å²	128	101.8 Å²	101.8	63%	0.631	50%	0.501	S	S	*	.	H	α-helix	trans	-66.8	-39.4	175.6	-68.4	175.9	68.3	0	0	112.2	T70 E71 L72 E77 E78	T70-M74 HydrophobicContact CG2-SD 4.33Å; T70-M74 WeakPolarHBondContact O-CG 3.47Å; T70-M74 PolarHBondContact O-N 2.98Å; E71-M74 PolarHBondContact O-N 3.36Å; L72-M74 VanDerWaalsContact C-N 3.3Å; L72-M74 PolarHBondContact O-N 2.89Å; M74-E77 PolarHBondContact O-N 3.33Å; M74-E78 PolarHBondContact O-N 3.41Å
75	Q	94.7	Very high	93.8	Very high	105 Å²	105	102.7 Å²	102.7	49%	0.491	51%	0.511	S	S	.	.	H	α-helix	trans	-65	-41.8	176.3	-71.6	172.6	21.3	0	0	111.6	E71 L72 E78 L79	E71-Q75 WeakPolarHBondContact O-CG 3.38Å; E71-Q75 PolarHBondContact O-N 3.44Å; E71-Q75 VanDerWaalsContact O-N 3.11Å; L72-Q75 WeakPolarHBondContact O-CB 3.42Å; L72-Q75 PolarHBondContact O-N 2.65Å; L72-Q75 VanDerWaalsContact O-N 3.16Å; Q75-E78 PolarHBondContact O-N 3.08Å; Q75-L79 WeakPolarHBondContact O-CB 3.38Å; Q75-L79 PolarHBondContact O-N 3.4Å
76	D	94.8	Very high	92.8	Very high	93 Å²	93	102 Å²	102	50%	0.497	52%	0.518	S	S	.	.	H	α-helix	trans	-63.8	-40.9	177	-70.6	-20.7	0	0	0	111.6	L72 S73 L79 M80	L72-D76 PolarHBondContact O-N 3.48Å; S73-D76 PolarHBondContact O-N 3.22Å; D76-L79 PolarHBondContact O-N 2.93Å; D76-M80 WeakPolarHBondContact O-CG 3.33Å; D76-M80 PolarHBondContact O-N 3Å
77	E	94.2	Very high	91.5	Very high	101 Å²	101	104.5 Å²	104.5	47%	0.472	53%	0.53	S	S	.	.	H	α-helix	trans	-64	-42.5	175.9	-165.7	-171.2	126.7	0	0	111.9	S73 M74 M80 K81	S73-E77 PolarHBondContact O-N 3.47Å; M74-E77 PolarHBondContact O-N 3.33Å; E77-M80 PolarHBondContact O-N 3.11Å; E77-K81 WeakPolarHBondContact O-CG 3.36Å; E77-K81 PolarHBondContact O-N 3.03Å; E77-K81 WeakPolarHBondContact OE1-CE 3.39Å; E77-K81 IonicContact OE1-NZ 2.62Å; E77-K81 PolarHBondContact OE1-NZ 2.97Å
78	E	93.4	Very high	89.6	Confident	99 Å²	99	101 Å²	101	46%	0.463	53%	0.527	S	S	.	.	H	α-helix	trans	-64.5	-42.2	176.3	-172.6	177.6	-177.6	0	0	111.6	M74 Q75 K81 R82	M74-E78 PolarHBondContact O-N 3.41Å; Q75-E78 PolarHBondContact O-N 3.08Å; E78-K81 PolarHBondContact O-N 3.42Å; E78-R82 WeakPolarHBondContact O-CG 3.36Å; E78-R82 PolarHBondContact O-N 3.05Å; E78-R82 IonicContact OE1-CZ 3.38Å; E78-R82 IonicContact OE1-NE 3.48Å; E78-R82 PolarHBondContact OE1-NE 3.48Å; E78-R82 IonicContact OE1-NH2 2.65Å; E78-R82 PolarHBondContact OE1-NH2 3.01Å
79	L	93.3	Very high	87.8	Confident	105 Å²	105	103 Å²	103	55%	0.55	55%	0.549	S	S	.	.	H	α-helix	trans	-60.5	-47.1	175.5	179.4	62.2	0	0	0	111.1	Q75 D76 K81 R82 V83	Q75-L79 WeakPolarHBondContact O-CB 3.38Å; Q75-L79 PolarHBondContact O-N 3.4Å; D76-L79 PolarHBondContact O-N 2.93Å; L79-K81 VanDerWaalsContact C-N 3.34Å; L79-K81 PolarHBondContact O-N 3.33Å; L79-R82 PolarHBondContact O-N 3.41Å; L79-V83 HydrophobicContact CD1-CG2 4.47Å; L79-V83 WeakPolarHBondContact O-CG2 3.34Å; L79-V83 PolarHBondContact O-N 3.11Å
80	M	92.2	Very high	85.6	Confident	115 Å²	115	105.9 Å²	105.9	57%	0.567	59%	0.589	S	S	*	*	H	α-helix	trans	-60.5	-41.8	177.2	-78.3	-161.7	-79.5	0	0	112.2	D76 E77 R82 V83 Q84	D76-M80 WeakPolarHBondContact O-CG 3.33Å; D76-M80 PolarHBondContact O-N 3Å; E77-M80 PolarHBondContact O-N 3.11Å; M80-R82 PolarHBondContact O-N 3.36Å; M80-V83 PolarHBondContact O-N 3.08Å; M80-Q84 WeakPolarHBondContact O-CG 3.3Å; M80-Q84 PolarHBondContact O-N 2.62Å
81	K	92.8	Very high	85.1	Confident	106 Å²	106	107 Å²	107	46%	0.461	59%	0.593	S	S	.	*	H	α-helix	trans	-60.4	-42.8	175.6	-77.4	169.6	171.6	168.1	0	112.1	E77 E78 L79 Q84 Q85	E77-K81 WeakPolarHBondContact O-CG 3.36Å; E77-K81 PolarHBondContact O-N 3.03Å; E77-K81 WeakPolarHBondContact OE1-CE 3.39Å; E77-K81 IonicContact OE1-NZ 2.62Å; E77-K81 PolarHBondContact OE1-NZ 2.97Å; E78-K81 PolarHBondContact O-N 3.42Å; L79-K81 VanDerWaalsContact C-N 3.34Å; L79-K81 PolarHBondContact O-N 3.33Å; K81-Q84 PolarHBondContact O-N 3.06Å; K81-Q85 VanDerWaalsContact O-CG 3.3Å; K81-Q85 WeakPolarHBondContact O-CG 3.49Å; K81-Q85 PolarHBondContact O-N 3.47Å; K81-Q85 VanDerWaalsContact O-N 3.08Å
82	R	91.3	Very high	84.5	Confident	152 Å²	152	107.8 Å²	107.8	57%	0.574	60%	0.602	S	S	*	*	H	α-helix	trans	-65.5	-41.7	177.4	-70.3	176.7	-175.1	-172.6	1.6	112.1	E78 L79 M80 Q85 S86	E78-R82 WeakPolarHBondContact O-CG 3.36Å; E78-R82 PolarHBondContact O-N 3.05Å; E78-R82 IonicContact OE1-CZ 3.38Å; E78-R82 IonicContact OE1-NE 3.48Å; E78-R82 PolarHBondContact OE1-NE 3.48Å; E78-R82 IonicContact OE1-NH2 2.65Å; E78-R82 PolarHBondContact OE1-NH2 3.01Å; L79-R82 PolarHBondContact O-N 3.41Å; M80-R82 PolarHBondContact O-N 3.36Å; R82-Q85 PolarHBondContact O-N 3.06Å; R82-S86 PolarHBondContact O-N 3.13Å; R82-S86 VanDerWaalsContact O-N 3.08Å; R82-S86 PolarHBondContact O-OG 3.33Å
83	V	90.1	Very high	83.8	Confident	81 Å²	81	109.7 Å²	109.7	49%	0.491	61%	0.614	S	S	.	*	H	α-helix	trans	-61.8	-48	176.3	173.5	0	0	0	0	110.5	L79 M80 Q85 S86 S87	L79-V83 HydrophobicContact CD1-CG2 4.47Å; L79-V83 WeakPolarHBondContact O-CG2 3.34Å; L79-V83 PolarHBondContact O-N 3.11Å; M80-V83 PolarHBondContact O-N 3.08Å; V83-Q85 VanDerWaalsContact C-N 3.32Å; V83-Q85 PolarHBondContact O-N 3.31Å; V83-S86 PolarHBondContact O-N 3.47Å; V83-S86 VanDerWaalsContact O-N 3.11Å; V83-S86 PolarHBondContact O-OG 3Å; V83-S87 PolarHBondContact O-N 3.35Å; V83-S87 PolarHBondContact O-OG 3.46Å; V83-S87 VanDerWaalsContact O-OG 3.11Å
84	Q	87.1	Confident	83.1	Confident	131 Å²	131	112.4 Å²	112.4	61%	0.612	62%	0.624	S	S	*	*	H	α-helix	trans	-60.1	-38.1	178.9	-72.8	174.9	6.1	0	0	113.3	M80 K81 S87 G88	M80-Q84 WeakPolarHBondContact O-CG 3.3Å; M80-Q84 PolarHBondContact O-N 2.62Å; K81-Q84 PolarHBondContact O-N 3.06Å; Q84-S87 PolarHBondContact O-OG 3.19Å; Q84-G88 PolarHBondContact O-N 2.97Å
85	Q	82	Confident	82.4	Confident	157 Å²	157	111.4 Å²	111.4	73%	0.734	62%	0.623	S	S	*	*	H	α-helix	trans	-67.9	-36.7	175.7	-72.9	172.5	-2.9	0	0	112.3	K81 R82 V83	K81-Q85 VanDerWaalsContact O-CG 3.3Å; K81-Q85 WeakPolarHBondContact O-CG 3.49Å; K81-Q85 PolarHBondContact O-N 3.47Å; K81-Q85 VanDerWaalsContact O-N 3.08Å; R82-Q85 PolarHBondContact O-N 3.06Å; V83-Q85 VanDerWaalsContact C-N 3.32Å; V83-Q85 PolarHBondContact O-N 3.31Å
86	S	74.2	Confident	81.6	Confident	101 Å²	101	111.9 Å²	111.9	71%	0.706	63%	0.632	S	S	*	*	H	α-helix	trans	-75.2	-23.3	178.7	71.6	0	0	0	0	114.1	R82 V83	R82-S86 PolarHBondContact O-N 3.13Å; R82-S86 VanDerWaalsContact O-N 3.08Å; R82-S86 PolarHBondContact O-OG 3.33Å; V83-S86 PolarHBondContact O-N 3.47Å; V83-S86 VanDerWaalsContact O-N 3.11Å; V83-S86 PolarHBondContact O-OG 3Å
87	S	68.7	Low	80.6	Confident	86 Å²	86	113.2 Å²	113.2	60%	0.601	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.8	12.7	178.3	60.7	0	0	0	0	113.7	V83 Q84	V83-S87 PolarHBondContact O-N 3.35Å; V83-S87 PolarHBondContact O-OG 3.46Å; V83-S87 VanDerWaalsContact O-OG 3.11Å; Q84-S87 PolarHBondContact O-OG 3.19Å
88	G	57.6	Low	79.6	Confident	43 Å²	43	114.2 Å²	114.2	44%	0.443	66%	0.655	S	S	.	*			trans	-61.2	141.6	177	0	0	0	0	0	111.6	Q84 A90	Q84-G88 PolarHBondContact O-N 2.97Å; G88-A90 PolarHBondContact O-N 3.26Å
89	P	60.3	Low	78.4	Confident	134 Å²	134	115.4 Å²	115.4	87%	0.87	67%	0.671	S	S	*	*			trans	-63.4	122.6	-172.4	26.1	-32.6	0	0	0	110.6
90	A	51.3	Low	77.1	Confident	174 Å²	174	116.4 Å²	116.4	100%	1.438	68%	0.682	S	S	*	*			trans	-73.1	0	159	0	0	0	0	0	110.3	G88	G88-A90 PolarHBondContact O-N 3.26Å

Retrieved 90 of 90 residues in 17.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).