H4_DROME Loading...

Histone H4

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Involved in recruitment of Parp1 to chromatin and regulates its activity; mediates nucleosome-dependent activation of Parp11.

AlphaFold DB , UniProt , Accession P84040, Species DROME (Drosophila melanogaster, Fruit fly), Gene His4/His4r/His4:CG31611/His4:CG33869/His4:CG33871/His4:CG33873/His4:CG33875/His4:CG33877/His4:CG33879/His4:CG33881/His4:CG33883/His4:CG33885/His4:CG33887/His4:CG33889/His4:CG33891/His4:CG33893/His4:CG33895/His4:CG33897/His4:CG33899/His4:CG33901/His4:CG33903/His4:CG33905/His4:CG33907/His4:CG33909, Length 103 aa.

>H4_DROME|P84040|His4/His4r/His4:CG31611/His4:CG33869/His4:CG33871/His4:CG33873/His4:CG33875/His4:CG33877/His4:CG33879/His4:CG33881/His4:CG33883/His4:CG33885/His4:CG33887/His4:CG33889/His4:CG33891/His4:CG33893/His4:CG33895/His4:CG33897/His4:CG33899/His4:CG33901/His4:CG33903/His4:CG33905/His4:CG33907/His4:CG33909
MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1M59.1Low60.1Low239 Ų239144.4 Ų144.4100%1.17786%0.862SS**  0107.80-103.7178.9159.900108.6
2T53.6Low60.3Low144 Ų144137.9 Ų137.988%0.88385%0.848SS**  trans-170.788.515438.70000108.7R4T2-R4 PolarHBondContact O-N 2.97Å; T2-R4 VanDerWaalsContact O-N 3.12Å
3G58.1Low60.8Low84 Ų84143.2 Ų143.287%0.86685%0.852SS**  trans-70.8100.3170.100000109.6G5G3-G5 PolarHBondContact O-N 3.46Å; G3-G5 VanDerWaalsContact O-N 3.16Å
4R66.9Low61.1Low252 Ų252138.2 Ų138.295%0.95185%0.845SS**  trans-79.898.5175.9-160.3165.7177.5118.5-4.8108.2T2T2-R4 PolarHBondContact O-N 2.97Å; T2-R4 VanDerWaalsContact O-N 3.12Å
5G60.5Low61.6Low68 Ų68133.8 Ų133.870%0.70184%0.838SS**  trans-55.2141.2-174.100000113.8G3 G7G3-G5 PolarHBondContact O-N 3.46Å; G3-G5 VanDerWaalsContact O-N 3.16Å; G5-G7 PolarHBondContact O-N 3.36Å
6K60.1Low62.4Low215 Ų215131.1 Ų131.194%0.93583%0.833SS**  trans-54.5101.5171.2-85.2174.6171.11730109.6G8K6-G8 VanDerWaalsContact C-N 3.31Å; K6-G8 PolarHBondContact O-N 3.19Å
7G59.2Low62.9Low75 Ų75134.6 Ų134.677%0.77383%0.833SS**  trans-64.894.6163.900000108.4G5 K9G5-G7 PolarHBondContact O-N 3.36Å; G7-K9 PolarHBondContact O-N 2.97Å
8G59.5Low63.4Low71 Ų71140.6 Ų140.673%0.73284%0.837SS**  trans-56.5109.5168.900000107.6K6 G10K6-G8 VanDerWaalsContact C-N 3.31Å; K6-G8 PolarHBondContact O-N 3.19Å; G8-G10 PolarHBondContact O-N 3.42Å
9K63.3Low64.1Low203 Ų203142.3 Ų142.388%0.88384%0.835SS**  trans-63.691.8174.2-152.5174.6-172178.30105.6G7 L11G7-K9 PolarHBondContact O-N 2.97Å; K9-L11 PolarHBondContact O-N 3.2Å
10G60Low64.4Low68 Ų68147 Ų14770%0.70184%0.838SS**  trans-52.3109.4-176.600000108G8 G12G8-G10 PolarHBondContact O-N 3.42Å; G10-G12 VanDerWaalsContact C-N 3.32Å; G10-G12 PolarHBondContact O-N 3.33Å
11L60.5Low65Low169 Ų169148.2 Ų148.289%0.88583%0.834SS**  trans-55.8103.8172.2-65.4169000105.2K9 K13K9-L11 PolarHBondContact O-N 3.2Å; L11-K13 PolarHBondContact O-N 3.02Å; L11-K13 VanDerWaalsContact O-N 3.16Å
12G62.8Low66Low67 Ų67141.2 Ų141.269%0.69180%0.804SS**  trans-48.8127.3-178.100000107.8G10 G14G10-G12 VanDerWaalsContact C-N 3.32Å; G10-G12 PolarHBondContact O-N 3.33Å; G12-G14 PolarHBondContact O-N 2.69Å
13K66.5Low67.5Low207 Ų207142.5 Ų142.590%0.981%0.805SS**  trans-40.8106.3-177-71.8178.9176.91780108.2L11 G15L11-K13 PolarHBondContact O-N 3.02Å; L11-K13 VanDerWaalsContact O-N 3.16Å; K13-G15 PolarHBondContact O-N 2.71Å
14G64.8Low68.8Low73 Ų73147.2 Ų147.275%0.75380%0.796SS**  trans-52.1112-174.900000107.7G12 A16G12-G14 PolarHBondContact O-N 2.69Å; G14-A16 PolarHBondContact O-N 3Å
15G69.7Low69.9Low72 Ų72141.7 Ų141.774%0.74279%0.786SS**  trans-52.9122.2-177.700000107.9K13 K17K13-G15 PolarHBondContact O-N 2.71Å; G15-K17 PolarHBondContact O-N 3.39Å
16A73.6Confident71.4Confident91 Ų91143.6 Ų143.675%0.75278%0.78SS**  trans-48.1120.6-177.200000108.9G14 R18G14-A16 PolarHBondContact O-N 3Å; A16-R18 PolarHBondContact O-N 3.16Å
17K70.7Confident73.1Confident191 Ų191135.1 Ų135.183%0.8374%0.744SS**  trans-61.797.8-177.1-157.5175.7-171.4177.40107.4G15 H19G15-K17 PolarHBondContact O-N 3.39Å; K17-H19 PolarHBondContact O-N 3.32Å; K17-H19 VanDerWaalsContact O-N 3.1Å
18R72.2Confident74.8Confident242 Ų242136.7 Ų136.791%0.91373%0.731SS**  trans-68.6110.4177.8-86.4-175.9175.1178.9-0.8107.7A16 R20A16-R18 PolarHBondContact O-N 3.16Å; R18-R20 PolarHBondContact O-N 2.89Å
19H76Confident76.6Confident172 Ų172136 Ų13680%0.79673%0.725SS**  trans-60.5120.6167.3-68.9-89.8000108K17 K21K17-H19 PolarHBondContact O-N 3.32Å; K17-H19 VanDerWaalsContact O-N 3.1Å; H19-K21 PolarHBondContact O-N 3.43Å
20R71.4Confident78.2Confident237 Ų237129.3 Ų129.389%0.89470%0.698SS**  trans-57113.4174.9-171.717584.2168.94.8107.4R18 V22R18-R20 PolarHBondContact O-N 2.89Å; R20-V22 PolarHBondContact O-N 2.91Å; R20-V22 VanDerWaalsContact O-N 3.14Å
21K77.2Confident80Confident173 Ų173128.9 Ų128.975%0.75268%0.682SS**PPolyproline II helixtrans-64.1119.5178.2-164.8175.7-176.4-179.30107.6H19 L23H19-K21 PolarHBondContact O-N 3.43Å; K21-L23 PolarHBondContact O-N 3.25Å
22V79.7Confident81.8Confident91 Ų91126.2 Ų126.255%0.55266%0.663SS**PPolyproline II helixtrans-67.2123.5170.9-179.80000107R20 R24R20-V22 PolarHBondContact O-N 2.91Å; R20-V22 VanDerWaalsContact O-N 3.14Å; V22-R24 HydrophobicContact CG1-CG 4.1Å; V22-R24 PolarHBondContact O-N 3.11Å
23L84Confident83.4Confident171 Ų171126.3 Ų126.390%0.89565%0.652SS**PPolyproline II helixtrans-66.7119.8173.8-62.3178.8000107.7K21K21-L23 PolarHBondContact O-N 3.25Å
24R87Confident84.9Confident184 Ų184117.6 Ų117.669%0.69462%0.618SS**  trans-131.2146.8176.1-62.5-177.5-176.3-175.6-0.1107.3V22 N26V22-R24 HydrophobicContact CG1-CG 4.1Å; V22-R24 PolarHBondContact O-N 3.11Å; R24-N26 PolarHBondContact O-N 3.43Å; R24-N26 PolarHBondContact O-ND2 3.36Å
25D89.6Confident86.5Confident136 Ų136114.4 Ų114.473%0.72758%0.584SS**  trans-64.8125.2165.9-174.411.9000108.7I27D25-I27 WeakPolarHBondContact OD1-CB 3.34Å; D25-I27 WeakPolarHBondContact OD1-CG2 3.34Å; D25-I27 PolarHBondContact OD1-N 3.23Å; D25-I27 WeakPolarHBondContact OD2-CG2 3.44Å
26N92.1Very high87.9Confident107 Ų107115.7 Ų115.757%0.57257%0.566SS**  trans-118.213.1-177.5-62.5-63.7000111.6R24 Q28 G29R24-N26 PolarHBondContact O-N 3.43Å; R24-N26 PolarHBondContact O-ND2 3.36Å; N26-Q28 PolarHBondContact O-N 2.93Å; N26-Q28 VanDerWaalsContact O-N 3.17Å; N26-G29 WeakPolarHBondContact O-CA 3.25Å; N26-G29 PolarHBondContact O-N 3.47Å
27I95.2Very high89Confident38 Ų38119 Ų11920%0.19556%0.559CS.*G310 helixtrans-59.4-32.8-173.2-163.955.2000112.6D25 G29 I30 R56 K60D25-I27 WeakPolarHBondContact OD1-CB 3.34Å; D25-I27 WeakPolarHBondContact OD1-CG2 3.34Å; D25-I27 PolarHBondContact OD1-N 3.23Å; D25-I27 WeakPolarHBondContact OD2-CG2 3.44Å; I27-G29 PolarHBondContact O-N 3.02Å; I27-I30 PolarHBondContact O-N 2.91Å; I27-I30 VanDerWaalsContact O-N 3.16Å; I27-R56 HydrophobicContact CD1-CB 3.83Å; I27-R56 HydrophobicContact CD1-CG 4.22Å; I27-R56 HydrophobicContact CG1-CB 3.75Å; I27-R56 HydrophobicContact CG1-CG 4.11Å; I27-K60 HydrophobicContact CD1-CB 4.46Å
28Q95.7Very high90.3Very high107 Ų107115.1 Ų115.150%0.555%0.547SS..G310 helixtrans-70.6-14.1175-63.8-58.3-3100113.9N26 I30N26-Q28 PolarHBondContact O-N 2.93Å; N26-Q28 VanDerWaalsContact O-N 3.17Å; Q28-I30 CarbonylContact O-C 3.58Å; Q28-I30 PolarHBondContact O-N 3.26Å
29G95.7Very high91.5Very high57 Ų57104.5 Ų104.559%0.58851%0.511SS*.G310 helixtrans-62-22169.100000112.8N26 I27 T31N26-G29 WeakPolarHBondContact O-CA 3.25Å; N26-G29 PolarHBondContact O-N 3.47Å; I27-G29 PolarHBondContact O-N 3.02Å; G29-T31 VanDerWaalsContact C-N 3.32Å; G29-T31 PolarHBondContact O-N 2.65Å; G29-T31 VanDerWaalsContact O-N 3.08Å
30I97Very high92.5Very high63 Ų63102.1 Ų102.132%0.32350%0.495SS..SBendtrans-8087.6164-51.3-59.7000107.7I27 Q28 I35 R56 L59I27-I30 PolarHBondContact O-N 2.91Å; I27-I30 VanDerWaalsContact O-N 3.16Å; Q28-I30 CarbonylContact O-C 3.58Å; Q28-I30 PolarHBondContact O-N 3.26Å; I30-I35 HydrophobicContact CG2-CD1 4.13Å; I30-I35 HydrophobicContact CG2-CG1 3.86Å; I30-R56 HydrophobicContact CB-CG 4.32Å; I30-R56 HydrophobicContact CG2-CG 4.5Å; I30-R56 PolarHBondContact O-NE 3.22Å; I30-R56 PolarHBondContact O-NH2 3.37Å; I30-L59 HydrophobicContact CD1-CD2 3.89Å; I30-L59 HydrophobicContact CG1-CD2 3.64Å; I30-L59 HydrophobicContact CG2-CD2 4.5Å
31T98.1Very high93.8Very high59 Ų59101 Ų10136%0.36249%0.49SS..  trans-75155.3-170.365.30000112.5G29 P33 A34 I35G29-T31 VanDerWaalsContact C-N 3.32Å; G29-T31 PolarHBondContact O-N 2.65Å; G29-T31 VanDerWaalsContact O-N 3.08Å; T31-P33 VanDerWaalsContact C-N 3.31Å; T31-A34 WeakPolarHBondContact O-CB 3.41Å; T31-A34 PolarHBondContact O-N 3.13Å; T31-A34 PolarHBondContact OG1-N 2.89Å; T31-I35 PolarHBondContact O-N 3.38Å; T31-I35 VanDerWaalsContact O-N 3.11Å
32K97.9Very high94.8Very high112 Ų11295.8 Ų95.849%0.48749%0.486SS..Hα-helixtrans-52.5-41.5174.8-62.8-178.5177.9176.80112.8A34 I35 R36 Y52K32-A34 PolarHBondContact O-N 3.38Å; K32-I35 PolarHBondContact O-N 3.38Å; K32-R36 WeakPolarHBondContact O-CB 3.14Å; K32-R36 PolarHBondContact O-N 3.11Å; K32-Y52 HydrophobicContact CB-CD1 3.95Å; K32-Y52 HydrophobicContact CB-CE1 3.96Å; K32-Y52 HydrophobicContact CD-CD2 4.31Å; K32-Y52 HydrophobicContact CD-CE2 4.49Å; K32-Y52 HydrophobicContact CD-CG 4.35Å; K32-Y52 HydrophobicContact CG-CD1 3.82Å; K32-Y52 HydrophobicContact CG-CD2 4.41Å; K32-Y52 HydrophobicContact CG-CE1 4.2Å; K32-Y52 HydrophobicContact CG-CG 3.94Å
33P98.1Very high95.6Very high70 Ų7094.5 Ų94.546%0.45549%0.492SS..Hα-helixtrans-61.4-38.7172.9-26.136.4000114T31 R36 R37T31-P33 VanDerWaalsContact C-N 3.31Å; P33-R36 PolarHBondContact O-N 3.46Å; P33-R37 WeakPolarHBondContact O-CG 3.46Å; P33-R37 PolarHBondContact O-N 2.97Å
34A98.2Very high96.3Very high24 Ų2489.3 Ų89.320%0.19847%0.466CS..Hα-helixtrans-63.6-46.7177.600000111.6T31 K32 R36 R37 L38T31-A34 WeakPolarHBondContact O-CB 3.41Å; T31-A34 PolarHBondContact O-N 3.13Å; T31-A34 PolarHBondContact OG1-N 2.89Å; K32-A34 PolarHBondContact O-N 3.38Å; A34-R36 VanDerWaalsContact C-N 3.33Å; A34-R36 PolarHBondContact O-N 3.5Å; A34-R37 PolarHBondContact O-N 3.4Å; A34-L38 PolarHBondContact O-N 2.88Å; A34-L38 VanDerWaalsContact O-N 3.11Å
35I98.3Very high96.8Very high5 Ų588.9 Ų88.93%0.02647%0.47CS..Hα-helixtrans-61-44.2175.4-61.6171.2000110.3I30 T31 K32 R37 L38 A39 I51 Y52 T55 R56I30-I35 HydrophobicContact CG2-CD1 4.13Å; I30-I35 HydrophobicContact CG2-CG1 3.86Å; T31-I35 PolarHBondContact O-N 3.38Å; T31-I35 VanDerWaalsContact O-N 3.11Å; K32-I35 PolarHBondContact O-N 3.38Å; I35-R37 PolarHBondContact O-N 3.47Å; I35-L38 PolarHBondContact O-N 3.18Å; I35-A39 WeakPolarHBondContact O-CB 3.36Å; I35-A39 PolarHBondContact O-N 2.92Å; I35-I51 HydrophobicContact CG2-CG2 4.45Å; I35-Y52 HydrophobicContact CB-CD1 4.31Å; I35-Y52 HydrophobicContact CD1-CD1 4.28Å; I35-Y52 WeakPolarHBondContact CD1-O 3.29Å; I35-Y52 HydrophobicContact CG2-CD1 4.18Å; I35-T55 HydrophobicContact CD1-CG2 4.29Å; I35-T55 HydrophobicContact CG1-CG2 4.15Å; I35-T55 HydrophobicContact CG2-CG2 4.19Å; I35-R56 HydrophobicContact CD1-CG 4.39Å
36R97.8Very high97.1Very high100 Ų10092.9 Ų92.938%0.37748%0.475SS..Hα-helixtrans-59.1-45.4176.6-168.9-174.7-50.9-66.9-4.2111.5K32 P33 A34 L38 A39 R40 I47 Y52K32-R36 WeakPolarHBondContact O-CB 3.14Å; K32-R36 PolarHBondContact O-N 3.11Å; P33-R36 PolarHBondContact O-N 3.46Å; A34-R36 VanDerWaalsContact C-N 3.33Å; A34-R36 PolarHBondContact O-N 3.5Å; R36-L38 VanDerWaalsContact C-N 3.33Å; R36-L38 PolarHBondContact O-N 3.01Å; R36-A39 PolarHBondContact O-N 3.11Å; R36-R40 HydrophobicContact CG-CG 4.36Å; R36-R40 VanDerWaalsContact O-CG 3.29Å; R36-R40 WeakPolarHBondContact O-CG 3.37Å; R36-R40 PolarHBondContact O-N 3.27Å; R36-I47 HydrophobicContact CG-CD1 4.03Å; R36-Y52 PolarHBondContact NH1-OH 3.36Å; R36-Y52 PolarHBondContact NH2-OH 2.93Å
37R97.9Very high97.3Very high160 Ų16089.5 Ų89.560%0.60446%0.456SS*.Hα-helixtrans-59.9-42.1178-74.3-171.4-57.8-93.85111.9P33 A34 I35 R41P33-R37 WeakPolarHBondContact O-CG 3.46Å; P33-R37 PolarHBondContact O-N 2.97Å; A34-R37 PolarHBondContact O-N 3.4Å; I35-R37 PolarHBondContact O-N 3.47Å; R37-R41 WeakPolarHBondContact O-CB 3.2Å; R37-R41 PolarHBondContact O-N 3.12Å
38L97Very high97.4Very high110 Ų11091 Ų9158%0.57647%0.47SS*.Hα-helixtrans-64.3-48.6175.5-71.4174.4000111.9A34 I35 R36 R40 R41 G42A34-L38 PolarHBondContact O-N 2.88Å; A34-L38 VanDerWaalsContact O-N 3.11Å; I35-L38 PolarHBondContact O-N 3.18Å; R36-L38 VanDerWaalsContact C-N 3.33Å; R36-L38 PolarHBondContact O-N 3.01Å; L38-R40 VanDerWaalsContact C-N 3.33Å; L38-R40 PolarHBondContact O-N 3.44Å; L38-R41 WeakPolarHBondContact O-CB 3.2Å; L38-R41 PolarHBondContact O-N 2.97Å; L38-R41 VanDerWaalsContact O-N 3.16Å; L38-G42 PolarHBondContact O-N 3.29Å
39A97.4Very high97.4Very high18 Ų1888.7 Ų88.715%0.14948%0.475CS..Hα-helixtrans-59.5-42.8178.400000112I35 R36 G42 G43 V44 I47I35-A39 WeakPolarHBondContact O-CB 3.36Å; I35-A39 PolarHBondContact O-N 2.92Å; R36-A39 PolarHBondContact O-N 3.11Å; A39-G42 CarbonylContact O-C 2.94Å; A39-G42 PolarHBondContact O-N 3.35Å; A39-G43 PolarHBondContact O-N 2.89Å; A39-V44 HydrophobicContact CB-CB 4.06Å; A39-V44 HydrophobicContact CB-CG2 4.19Å; A39-V44 VanDerWaalsContact O-CB 3.25Å; A39-V44 WeakPolarHBondContact O-CB 3.33Å; A39-V44 WeakPolarHBondContact O-CG2 3.38Å; A39-V44 PolarHBondContact O-N 3.02Å; A39-I47 HydrophobicContact CB-CD1 3.63Å; A39-I47 HydrophobicContact CB-CG1 4.2Å
40R97.9Very high97.4Very high123 Ų12392.4 Ų92.446%0.46448%0.48SS..Hα-helixtrans-65.1-39.8175.5-64.9-45.2-177178.83.3112.4R36 L38 G42 G43 V44 K45R36-R40 HydrophobicContact CG-CG 4.36Å; R36-R40 VanDerWaalsContact O-CG 3.29Å; R36-R40 WeakPolarHBondContact O-CG 3.37Å; R36-R40 PolarHBondContact O-N 3.27Å; L38-R40 VanDerWaalsContact C-N 3.33Å; L38-R40 PolarHBondContact O-N 3.44Å; R40-G42 PolarHBondContact O-N 2.88Å; R40-G43 PolarHBondContact O-N 3.16Å; R40-V44 WeakPolarHBondContact CD-O 3.47Å; R40-V44 PolarHBondContact NH1-O 3.08Å; R40-K45 VanDerWaalsContact NH1-CA 3.33Å; R40-K45 PolarHBondContact NH1-O 2.93Å
41R97.9Very high97.4Very high212 Ų21292.1 Ų92.180%0.848%0.479SS*.Hα-helixtrans-60.5-34.3173.5-175.5179.9-66.2175.5-3.1111.8R37 L38 G43R37-R41 WeakPolarHBondContact O-CB 3.2Å; R37-R41 PolarHBondContact O-N 3.12Å; L38-R41 WeakPolarHBondContact O-CB 3.2Å; L38-R41 PolarHBondContact O-N 2.97Å; L38-R41 VanDerWaalsContact O-N 3.16Å; R41-G43 VanDerWaalsContact C-N 3.26Å; R41-G43 PolarHBondContact O-N 3.18Å
42G97.4Very high97.4Very high65 Ų6590.6 Ų90.667%0.6747%0.467SS*.THydrogen-bonded Turntrans-80.58.1173.400000115.4L38 A39 R40 V44L38-G42 PolarHBondContact O-N 3.29Å; A39-G42 CarbonylContact O-C 2.94Å; A39-G42 PolarHBondContact O-N 3.35Å; R40-G42 PolarHBondContact O-N 2.88Å; G42-V44 VanDerWaalsContact C-N 3.35Å; G42-V44 PolarHBondContact O-N 2.67Å
43G98Very high97.4Very high64 Ų6490.1 Ų90.166%0.6647%0.466SS*.THydrogen-bonded Turntrans79.88.5178.100000115.5A39 R40 R41 K45A39-G43 PolarHBondContact O-N 2.89Å; R40-G43 PolarHBondContact O-N 3.16Å; R41-G43 VanDerWaalsContact C-N 3.26Å; R41-G43 PolarHBondContact O-N 3.18Å; G43-K45 PolarHBondContact O-N 3.26Å
44V97.7Very high97.3Very high61 Ų6192.4 Ų92.437%0.3747%0.471SS..  trans-68.5117.4-179.9-179.40000110A39 R40 G42 R46 I47A39-V44 HydrophobicContact CB-CB 4.06Å; A39-V44 HydrophobicContact CB-CG2 4.19Å; A39-V44 VanDerWaalsContact O-CB 3.25Å; A39-V44 WeakPolarHBondContact O-CB 3.33Å; A39-V44 WeakPolarHBondContact O-CG2 3.38Å; A39-V44 PolarHBondContact O-N 3.02Å; R40-V44 WeakPolarHBondContact CD-O 3.47Å; R40-V44 PolarHBondContact NH1-O 3.08Å; G42-V44 VanDerWaalsContact C-N 3.35Å; G42-V44 PolarHBondContact O-N 2.67Å; V44-R46 WeakPolarHBondContact CG1-O 3.4Å; V44-I47 HydrophobicContact CG1-CG1 3.79Å
45K97Very high97.3Very high176 Ų17693.5 Ų93.577%0.76548%0.475SS*.SBendtrans-86-31.1-179.1-171.6172.8-179.2176.40114R40 G43R40-K45 VanDerWaalsContact NH1-CA 3.33Å; R40-K45 PolarHBondContact NH1-O 2.93Å; G43-K45 PolarHBondContact O-N 3.26Å
46R97.7Very high97.3Very high220 Ų22093.6 Ų93.683%0.8348%0.475SS*.  trans-133.7137.8176.5-65-176.3-178.2-94.22.5109.4V44V44-R46 WeakPolarHBondContact CG1-O 3.4Å
47I96.4Very high97.3Very high36 Ų3690.6 Ų90.619%0.18548%0.475CS..  trans-120.5125.1-176.4-62170.5000107.7R36 A39 V44 I51 Y52R36-I47 HydrophobicContact CG-CD1 4.03Å; A39-I47 HydrophobicContact CB-CD1 3.63Å; A39-I47 HydrophobicContact CB-CG1 4.2Å; V44-I47 HydrophobicContact CG1-CG1 3.79Å; I47-I51 HydrophobicContact CG2-CB 4.1Å; I47-I51 HydrophobicContact CG2-CG1 4.49Å; I47-I51 HydrophobicContact CG2-CG2 4.18Å; I47-Y52 HydrophobicContact CG2-CE1 4.48Å
48S96.3Very high97.3Very high70 Ų7087.5 Ų87.549%0.4947%0.474SS..  trans-72.1153.1172.6174.80000111.3L50 I51S48-L50 VanDerWaalsContact C-N 3.28Å; S48-L50 PolarHBondContact O-N 3.46Å; S48-I51 PolarHBondContact O-N 3Å
49G95Very high97.3Very high57 Ų5785 Ų8559%0.58846%0.461SS*.THydrogen-bonded Turntrans-62.1-32.1177.900000113.8I51 Y52G49-I51 VanDerWaalsContact C-N 3.28Å; G49-I51 PolarHBondContact O-N 3.28Å; G49-Y52 WeakPolarHBondContact O-CD2 3.47Å
50L96.4Very high97.3Very high136 Ų13689.6 Ų89.671%0.71248%0.478SS*.THydrogen-bonded Turntrans-71.2-23-177.6-62.9177.3000113.3S48 Y52 E53 E54S48-L50 VanDerWaalsContact C-N 3.28Å; S48-L50 PolarHBondContact O-N 3.46Å; L50-Y52 PolarHBondContact O-N 2.98Å; L50-Y52 VanDerWaalsContact O-N 3.13Å; L50-E53 PolarHBondContact O-N 3.33Å; L50-E54 PolarHBondContact O-N 2.92Å; L50-E54 VanDerWaalsContact O-N 3.12Å
51I97.3Very high97.3Very high56 Ų5687.4 Ų87.429%0.28748%0.478SS..Hα-helixtrans-59.8-29.3-176.8-67.2-48.6000112.8I35 I47 S48 G49 E54 T55I35-I51 HydrophobicContact CG2-CG2 4.45Å; I47-I51 HydrophobicContact CG2-CB 4.1Å; I47-I51 HydrophobicContact CG2-CG1 4.49Å; I47-I51 HydrophobicContact CG2-CG2 4.18Å; S48-I51 PolarHBondContact O-N 3Å; G49-I51 VanDerWaalsContact C-N 3.28Å; G49-I51 PolarHBondContact O-N 3.28Å; I51-E54 WeakPolarHBondContact CD1-OE2 3.28Å; I51-T55 WeakPolarHBondContact O-CB 3.41Å; I51-T55 PolarHBondContact O-N 3.34Å; I51-T55 PolarHBondContact O-OG1 3.49Å
52Y97.5Very high97.2Very high27 Ų2781.5 Ų81.511%0.10646%0.458CS..Hα-helixtrans-66.2-43.3-177.7-56-65.9000112.5K32 I35 R36 I47 G49 L50 R56K32-Y52 HydrophobicContact CB-CD1 3.95Å; K32-Y52 HydrophobicContact CB-CE1 3.96Å; K32-Y52 HydrophobicContact CD-CD2 4.31Å; K32-Y52 HydrophobicContact CD-CE2 4.49Å; K32-Y52 HydrophobicContact CD-CG 4.35Å; K32-Y52 HydrophobicContact CG-CD1 3.82Å; K32-Y52 HydrophobicContact CG-CD2 4.41Å; K32-Y52 HydrophobicContact CG-CE1 4.2Å; K32-Y52 HydrophobicContact CG-CG 3.94Å; I35-Y52 HydrophobicContact CB-CD1 4.31Å; I35-Y52 HydrophobicContact CD1-CD1 4.28Å; I35-Y52 WeakPolarHBondContact CD1-O 3.29Å; I35-Y52 HydrophobicContact CG2-CD1 4.18Å; R36-Y52 PolarHBondContact NH1-OH 3.36Å; R36-Y52 PolarHBondContact NH2-OH 2.93Å; I47-Y52 HydrophobicContact CG2-CE1 4.48Å; G49-Y52 WeakPolarHBondContact O-CD2 3.47Å; L50-Y52 PolarHBondContact O-N 2.98Å; L50-Y52 VanDerWaalsContact O-N 3.13Å; Y52-R56 WeakPolarHBondContact O-CG 3.4Å
53E97.1Very high97.2Very high103 Ų10382.2 Ų82.248%0.48145%0.446SS..Hα-helixtrans-79.2-37.7177.6-58.2-49.8147.800111.3L50 T55 R56 G57L50-E53 PolarHBondContact O-N 3.33Å; E53-T55 PolarHBondContact O-N 3.1Å; E53-R56 WeakPolarHBondContact O-CB 3.39Å; E53-R56 PolarHBondContact O-N 3.3Å; E53-R56 IonicContact OE1-CZ 3.93Å; E53-R56 IonicContact OE1-NH1 2.67Å; E53-R56 PolarHBondContact OE1-NH1 2.99Å; E53-R56 IonicContact OE2-CZ 3.94Å; E53-R56 IonicContact OE2-NH1 2.88Å; E53-R56 PolarHBondContact OE2-NH1 2.96Å; E53-G57 PolarHBondContact O-N 3.48Å
54E97.6Very high97.1Very high117 Ų11783.1 Ų83.155%0.54743%0.433SS..Hα-helixtrans-60-45.6176.3-173.7174.1-167.400112L50 I51 R56 G57 V58L50-E54 PolarHBondContact O-N 2.92Å; L50-E54 VanDerWaalsContact O-N 3.12Å; I51-E54 WeakPolarHBondContact CD1-OE2 3.28Å; E54-R56 PolarHBondContact O-N 3.43Å; E54-G57 PolarHBondContact O-N 3.34Å; E54-G57 VanDerWaalsContact O-N 3.11Å; E54-V58 WeakPolarHBondContact O-CG2 3.47Å; E54-V58 PolarHBondContact O-N 3.46Å
55T98.1Very high97.1Very high47 Ų4783.1 Ų83.129%0.28843%0.431SS..Hα-helixtrans-59.3-37.9177.6-58.70000111.7I35 I51 E53 L59I35-T55 HydrophobicContact CD1-CG2 4.29Å; I35-T55 HydrophobicContact CG1-CG2 4.15Å; I35-T55 HydrophobicContact CG2-CG2 4.19Å; I51-T55 WeakPolarHBondContact O-CB 3.41Å; I51-T55 PolarHBondContact O-N 3.34Å; I51-T55 PolarHBondContact O-OG1 3.49Å; E53-T55 PolarHBondContact O-N 3.1Å; T55-L59 WeakPolarHBondContact O-CB 3.44Å; T55-L59 PolarHBondContact O-N 3.33Å
56R98Very high97.1Very high7 Ų775.3 Ų75.33%0.02640%0.398CS..Hα-helixtrans-68.2-42.2176.7-75178.2-167.2132.1-14111.7I27 I30 I35 Y52 E53 E54 L59 K60I27-R56 HydrophobicContact CD1-CB 3.83Å; I27-R56 HydrophobicContact CD1-CG 4.22Å; I27-R56 HydrophobicContact CG1-CB 3.75Å; I27-R56 HydrophobicContact CG1-CG 4.11Å; I30-R56 HydrophobicContact CB-CG 4.32Å; I30-R56 HydrophobicContact CG2-CG 4.5Å; I30-R56 PolarHBondContact O-NE 3.22Å; I30-R56 PolarHBondContact O-NH2 3.37Å; I35-R56 HydrophobicContact CD1-CG 4.39Å; Y52-R56 WeakPolarHBondContact O-CG 3.4Å; E53-R56 WeakPolarHBondContact O-CB 3.39Å; E53-R56 PolarHBondContact O-N 3.3Å; E53-R56 IonicContact OE1-CZ 3.93Å; E53-R56 IonicContact OE1-NH1 2.67Å; E53-R56 PolarHBondContact OE1-NH1 2.99Å; E53-R56 IonicContact OE2-CZ 3.94Å; E53-R56 IonicContact OE2-NH1 2.88Å; E53-R56 PolarHBondContact OE2-NH1 2.96Å; E54-R56 PolarHBondContact O-N 3.43Å; R56-L59 PolarHBondContact O-N 3.45Å; R56-K60 WeakPolarHBondContact O-CB 3.3Å; R56-K60 PolarHBondContact O-N 3.19Å
57G97.7Very high97.1Very high37 Ų3769.5 Ų69.538%0.38138%0.382SS..Hα-helixtrans-57.9-50173.900000112E53 E54 L59 K60 V61E53-G57 PolarHBondContact O-N 3.48Å; E54-G57 PolarHBondContact O-N 3.34Å; E54-G57 VanDerWaalsContact O-N 3.11Å; G57-L59 VanDerWaalsContact C-N 3.35Å; G57-L59 PolarHBondContact O-N 2.99Å; G57-K60 PolarHBondContact O-N 2.94Å; G57-V61 WeakPolarHBondContact O-CG2 3.43Å; G57-V61 PolarHBondContact O-N 3.42Å
58V97.7Very high97.1Very high96 Ų9674.2 Ų74.258%0.58240%0.398SS*.Hα-helixtrans-59.4-45.3177.8173.70000111.4E54 K60 V61 F62E54-V58 WeakPolarHBondContact O-CG2 3.47Å; E54-V58 PolarHBondContact O-N 3.46Å; V58-K60 VanDerWaalsContact C-N 3.33Å; V58-K60 PolarHBondContact O-N 3.45Å; V58-V61 PolarHBondContact O-N 3.45Å; V58-F62 WeakPolarHBondContact O-CB 3.31Å; V58-F62 PolarHBondContact O-N 3.38Å
59L97.4Very high97.2Very high58 Ų5871.8 Ų71.830%0.30438%0.379SS..Hα-helixtrans-61.2-42.9177.5178.565.5000111.9I30 T55 R56 G57 F62 L63I30-L59 HydrophobicContact CD1-CD2 3.89Å; I30-L59 HydrophobicContact CG1-CD2 3.64Å; I30-L59 HydrophobicContact CG2-CD2 4.5Å; T55-L59 WeakPolarHBondContact O-CB 3.44Å; T55-L59 PolarHBondContact O-N 3.33Å; R56-L59 PolarHBondContact O-N 3.45Å; G57-L59 VanDerWaalsContact C-N 3.35Å; G57-L59 PolarHBondContact O-N 2.99Å; L59-F62 PolarHBondContact O-N 2.96Å; L59-L63 HydrophobicContact CD1-CD1 4.04Å; L59-L63 HydrophobicContact CD1-CG 4.19Å; L59-L63 HydrophobicContact CG-CD1 4.05Å; L59-L63 WeakPolarHBondContact O-CB 3.48Å; L59-L63 WeakPolarHBondContact O-CG 3.41Å; L59-L63 PolarHBondContact O-N 2.84Å
60K96.8Very high97.3Very high114 Ų11469.3 Ų69.350%0.49635%0.353SS..Hα-helixtrans-61.3-51.7178.6179.2175.5173-179.90110.9I27 R56 G57 V58 F62 L63 E64I27-K60 HydrophobicContact CD1-CB 4.46Å; R56-K60 WeakPolarHBondContact O-CB 3.3Å; R56-K60 PolarHBondContact O-N 3.19Å; G57-K60 PolarHBondContact O-N 2.94Å; V58-K60 VanDerWaalsContact C-N 3.33Å; V58-K60 PolarHBondContact O-N 3.45Å; K60-F62 VanDerWaalsContact C-N 3.31Å; K60-F62 PolarHBondContact O-N 3.19Å; K60-L63 PolarHBondContact O-N 3.17Å; K60-E64 WeakPolarHBondContact CE-OE1 3.5Å; K60-E64 HydrophobicContact CG-CG 4.34Å; K60-E64 WeakPolarHBondContact CG-OE1 3.35Å; K60-E64 IonicContact NZ-OE1 2.75Å; K60-E64 WeakPolarHBondContact O-CB 3.35Å; K60-E64 VanDerWaalsContact O-CG 3.3Å; K60-E64 WeakPolarHBondContact O-CG 3.31Å; K60-E64 PolarHBondContact O-N 3.3Å
61V97.3Very high97.4Very high77 Ų7765.1 Ų65.147%0.46733%0.333SS..Hα-helixtrans-59.7-42.7179.2173.20000111.3G57 V58 E64 N65G57-V61 WeakPolarHBondContact O-CG2 3.43Å; G57-V61 PolarHBondContact O-N 3.42Å; V58-V61 PolarHBondContact O-N 3.45Å; V61-E64 PolarHBondContact O-N 2.81Å; V61-N65 VanDerWaalsContact O-CG 3.28Å; V61-N65 PolarHBondContact O-N 3.02Å; V61-N65 VanDerWaalsContact O-N 3.08Å; V61-N65 PolarHBondContact O-ND2 2.95Å
62F97Very high97.4Very high88 Ų8866.3 Ų66.339%0.38634%0.343SS..Hα-helixtrans-58.5-51.7176.2173.3-102000111.6V58 L59 K60 E64 N65 V66 L91V58-F62 WeakPolarHBondContact O-CB 3.31Å; V58-F62 PolarHBondContact O-N 3.38Å; L59-F62 PolarHBondContact O-N 2.96Å; K60-F62 VanDerWaalsContact C-N 3.31Å; K60-F62 PolarHBondContact O-N 3.19Å; F62-E64 PolarHBondContact O-N 3.22Å; F62-N65 PolarHBondContact O-N 3.47Å; F62-V66 HydrophobicContact CD2-CG2 4.42Å; F62-V66 HydrophobicContact CE1-CG2 4.21Å; F62-V66 HydrophobicContact CE2-CG2 3.95Å; F62-V66 HydrophobicContact CZ-CG2 3.84Å; F62-V66 WeakPolarHBondContact O-CG2 3.42Å; F62-V66 PolarHBondContact O-N 3.04Å; F62-V66 VanDerWaalsContact O-N 3.1Å; F62-L91 HydrophobicContact CZ-CD2 4.15Å
63L96.6Very high97.4Very high80 Ų8068.9 Ų68.942%0.41935%0.353SS..Hα-helixtrans-64.8-40.2-179.8-70.5174.8000112.2L59 K60 N65 V66 I67L59-L63 HydrophobicContact CD1-CD1 4.04Å; L59-L63 HydrophobicContact CD1-CG 4.19Å; L59-L63 HydrophobicContact CG-CD1 4.05Å; L59-L63 WeakPolarHBondContact O-CB 3.48Å; L59-L63 WeakPolarHBondContact O-CG 3.41Å; L59-L63 PolarHBondContact O-N 2.84Å; K60-L63 PolarHBondContact O-N 3.17Å; L63-N65 VanDerWaalsContact C-N 3.31Å; L63-N65 PolarHBondContact O-N 3.38Å; L63-V66 PolarHBondContact O-N 2.99Å; L63-I67 HydrophobicContact CB-CD1 4.35Å; L63-I67 VanDerWaalsContact O-CB 3.26Å; L63-I67 WeakPolarHBondContact O-CB 3.39Å; L63-I67 WeakPolarHBondContact O-CD1 3.37Å; L63-I67 WeakPolarHBondContact O-CG1 3.42Å; L63-I67 PolarHBondContact O-N 3.37Å
64E96.8Very high97.4Very high83 Ų8364.3 Ų64.339%0.38833%0.332SS..Hα-helixtrans-58.4-43.5176.4-76.8173.6172.100111.8K60 V61 F62 R68K60-E64 WeakPolarHBondContact CE-OE1 3.5Å; K60-E64 HydrophobicContact CG-CG 4.34Å; K60-E64 WeakPolarHBondContact CG-OE1 3.35Å; K60-E64 IonicContact NZ-OE1 2.75Å; K60-E64 WeakPolarHBondContact O-CB 3.35Å; K60-E64 VanDerWaalsContact O-CG 3.3Å; K60-E64 WeakPolarHBondContact O-CG 3.31Å; K60-E64 PolarHBondContact O-N 3.3Å; V61-E64 PolarHBondContact O-N 2.81Å; F62-E64 PolarHBondContact O-N 3.22Å; E64-R68 VanDerWaalsContact O-CB 3.27Å; E64-R68 WeakPolarHBondContact O-CB 3.43Å; E64-R68 PolarHBondContact O-N 2.84Å
65N97Very high97.4Very high60 Ų6065 Ų6532%0.32134%0.336SS..Hα-helixtrans-66.7-46.5178.4-69.2-24000112.1V61 F62 L63 R68 D69 Q94V61-N65 VanDerWaalsContact O-CG 3.28Å; V61-N65 PolarHBondContact O-N 3.02Å; V61-N65 VanDerWaalsContact O-N 3.08Å; V61-N65 PolarHBondContact O-ND2 2.95Å; F62-N65 PolarHBondContact O-N 3.47Å; L63-N65 VanDerWaalsContact C-N 3.31Å; L63-N65 PolarHBondContact O-N 3.38Å; N65-R68 PolarHBondContact O-N 2.76Å; N65-R68 PolarHBondContact OD1-NH1 2.86Å; N65-D69 PolarHBondContact O-N 3.28Å; N65-Q94 PolarHBondContact O-NE2 2.77Å
66V97.3Very high97.4Very high12 Ų1270.5 Ų70.57%0.07336%0.358CS..Hα-helixtrans-63.4-42.9177.8175.70000111.3F62 L63 D69 A70 V87 A90 L91F62-V66 HydrophobicContact CD2-CG2 4.42Å; F62-V66 HydrophobicContact CE1-CG2 4.21Å; F62-V66 HydrophobicContact CE2-CG2 3.95Å; F62-V66 HydrophobicContact CZ-CG2 3.84Å; F62-V66 WeakPolarHBondContact O-CG2 3.42Å; F62-V66 PolarHBondContact O-N 3.04Å; F62-V66 VanDerWaalsContact O-N 3.1Å; L63-V66 PolarHBondContact O-N 2.99Å; V66-D69 PolarHBondContact O-N 3.49Å; V66-A70 WeakPolarHBondContact O-CB 3.43Å; V66-A70 PolarHBondContact O-N 2.84Å; V66-V87 HydrophobicContact CG1-CG1 4.36Å; V66-A90 HydrophobicContact CG1-CB 4.31Å; V66-L91 HydrophobicContact CG1-CD2 4.06Å; V66-L91 HydrophobicContact CG1-CG 4.27Å; V66-L91 HydrophobicContact CG2-CD2 3.82Å
67I97.3Very high97.3Very high98 Ų9872.4 Ų72.450%0.50337%0.374SS..Hα-helixtrans-66.8-40.9179.6-69166000110.7L63 D69 A70 V71L63-I67 HydrophobicContact CB-CD1 4.35Å; L63-I67 VanDerWaalsContact O-CB 3.26Å; L63-I67 WeakPolarHBondContact O-CB 3.39Å; L63-I67 WeakPolarHBondContact O-CD1 3.37Å; L63-I67 WeakPolarHBondContact O-CG1 3.42Å; L63-I67 PolarHBondContact O-N 3.37Å; I67-D69 PolarHBondContact O-N 3.21Å; I67-A70 PolarHBondContact O-N 2.93Å; I67-V71 HydrophobicContact CG2-CG2 4.09Å; I67-V71 WeakPolarHBondContact O-CB 3.45Å; I67-V71 VanDerWaalsContact O-CG2 3.26Å; I67-V71 WeakPolarHBondContact O-CG2 3.42Å; I67-V71 PolarHBondContact O-N 2.86Å
68R97.6Very high97.3Very high136 Ų13680.1 Ų80.151%0.51340%0.398SS..Hα-helixtrans-56.1-52176.7-173.5-175.9-58.51123110.9E64 N65 A70 V71 T72E64-R68 VanDerWaalsContact O-CB 3.27Å; E64-R68 WeakPolarHBondContact O-CB 3.43Å; E64-R68 PolarHBondContact O-N 2.84Å; N65-R68 PolarHBondContact O-N 2.76Å; N65-R68 PolarHBondContact OD1-NH1 2.86Å; R68-A70 PolarHBondContact O-N 3.44Å; R68-V71 PolarHBondContact O-N 3.42Å; R68-T72 PolarHBondContact O-N 3.35Å; R68-T72 PolarHBondContact O-OG1 3.25Å; R68-T72 VanDerWaalsContact O-OG1 3.07Å
69D97.3Very high97.3Very high19 Ų1979.8 Ų79.810%0.10239%0.386CS..Hα-helixtrans-62.9-42.4179.5-69.6-13.4000111.6N65 V66 I67 V71 T72 Y73 A90 R93 Q94N65-D69 PolarHBondContact O-N 3.28Å; V66-D69 PolarHBondContact O-N 3.49Å; I67-D69 PolarHBondContact O-N 3.21Å; D69-V71 PolarHBondContact O-N 3.41Å; D69-T72 WeakPolarHBondContact O-CB 3.12Å; D69-T72 PolarHBondContact O-N 3.47Å; D69-Y73 WeakPolarHBondContact O-CD2 3.32Å; D69-Y73 PolarHBondContact O-N 3.5Å; D69-Y73 VanDerWaalsContact O-N 3.14Å; D69-A90 HydrophobicContact CB-CB 3.61Å; D69-R93 IonicContact OD1-CZ 3.76Å; D69-R93 IonicContact OD1-NH1 2.84Å; D69-R93 PolarHBondContact OD1-NH1 3.05Å; D69-R93 IonicContact OD2-CZ 3.94Å; D69-R93 IonicContact OD2-NH1 2.81Å; D69-R93 PolarHBondContact OD2-NH1 3.2Å; D69-Q94 PolarHBondContact OD2-NE2 3.08Å
70A97.9Very high97.2Very high4 Ų487.3 Ų87.33%0.03342%0.416CS..Hα-helixtrans-65.2-37.8178.700000112.8V66 I67 R68 Y73 T74 V82 D86 V87 A90V66-A70 WeakPolarHBondContact O-CB 3.43Å; V66-A70 PolarHBondContact O-N 2.84Å; I67-A70 PolarHBondContact O-N 2.93Å; R68-A70 PolarHBondContact O-N 3.44Å; A70-Y73 PolarHBondContact O-N 3.3Å; A70-T74 WeakPolarHBondContact O-CB 3.36Å; A70-T74 PolarHBondContact O-N 2.9Å; A70-T74 PolarHBondContact O-OG1 3.14Å; A70-V82 HydrophobicContact CB-CG1 4.09Å; A70-D86 HydrophobicContact CB-CB 4.36Å; A70-V87 HydrophobicContact CB-CG2 4.3Å; A70-A90 HydrophobicContact CB-CB 4.04Å
71V98Very high97.2Very high48 Ų4886.9 Ų86.929%0.29142%0.423SS..Hα-helixtrans-65-42.5174.3169.30000110.1I67 R68 D69 Y73 T74 E75 V82I67-V71 HydrophobicContact CG2-CG2 4.09Å; I67-V71 WeakPolarHBondContact O-CB 3.45Å; I67-V71 VanDerWaalsContact O-CG2 3.26Å; I67-V71 WeakPolarHBondContact O-CG2 3.42Å; I67-V71 PolarHBondContact O-N 2.86Å; R68-V71 PolarHBondContact O-N 3.42Å; D69-V71 PolarHBondContact O-N 3.41Å; V71-Y73 VanDerWaalsContact C-N 3.34Å; V71-Y73 PolarHBondContact O-N 3.48Å; V71-T74 WeakPolarHBondContact O-CB 3.27Å; V71-T74 PolarHBondContact O-N 3.37Å; V71-E75 HydrophobicContact CG1-CG 4.07Å; V71-E75 WeakPolarHBondContact O-CB 3.43Å; V71-E75 WeakPolarHBondContact O-CG 3.14Å; V71-E75 PolarHBondContact O-N 3.07Å; V71-V82 HydrophobicContact CG2-CG2 4.44Å
72T97.8Very high97.1Very high81 Ų8186.4 Ų86.450%0.49742%0.42SS..Hα-helixtrans-57.2-44.8175.6-57.40000112.3R68 D69 T74 H76R68-T72 PolarHBondContact O-N 3.35Å; R68-T72 PolarHBondContact O-OG1 3.25Å; R68-T72 VanDerWaalsContact O-OG1 3.07Å; D69-T72 WeakPolarHBondContact O-CB 3.12Å; D69-T72 PolarHBondContact O-N 3.47Å; T72-T74 VanDerWaalsContact C-N 3.32Å; T72-T74 PolarHBondContact O-N 3.38Å; T72-H76 VanDerWaalsContact O-CB 3.28Å; T72-H76 WeakPolarHBondContact O-CB 3.26Å; T72-H76 PolarHBondContact O-N 3.25Å
73Y96.9Very high97.1Very high82 Ų8284.8 Ų84.832%0.32242%0.418SS..Hα-helixtrans-64-37.9175.3-69.9-61.3000112.9D69 A70 V71 A77 A90D69-Y73 WeakPolarHBondContact O-CD2 3.32Å; D69-Y73 PolarHBondContact O-N 3.5Å; D69-Y73 VanDerWaalsContact O-N 3.14Å; A70-Y73 PolarHBondContact O-N 3.3Å; V71-Y73 VanDerWaalsContact C-N 3.34Å; V71-Y73 PolarHBondContact O-N 3.48Å; Y73-A77 WeakPolarHBondContact O-CB 3.5Å; Y73-A77 PolarHBondContact O-N 3.32Å; Y73-A77 VanDerWaalsContact O-N 3.12Å; Y73-A90 HydrophobicContact CE2-CB 4.47Å
74T98Very high97Very high6 Ų683.7 Ų83.74%0.03742%0.42CS..Hα-helixtrans-66.2-46.2179.4-58.90000111.7A70 V71 T72 A77 K78 R79 T81 V82 D86A70-T74 WeakPolarHBondContact O-CB 3.36Å; A70-T74 PolarHBondContact O-N 2.9Å; A70-T74 PolarHBondContact O-OG1 3.14Å; V71-T74 WeakPolarHBondContact O-CB 3.27Å; V71-T74 PolarHBondContact O-N 3.37Å; T72-T74 VanDerWaalsContact C-N 3.32Å; T72-T74 PolarHBondContact O-N 3.38Å; T74-A77 PolarHBondContact O-N 3.47Å; T74-K78 PolarHBondContact O-N 3.47Å; T74-R79 HydrophobicContact CG2-CB 4.04Å; T74-R79 WeakPolarHBondContact CG2-O 3.3Å; T74-R79 PolarHBondContact O-N 3.44Å; T74-T81 WeakPolarHBondContact CG2-O 3.09Å; T74-V82 HydrophobicContact CG2-CG2 4.22Å; T74-V82 WeakPolarHBondContact OG1-CA 3.45Å; T74-V82 WeakPolarHBondContact OG1-CG2 2.85Å; T74-D86 PolarHBondContact OG1-OD2 2.85Å
75E97.7Very high96.9Very high133 Ų13382.7 Ų82.762%0.62142%0.416SS*.Hα-helixtrans-66.5-42178-71.9178.5161.300111.3V71 A77 K78V71-E75 HydrophobicContact CG1-CG 4.07Å; V71-E75 WeakPolarHBondContact O-CB 3.43Å; V71-E75 WeakPolarHBondContact O-CG 3.14Å; V71-E75 PolarHBondContact O-N 3.07Å; E75-A77 PolarHBondContact O-N 3.29Å; E75-K78 WeakPolarHBondContact O-CA 3.42Å; E75-K78 PolarHBondContact O-N 3.34Å
76H97.3Very high96.9Very high162 Ų16280 Ų8075%0.7540%0.402SS*.Hα-helixtrans-57.7-39.5175-177.471.4000111.9T72 K78T72-H76 VanDerWaalsContact O-CB 3.28Å; T72-H76 WeakPolarHBondContact O-CB 3.26Å; T72-H76 PolarHBondContact O-N 3.25Å; H76-K78 PolarHBondContact O-N 3.04Å
77A96.8Very high96.9Very high46 Ų4681.9 Ų81.938%0.3841%0.413SS..THydrogen-bonded Turntrans-79.27.2175.800000114.3Y73 T74 E75 R79Y73-A77 WeakPolarHBondContact O-CB 3.5Å; Y73-A77 PolarHBondContact O-N 3.32Å; Y73-A77 VanDerWaalsContact O-N 3.12Å; T74-A77 PolarHBondContact O-N 3.47Å; E75-A77 PolarHBondContact O-N 3.29Å; A77-R79 HydrophobicContact CB-CG 4.4Å; A77-R79 PolarHBondContact O-N 3.48Å; A77-R79 VanDerWaalsContact O-N 3.16Å
78K97.6Very high96.8Very high199 Ų19977.3 Ų77.387%0.86539%0.39SS*.THydrogen-bonded Turntrans5529.8-177.8-55.7178.5-177.9177.50113.4T74 E75 H76T74-K78 PolarHBondContact O-N 3.47Å; E75-K78 WeakPolarHBondContact O-CA 3.42Å; E75-K78 PolarHBondContact O-N 3.34Å; H76-K78 PolarHBondContact O-N 3.04Å
79R97.2Very high96.7Very high90 Ų9075.9 Ų75.934%0.3439%0.385SS..  trans-98.5153.1177.3-72.8-178.3-76.1103.2-5.2110.5T74 A77 T81 D86T74-R79 HydrophobicContact CG2-CB 4.04Å; T74-R79 WeakPolarHBondContact CG2-O 3.3Å; T74-R79 PolarHBondContact O-N 3.44Å; A77-R79 HydrophobicContact CB-CG 4.4Å; A77-R79 PolarHBondContact O-N 3.48Å; A77-R79 VanDerWaalsContact O-N 3.16Å; R79-T81 PolarHBondContact NH1-O 3.2Å; R79-T81 VanDerWaalsContact NH1-O 3.11Å; R79-D86 IonicContact CZ-OD1 3.44Å; R79-D86 IonicContact CZ-OD2 3.97Å; R79-D86 IonicContact NH1-OD1 3.68Å; R79-D86 IonicContact NH1-OD2 2.7Å; R79-D86 PolarHBondContact NH1-OD2 3.11Å; R79-D86 IonicContact NH2-OD1 3.26Å; R79-D86 PolarHBondContact NH2-OD1 3.26Å; R79-D86 IonicContact NH2-OD2 3.68Å; R79-D86 PolarHBondContact NH2-OD2 2.75Å
80K95.3Very high96.7Very high216 Ų21675 Ų7594%0.93938%0.38SS*.SBendtrans-99.9-2.8173.2-62.7-177.3-179.4179.60113.3
81T95.9Very high96.6Very high104 Ų10475.8 Ų75.864%0.63838%0.384SS*.SBendtrans-126.7120.8-175.5-56.20000108.8T74 R79 T83T74-T81 WeakPolarHBondContact CG2-O 3.09Å; R79-T81 PolarHBondContact NH1-O 3.2Å; R79-T81 VanDerWaalsContact NH1-O 3.11Å; T81-T83 PolarHBondContact O-N 2.7Å
82V96.5Very high96.4Very high68 Ų6878.8 Ų78.841%0.41239%0.393SS..  trans-65.8128.5170.9-176.40000108.5A70 V71 T74 D86 V87A70-V82 HydrophobicContact CB-CG1 4.09Å; V71-V82 HydrophobicContact CG2-CG2 4.44Å; T74-V82 HydrophobicContact CG2-CG2 4.22Å; T74-V82 WeakPolarHBondContact OG1-CA 3.45Å; T74-V82 WeakPolarHBondContact OG1-CG2 2.85Å; V82-D86 HydrophobicContact CG1-CB 3.95Å; V82-V87 HydrophobicContact CG1-CG2 4.03Å
83T95.8Very high96.2Very high53 Ų5382.7 Ų82.733%0.32540%0.399SS..  trans-97.5165.917766.40000110.6T81 M85 D86 V87T81-T83 PolarHBondContact O-N 2.7Å; T83-M85 PolarHBondContact O-N 2.8Å; T83-M85 PolarHBondContact OG1-N 3.07Å; T83-D86 WeakPolarHBondContact CB-OD2 3.44Å; T83-D86 PolarHBondContact N-OD2 3.25Å; T83-D86 PolarHBondContact O-N 3.07Å; T83-D86 VanDerWaalsContact OG1-CG 3.25Å; T83-D86 PolarHBondContact OG1-N 3.12Å; T83-D86 PolarHBondContact OG1-OD2 3.33Å; T83-V87 PolarHBondContact O-N 2.99Å
84A95Very high96.1Very high57 Ų5781.8 Ų81.847%0.47140%0.397SS..Hα-helixtrans-57.3-36.8172.900000112D86 V87 V88 F101A84-D86 PolarHBondContact O-N 2.67Å; A84-V87 PolarHBondContact O-N 2.76Å; A84-V88 VanDerWaalsContact O-CG2 3.31Å; A84-V88 WeakPolarHBondContact O-CG2 3.42Å; A84-V88 PolarHBondContact O-N 2.9Å; A84-F101 HydrophobicContact CB-CD1 4.38Å; A84-F101 HydrophobicContact CB-CE1 4.16Å
85M95.6Very high95.9Very high62 Ų6284.6 Ų84.631%0.30543%0.428SS..Hα-helixtrans-66.3-36.8-180-66.2-51.3-62.600112.7T83 V87 V88 Y89T83-M85 PolarHBondContact O-N 2.8Å; T83-M85 PolarHBondContact OG1-N 3.07Å; M85-V87 PolarHBondContact O-N 3.14Å; M85-V88 PolarHBondContact O-N 3.03Å; M85-Y89 HydrophobicContact CB-CD2 4.43Å; M85-Y89 HydrophobicContact CB-CE2 4.02Å; M85-Y89 HydrophobicContact CE-CE1 3.93Å; M85-Y89 HydrophobicContact CE-CE2 4.21Å; M85-Y89 WeakPolarHBondContact CE-OH 3.39Å; M85-Y89 WeakPolarHBondContact O-CB 3.49Å; M85-Y89 WeakPolarHBondContact O-CD2 3.44Å; M85-Y89 VanDerWaalsContact O-CG 3.25Å; M85-Y89 PolarHBondContact O-N 3.16Å
86D96.3Very high95.7Very high4 Ų486.1 Ų86.12%0.02143%0.428CS..Hα-helixtrans-60.6-38.9175.6-57.4-50.6000111.1A70 T74 R79 V82 T83 A84 A90A70-D86 HydrophobicContact CB-CB 4.36Å; T74-D86 PolarHBondContact OG1-OD2 2.85Å; R79-D86 IonicContact CZ-OD1 3.44Å; R79-D86 IonicContact CZ-OD2 3.97Å; R79-D86 IonicContact NH1-OD1 3.68Å; R79-D86 IonicContact NH1-OD2 2.7Å; R79-D86 PolarHBondContact NH1-OD2 3.11Å; R79-D86 IonicContact NH2-OD1 3.26Å; R79-D86 PolarHBondContact NH2-OD1 3.26Å; R79-D86 IonicContact NH2-OD2 3.68Å; R79-D86 PolarHBondContact NH2-OD2 2.75Å; V82-D86 HydrophobicContact CG1-CB 3.95Å; T83-D86 WeakPolarHBondContact CB-OD2 3.44Å; T83-D86 PolarHBondContact N-OD2 3.25Å; T83-D86 PolarHBondContact O-N 3.07Å; T83-D86 VanDerWaalsContact OG1-CG 3.25Å; T83-D86 PolarHBondContact OG1-N 3.12Å; T83-D86 PolarHBondContact OG1-OD2 3.33Å; A84-D86 PolarHBondContact O-N 2.67Å; D86-A90 WeakPolarHBondContact O-CB 3.48Å; D86-A90 PolarHBondContact O-N 2.8Å
87V96.4Very high95.4Very high51 Ų5182.6 Ų82.631%0.30942%0.418SS..Hα-helixtrans-69.8-42175.8-178.90000111.2V66 A70 V82 T83 A84 M85 Y89 A90 L91V66-V87 HydrophobicContact CG1-CG1 4.36Å; A70-V87 HydrophobicContact CB-CG2 4.3Å; V82-V87 HydrophobicContact CG1-CG2 4.03Å; T83-V87 PolarHBondContact O-N 2.99Å; A84-V87 PolarHBondContact O-N 2.76Å; M85-V87 PolarHBondContact O-N 3.14Å; V87-Y89 VanDerWaalsContact C-N 3.32Å; V87-Y89 PolarHBondContact O-N 2.81Å; V87-A90 PolarHBondContact O-N 3.1Å; V87-L91 HydrophobicContact CG1-CD1 4.08Å; V87-L91 HydrophobicContact CG1-CG 4.44Å; V87-L91 WeakPolarHBondContact O-CB 3.48Å; V87-L91 VanDerWaalsContact O-CG 3.31Å; V87-L91 WeakPolarHBondContact O-CG 3.26Å; V87-L91 PolarHBondContact O-N 3.28Å
88V96.2Very high95.2Very high2 Ų283.8 Ų83.81%0.01242%0.417CS..Hα-helixtrans-61.3-42.2176.61720000110.8A84 M85 L91 K92 L98 F101A84-V88 VanDerWaalsContact O-CG2 3.31Å; A84-V88 WeakPolarHBondContact O-CG2 3.42Å; A84-V88 PolarHBondContact O-N 2.9Å; M85-V88 PolarHBondContact O-N 3.03Å; V88-L91 PolarHBondContact O-N 3.07Å; V88-K92 HydrophobicContact CG1-CD 4.15Å; V88-K92 WeakPolarHBondContact O-CB 3.42Å; V88-K92 VanDerWaalsContact O-CG 3.3Å; V88-K92 WeakPolarHBondContact O-CG 3.5Å; V88-K92 PolarHBondContact O-N 3.46Å; V88-L98 HydrophobicContact CG2-CD2 4.32Å; V88-F101 HydrophobicContact CG1-CB 4.47Å; V88-F101 HydrophobicContact CG2-CB 3.53Å; V88-F101 HydrophobicContact CG2-CD1 3.86Å; V88-F101 HydrophobicContact CG2-CG 3.74Å
89Y95.2Very high94.9Very high107 Ų10783.8 Ų83.842%0.4241%0.413SS..Hα-helixtrans-68.7-41.2176.6-62.9-38.6000112.5M85 V87 L91 K92 R93M85-Y89 HydrophobicContact CB-CD2 4.43Å; M85-Y89 HydrophobicContact CB-CE2 4.02Å; M85-Y89 HydrophobicContact CE-CE1 3.93Å; M85-Y89 HydrophobicContact CE-CE2 4.21Å; M85-Y89 WeakPolarHBondContact CE-OH 3.39Å; M85-Y89 WeakPolarHBondContact O-CB 3.49Å; M85-Y89 WeakPolarHBondContact O-CD2 3.44Å; M85-Y89 VanDerWaalsContact O-CG 3.25Å; M85-Y89 PolarHBondContact O-N 3.16Å; V87-Y89 VanDerWaalsContact C-N 3.32Å; V87-Y89 PolarHBondContact O-N 2.81Å; Y89-L91 VanDerWaalsContact C-N 3.33Å; Y89-L91 PolarHBondContact O-N 2.96Å; Y89-K92 HydrophobicContact CD1-CD 4.45Å; Y89-K92 PolarHBondContact O-N 3.16Å; Y89-R93 WeakPolarHBondContact O-CB 3.42Å; Y89-R93 PolarHBondContact O-N 2.91Å
90A96.6Very high94.7Very high0 Ų083.4 Ų83.40%044%0.438CS..Hα-helixtrans-57.3-45.3172.900000112.2V66 D69 A70 Y73 D86 V87 R93 Q94V66-A90 HydrophobicContact CG1-CB 4.31Å; D69-A90 HydrophobicContact CB-CB 3.61Å; A70-A90 HydrophobicContact CB-CB 4.04Å; Y73-A90 HydrophobicContact CE2-CB 4.47Å; D86-A90 WeakPolarHBondContact O-CB 3.48Å; D86-A90 PolarHBondContact O-N 2.8Å; V87-A90 PolarHBondContact O-N 3.1Å; A90-R93 PolarHBondContact O-N 3.38Å; A90-Q94 PolarHBondContact O-N 2.84Å
91L96.3Very high94.3Very high20 Ų2077.3 Ų77.311%0.10541%0.411CS..Hα-helixtrans-65.7-46176.8-70.4170.7000111.6F62 V66 V87 V88 Y89 R93 Q94 G95 R96 L98F62-L91 HydrophobicContact CZ-CD2 4.15Å; V66-L91 HydrophobicContact CG1-CD2 4.06Å; V66-L91 HydrophobicContact CG1-CG 4.27Å; V66-L91 HydrophobicContact CG2-CD2 3.82Å; V87-L91 HydrophobicContact CG1-CD1 4.08Å; V87-L91 HydrophobicContact CG1-CG 4.44Å; V87-L91 WeakPolarHBondContact O-CB 3.48Å; V87-L91 VanDerWaalsContact O-CG 3.31Å; V87-L91 WeakPolarHBondContact O-CG 3.26Å; V87-L91 PolarHBondContact O-N 3.28Å; V88-L91 PolarHBondContact O-N 3.07Å; Y89-L91 VanDerWaalsContact C-N 3.33Å; Y89-L91 PolarHBondContact O-N 2.96Å; L91-R93 VanDerWaalsContact C-N 3.28Å; L91-R93 PolarHBondContact O-N 2.85Å; L91-Q94 CarbonylContact O-C 3.5Å; L91-Q94 WeakPolarHBondContact O-CA 3.28Å; L91-Q94 PolarHBondContact O-N 2.97Å; L91-G95 PolarHBondContact O-N 2.91Å; L91-R96 CarbonylContact C-O 3.51Å; L91-R96 HydrophobicContact CB-CB 4.2Å; L91-R96 VanDerWaalsContact CB-O 3.28Å; L91-R96 WeakPolarHBondContact CB-O 3.41Å; L91-R96 HydrophobicContact CD2-CB 4.22Å; L91-R96 WeakPolarHBondContact O-CA 3.48Å; L91-R96 PolarHBondContact O-N 2.95Å; L91-L98 HydrophobicContact CD1-CB 3.94Å; L91-L98 HydrophobicContact CD1-CD2 4.07Å; L91-L98 HydrophobicContact CD1-CG 4.44Å
92K94.5Very high93.3Very high111 Ų11176 Ų7648%0.48342%0.418SS..Hα-helixtrans-57.7-41.3177.6-79177.2178.5179.90111.7V88 Y89 Q94 G95 R96V88-K92 HydrophobicContact CG1-CD 4.15Å; V88-K92 WeakPolarHBondContact O-CB 3.42Å; V88-K92 VanDerWaalsContact O-CG 3.3Å; V88-K92 WeakPolarHBondContact O-CG 3.5Å; V88-K92 PolarHBondContact O-N 3.46Å; Y89-K92 HydrophobicContact CD1-CD 4.45Å; Y89-K92 PolarHBondContact O-N 3.16Å; K92-Q94 PolarHBondContact O-N 3.31Å; K92-G95 PolarHBondContact O-N 3.34Å; K92-R96 PolarHBondContact N-O 3.16Å
93R94.2Very high91.5Very high164 Ų16479.3 Ų79.362%0.61947%0.467SS*.Hα-helixtrans-58.9-32.5175.5-178.1177.8175.1-94.92112.7D69 Y89 A90 L91 G95D69-R93 IonicContact OD1-CZ 3.76Å; D69-R93 IonicContact OD1-NH1 2.84Å; D69-R93 PolarHBondContact OD1-NH1 3.05Å; D69-R93 IonicContact OD2-CZ 3.94Å; D69-R93 IonicContact OD2-NH1 2.81Å; D69-R93 PolarHBondContact OD2-NH1 3.2Å; Y89-R93 WeakPolarHBondContact O-CB 3.42Å; Y89-R93 PolarHBondContact O-N 2.91Å; A90-R93 PolarHBondContact O-N 3.38Å; L91-R93 VanDerWaalsContact C-N 3.28Å; L91-R93 PolarHBondContact O-N 2.85Å; R93-G95 VanDerWaalsContact C-N 3.29Å
94Q93.1Very high91.3Very high63 Ų6380.7 Ų80.729%0.29447%0.474SS..THydrogen-bonded Turntrans-89.311.9177.1-62.3177.78.100113.3N65 D69 A90 L91 K92 R96N65-Q94 PolarHBondContact O-NE2 2.77Å; D69-Q94 PolarHBondContact OD2-NE2 3.08Å; A90-Q94 PolarHBondContact O-N 2.84Å; L91-Q94 CarbonylContact O-C 3.5Å; L91-Q94 WeakPolarHBondContact O-CA 3.28Å; L91-Q94 PolarHBondContact O-N 2.97Å; K92-Q94 PolarHBondContact O-N 3.31Å; Q94-R96 VanDerWaalsContact C-N 3.26Å; Q94-R96 PolarHBondContact O-N 2.92Å
95G94.3Very high91.1Very high65 Ų6581.9 Ų81.967%0.6747%0.474SS*.THydrogen-bonded Turntrans69.821.4-17700000113.8L91 K92 R93L91-G95 PolarHBondContact O-N 2.91Å; K92-G95 PolarHBondContact O-N 3.34Å; R93-G95 VanDerWaalsContact C-N 3.29Å
96R93.6Very high90.8Very high164 Ų16483 Ų8362%0.61948%0.483SS*.  trans-111.2120.2178.5-60.9-58.8-174.5173.2-0.9110.1L91 K92 Q94L91-R96 CarbonylContact C-O 3.51Å; L91-R96 HydrophobicContact CB-CB 4.2Å; L91-R96 VanDerWaalsContact CB-O 3.28Å; L91-R96 WeakPolarHBondContact CB-O 3.41Å; L91-R96 HydrophobicContact CD2-CB 4.22Å; L91-R96 WeakPolarHBondContact O-CA 3.48Å; L91-R96 PolarHBondContact O-N 2.95Å; K92-R96 PolarHBondContact N-O 3.16Å; Q94-R96 VanDerWaalsContact C-N 3.26Å; Q94-R96 PolarHBondContact O-N 2.92Å
97T91.8Very high90.5Very high89 Ų8987.6 Ų87.655%0.54651%0.51SS..  trans-97125.6177.8-58.40000110Y99T97-Y99 HydrophobicContact CG2-CD1 4.48Å; T97-Y99 HydrophobicContact CG2-CE1 4.33Å
98L92.5Very high90.1Very high71 Ų7189.9 Ų89.937%0.37252%0.523SS..  trans-94.4113.1170.3-169.364.3000109.1V88 L91 F101V88-L98 HydrophobicContact CG2-CD2 4.32Å; L91-L98 HydrophobicContact CD1-CB 3.94Å; L91-L98 HydrophobicContact CD1-CD2 4.07Å; L91-L98 HydrophobicContact CD1-CG 4.44Å; L98-F101 HydrophobicContact CB-CD2 4.24Å; L98-F101 HydrophobicContact CD1-CE2 4.39Å; L98-F101 HydrophobicContact CD2-CD2 3.48Å; L98-F101 VanDerWaalsContact CD2-CD2 3.48Å; L98-F101 HydrophobicContact CD2-CE1 4.46Å; L98-F101 HydrophobicContact CD2-CE2 3.3Å; L98-F101 HydrophobicContact CD2-CG 4.15Å; L98-F101 HydrophobicContact CD2-CZ 3.84Å; L98-F101 HydrophobicContact CG-CD2 3.48Å; L98-F101 VanDerWaalsContact CG-CD2 3.48Å; L98-F101 HydrophobicContact CG-CE2 3.55Å; L98-F101 HydrophobicContact CG-CG 4.43Å
99Y91.5Very high89.7Confident198 Ų19895.8 Ų95.878%0.77656%0.557SS**THydrogen-bonded Turntrans-73.6151.5-179.1-58.7-77.9000112T97 F101T97-Y99 HydrophobicContact CG2-CD1 4.48Å; T97-Y99 HydrophobicContact CG2-CE1 4.33Å; Y99-F101 VanDerWaalsContact C-N 3.31Å; Y99-F101 WeakPolarHBondContact O-CD2 3.5Å
100G92Very high89.3Confident83 Ų8395 Ų9586%0.85657%0.567SS**THydrogen-bonded Turntrans81.85.9-178.500000114.7
101F87.1Confident88.8Confident87 Ų87102.3 Ų102.338%0.38261%0.611SS.*  trans-117.634.6175.2-63.6-99.3000111.6A84 V88 L98 Y99 G103A84-F101 HydrophobicContact CB-CD1 4.38Å; A84-F101 HydrophobicContact CB-CE1 4.16Å; V88-F101 HydrophobicContact CG1-CB 4.47Å; V88-F101 HydrophobicContact CG2-CB 3.53Å; V88-F101 HydrophobicContact CG2-CD1 3.86Å; V88-F101 HydrophobicContact CG2-CG 3.74Å; L98-F101 HydrophobicContact CB-CD2 4.24Å; L98-F101 HydrophobicContact CD1-CE2 4.39Å; L98-F101 HydrophobicContact CD2-CD2 3.48Å; L98-F101 VanDerWaalsContact CD2-CD2 3.48Å; L98-F101 HydrophobicContact CD2-CE1 4.46Å; L98-F101 HydrophobicContact CD2-CE2 3.3Å; L98-F101 HydrophobicContact CD2-CG 4.15Å; L98-F101 HydrophobicContact CD2-CZ 3.84Å; L98-F101 HydrophobicContact CG-CD2 3.48Å; L98-F101 VanDerWaalsContact CG-CD2 3.48Å; L98-F101 HydrophobicContact CG-CE2 3.55Å; L98-F101 HydrophobicContact CG-CG 4.43Å; Y99-F101 VanDerWaalsContact C-N 3.31Å; Y99-F101 WeakPolarHBondContact O-CD2 3.5Å; F101-G103 PolarHBondContact O-N 3.12Å
102G75.6Confident88.1Confident76 Ų76109.2 Ų109.278%0.78465%0.653SS**  trans-61.6125.2163.600000108.1
103G57.5Low87.6Confident139 Ų139109 Ų109100%1.43367%0.668SS**  trans-76.60171.800000111.1F101F101-G103 PolarHBondContact O-N 3.12Å

Retrieved 103 of 103 residues in 71.3 ms (Link to these results)