SERF2_HUMAN Loading...

Small EDRK-rich factor 2

Positive regulator of amyloid protein aggregation and proteotoxicity¹. Induces conformational changes in amyloid proteins, such as HTT, driving them into compact formations preceding the formation of aggregates².

AlphaFold DB , UniProt , Accession P84101, Species HUMAN (Homo sapiens, Human), Gene SERF2, Length 59 aa.

						>SERF2_HUMAN|P84101|SERF2
MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.9	Low	80.3	Confident	246 Å²	246	132.9 Å²	132.9	100%	1.212	65%	0.646	S	S	*	*				0	108.4	0	-60.8	173.1	-159.8	0	0	107.4	R3	M1-R3 PolarHBondContact O-N 2.95Å
2	T	65.3	Low	81	Confident	110 Å²	110	130.3 Å²	130.3	68%	0.675	63%	0.632	S	S	*	*			trans	-68.8	128.1	-153.8	56.2	0	0	0	0	111.9	G4 N5	T2-G4 PolarHBondContact O-N 3.49Å; T2-N5 PolarHBondContact O-N 3.47Å
3	R	70.8	Confident	81.8	Confident	226 Å²	226	132.2 Å²	132.2	85%	0.853	64%	0.635	S	S	*	*	H	α-helix	trans	-50.4	-22.1	175.1	-114.7	-179	-177.8	96.5	-2.5	113.4	M1 R7	M1-R3 PolarHBondContact O-N 2.95Å; R3-R7 PolarHBondContact O-N 3.44Å
4	G	77.5	Confident	82.4	Confident	49 Å²	49	129.9 Å²	129.9	51%	0.505	63%	0.628	S	S	.	*	H	α-helix	trans	-61.7	-37.8	174.3	0	0	0	0	0	113.9	T2 Q6 R7 E8	T2-G4 PolarHBondContact O-N 3.49Å; G4-Q6 PolarHBondContact O-N 3.26Å; G4-R7 PolarHBondContact O-N 3.39Å; G4-E8 PolarHBondContact O-N 2.91Å
5	N	84.3	Confident	82.7	Confident	101 Å²	101	127.5 Å²	127.5	54%	0.54	62%	0.617	S	S	.	*	H	α-helix	trans	-65	-43	-178.7	-171.1	26.1	0	0	0	111.7	T2 R7 E8 L9	T2-N5 PolarHBondContact O-N 3.47Å; N5-R7 VanDerWaalsContact C-N 3.3Å; N5-R7 PolarHBondContact O-N 3.06Å; N5-E8 PolarHBondContact O-N 3Å; N5-L9 WeakPolarHBondContact O-CB 3.39Å; N5-L9 PolarHBondContact O-N 3.13Å
6	Q	85.9	Confident	82.9	Confident	148 Å²	148	127.3 Å²	127.3	69%	0.692	61%	0.612	S	S	*	*	H	α-helix	trans	-63.5	-36.9	177.6	-71.9	-176	-8.5	0	0	112.3	G4 A10	G4-Q6 PolarHBondContact O-N 3.26Å; Q6-A10 WeakPolarHBondContact O-CB 3.33Å; Q6-A10 PolarHBondContact O-N 3.38Å
7	R	86.7	Confident	83.1	Confident	196 Å²	196	128.6 Å²	128.6	74%	0.74	61%	0.614	S	S	*	*	H	α-helix	trans	-67	-42.8	178	-171.1	-179	-76.4	-174.1	-4.1	111.3	R3 G4 N5 A10 R11	R3-R7 PolarHBondContact O-N 3.44Å; G4-R7 PolarHBondContact O-N 3.39Å; N5-R7 VanDerWaalsContact C-N 3.3Å; N5-R7 PolarHBondContact O-N 3.06Å; R7-A10 PolarHBondContact O-N 2.98Å; R7-R11 PolarHBondContact O-N 3.32Å
8	E	91.2	Very high	82.9	Confident	87 Å²	87	129.1 Å²	129.1	41%	0.407	62%	0.616	S	S	.	*	H	α-helix	trans	-65.3	-45	177.2	-175.5	51.3	-144.6	0	0	111.4	G4 N5 A10 R11 Q12	G4-E8 PolarHBondContact O-N 2.91Å; N5-E8 PolarHBondContact O-N 3Å; E8-A10 VanDerWaalsContact C-N 3.32Å; E8-A10 PolarHBondContact O-N 3.35Å; E8-R11 WeakPolarHBondContact O-CB 3.45Å; E8-R11 PolarHBondContact O-N 3.48Å; E8-R11 VanDerWaalsContact O-N 3.13Å; E8-Q12 WeakPolarHBondContact O-CG 3.43Å; E8-Q12 PolarHBondContact O-N 3.25Å; E8-Q12 WeakPolarHBondContact OE1-CG 3.43Å; E8-Q12 PolarHBondContact OE1-NE2 3.48Å
9	L	88.7	Confident	82.7	Confident	99 Å²	99	125.3 Å²	125.3	52%	0.518	60%	0.604	S	S	.	*	H	α-helix	trans	-58	-41.9	174.2	-113.9	152.7	0	0	0	112.6	N5 Q12 K13	N5-L9 WeakPolarHBondContact O-CB 3.39Å; N5-L9 PolarHBondContact O-N 3.13Å; L9-Q12 PolarHBondContact O-N 2.94Å; L9-K13 VanDerWaalsContact O-CB 3.28Å; L9-K13 WeakPolarHBondContact O-CB 3.49Å; L9-K13 PolarHBondContact O-N 3.48Å
10	A	88.8	Confident	82.4	Confident	48 Å²	48	122.6 Å²	122.6	40%	0.397	59%	0.593	S	S	.	*	H	α-helix	trans	-65.3	-40.5	176.1	0	0	0	0	0	112	Q6 R7 E8 K13 N14	Q6-A10 WeakPolarHBondContact O-CB 3.33Å; Q6-A10 PolarHBondContact O-N 3.38Å; R7-A10 PolarHBondContact O-N 2.98Å; E8-A10 VanDerWaalsContact C-N 3.32Å; E8-A10 PolarHBondContact O-N 3.35Å; A10-K13 PolarHBondContact O-N 2.87Å; A10-N14 WeakPolarHBondContact O-CB 3.28Å; A10-N14 VanDerWaalsContact O-CG 3.24Å; A10-N14 PolarHBondContact O-N 3.49Å; A10-N14 PolarHBondContact O-ND2 2.95Å
11	R	90.7	Very high	81.7	Confident	152 Å²	152	119.6 Å²	119.6	57%	0.574	59%	0.585	S	S	*	*	H	α-helix	trans	-62.6	-48.6	173.7	-77.1	-168.6	70.4	88.5	0.6	111.4	R7 E8 K13 N14 M15	R7-R11 PolarHBondContact O-N 3.32Å; E8-R11 WeakPolarHBondContact O-CB 3.45Å; E8-R11 PolarHBondContact O-N 3.48Å; E8-R11 VanDerWaalsContact O-N 3.13Å; R11-K13 VanDerWaalsContact C-N 3.34Å; R11-K13 PolarHBondContact O-N 3.44Å; R11-N14 PolarHBondContact O-N 3Å; R11-M15 HydrophobicContact CB-CE 4.39Å; R11-M15 WeakPolarHBondContact O-CB 3.36Å; R11-M15 WeakPolarHBondContact O-CG 3.24Å; R11-M15 PolarHBondContact O-N 2.68Å
12	Q	88.5	Confident	82.5	Confident	102 Å²	102	113 Å²	113	48%	0.477	56%	0.559	S	S	.	*	H	α-helix	trans	-60.1	-43.7	177.8	-71	-177.5	14.6	0	0	111.8	E8 L9 N14 M15 K16	E8-Q12 WeakPolarHBondContact O-CG 3.43Å; E8-Q12 PolarHBondContact O-N 3.25Å; E8-Q12 WeakPolarHBondContact OE1-CG 3.43Å; E8-Q12 PolarHBondContact OE1-NE2 3.48Å; L9-Q12 PolarHBondContact O-N 2.94Å; Q12-N14 PolarHBondContact O-N 2.94Å; Q12-M15 HydrophobicContact CG-CE 4.22Å; Q12-M15 PolarHBondContact O-N 2.85Å; Q12-K16 VanDerWaalsContact O-CB 3.26Å; Q12-K16 WeakPolarHBondContact O-CB 3.36Å; Q12-K16 PolarHBondContact O-N 3.3Å
13	K	90.9	Very high	82.3	Confident	154 Å²	154	116 Å²	116	67%	0.67	56%	0.562	S	S	*	*	H	α-helix	trans	-63.7	-40.9	177	-171.2	174.9	-178	177.8	0	112.1	L9 A10 R11 K16 K17	L9-K13 VanDerWaalsContact O-CB 3.28Å; L9-K13 WeakPolarHBondContact O-CB 3.49Å; L9-K13 PolarHBondContact O-N 3.48Å; A10-K13 PolarHBondContact O-N 2.87Å; R11-K13 VanDerWaalsContact C-N 3.34Å; R11-K13 PolarHBondContact O-N 3.44Å; K13-K16 PolarHBondContact O-N 3.45Å; K13-K17 WeakPolarHBondContact O-CB 3.45Å; K13-K17 PolarHBondContact O-N 2.86Å
14	N	90.1	Very high	81.8	Confident	100 Å²	100	108.6 Å²	108.6	54%	0.535	56%	0.556	S	S	.	*	H	α-helix	trans	-67.6	-44.5	176.6	-74.5	-12.3	0	0	0	112	A10 R11 Q12 K16 K17 Q18	A10-N14 WeakPolarHBondContact O-CB 3.28Å; A10-N14 VanDerWaalsContact O-CG 3.24Å; A10-N14 PolarHBondContact O-N 3.49Å; A10-N14 PolarHBondContact O-ND2 2.95Å; R11-N14 PolarHBondContact O-N 3Å; Q12-N14 PolarHBondContact O-N 2.94Å; N14-K16 VanDerWaalsContact C-N 3.34Å; N14-K16 PolarHBondContact O-N 2.79Å; N14-K17 PolarHBondContact O-N 3.41Å; N14-Q18 WeakPolarHBondContact O-CG 3.35Å; N14-Q18 PolarHBondContact O-N 2.85Å
15	M	87.6	Confident	80.9	Confident	94 Å²	94	113.9 Å²	113.9	46%	0.463	57%	0.565	S	S	.	*	H	α-helix	trans	-60	-44.3	174	-73	-174.3	-64.2	0	0	111	R11 Q12 Q18 S19	R11-M15 HydrophobicContact CB-CE 4.39Å; R11-M15 WeakPolarHBondContact O-CB 3.36Å; R11-M15 WeakPolarHBondContact O-CG 3.24Å; R11-M15 PolarHBondContact O-N 2.68Å; Q12-M15 HydrophobicContact CG-CE 4.22Å; Q12-M15 PolarHBondContact O-N 2.85Å; M15-Q18 PolarHBondContact O-N 3.36Å; M15-S19 WeakPolarHBondContact O-CB 3.46Å; M15-S19 PolarHBondContact O-N 3.35Å; M15-S19 PolarHBondContact O-OG 2.98Å
16	K	85.8	Confident	79.7	Confident	125 Å²	125	119.4 Å²	119.4	54%	0.543	58%	0.578	S	S	.	*	H	α-helix	trans	-64.5	-41.6	176.5	-174.9	170.2	-173.7	-62.8	0	112.3	Q12 K13 N14 Q18 S19 D20	Q12-K16 VanDerWaalsContact O-CB 3.26Å; Q12-K16 WeakPolarHBondContact O-CB 3.36Å; Q12-K16 PolarHBondContact O-N 3.3Å; K13-K16 PolarHBondContact O-N 3.45Å; N14-K16 VanDerWaalsContact C-N 3.34Å; N14-K16 PolarHBondContact O-N 2.79Å; K16-Q18 VanDerWaalsContact C-N 3.35Å; K16-Q18 PolarHBondContact O-N 3.31Å; K16-S19 WeakPolarHBondContact CA-OG 3.27Å; K16-S19 PolarHBondContact O-N 3.49Å; K16-S19 PolarHBondContact O-OG 2.91Å; K16-D20 WeakPolarHBondContact CG-OD2 3.33Å; K16-D20 IonicContact NZ-OD2 2.74Å; K16-D20 PolarHBondContact NZ-OD2 3.48Å; K16-D20 VanDerWaalsContact O-CB 3.27Å; K16-D20 WeakPolarHBondContact O-CB 3.26Å; K16-D20 PolarHBondContact O-N 2.82Å
17	K	85.1	Confident	78.5	Confident	149 Å²	149	122.7 Å²	122.7	65%	0.648	58%	0.584	S	S	*	*	H	α-helix	trans	-63.4	-41.9	176.5	-171.5	-179.9	179.9	-176.1	0	111.4	K13 N14 S21	K13-K17 WeakPolarHBondContact O-CB 3.45Å; K13-K17 PolarHBondContact O-N 2.86Å; N14-K17 PolarHBondContact O-N 3.41Å; K17-S21 VanDerWaalsContact O-CB 3.24Å; K17-S21 WeakPolarHBondContact O-CB 3.44Å; K17-S21 PolarHBondContact O-N 2.82Å; K17-S21 PolarHBondContact O-OG 3.16Å
18	Q	80.5	Confident	77.3	Confident	138 Å²	138	119.7 Å²	119.7	65%	0.645	58%	0.583	S	S	*	*	H	α-helix	trans	-64.6	-45.8	174	-75.2	178.7	-24.7	0	0	111.1	N14 M15 K16 S21 V22	N14-Q18 WeakPolarHBondContact O-CG 3.35Å; N14-Q18 PolarHBondContact O-N 2.85Å; M15-Q18 PolarHBondContact O-N 3.36Å; K16-Q18 VanDerWaalsContact C-N 3.35Å; K16-Q18 PolarHBondContact O-N 3.31Å; Q18-S21 PolarHBondContact O-N 3.22Å; Q18-V22 VanDerWaalsContact O-CG2 3.26Å; Q18-V22 WeakPolarHBondContact O-CG2 3.34Å; Q18-V22 PolarHBondContact O-N 3.19Å
19	S	79.4	Confident	76.4	Confident	56 Å²	56	119.3 Å²	119.3	39%	0.392	58%	0.584	S	S	.	*	H	α-helix	trans	-64.8	-43.4	179.2	68.5	0	0	0	0	112.2	M15 K16 V22 K23	M15-S19 WeakPolarHBondContact O-CB 3.46Å; M15-S19 PolarHBondContact O-N 3.35Å; M15-S19 PolarHBondContact O-OG 2.98Å; K16-S19 WeakPolarHBondContact CA-OG 3.27Å; K16-S19 PolarHBondContact O-N 3.49Å; K16-S19 PolarHBondContact O-OG 2.91Å; S19-V22 CarbonylContact O-C 3.48Å; S19-V22 WeakPolarHBondContact O-CB 3.09Å; S19-V22 PolarHBondContact O-N 2.69Å; S19-V22 VanDerWaalsContact O-N 3.16Å; S19-K23 WeakPolarHBondContact O-CA 3.19Å; S19-K23 WeakPolarHBondContact O-CB 3.27Å; S19-K23 PolarHBondContact O-N 2.74Å
20	D	75.2	Confident	75.7	Confident	71 Å²	71	118 Å²	118	38%	0.38	60%	0.595	S	S	.	*	H	α-helix	trans	-69.6	-37.3	-179.9	-70.5	-16.1	0	0	0	111.4	K16 V22 K23	K16-D20 WeakPolarHBondContact CG-OD2 3.33Å; K16-D20 IonicContact NZ-OD2 2.74Å; K16-D20 PolarHBondContact NZ-OD2 3.48Å; K16-D20 VanDerWaalsContact O-CB 3.27Å; K16-D20 WeakPolarHBondContact O-CB 3.26Å; K16-D20 PolarHBondContact O-N 2.82Å; D20-V22 PolarHBondContact O-N 3.46Å; D20-K23 CarbonylContact O-C 3.54Å; D20-K23 PolarHBondContact O-N 3.19Å
21	S	69.4	Low	75.3	Confident	61 Å²	61	118 Å²	118	43%	0.427	59%	0.587	S	S	.	*	H	α-helix	trans	-62	-25.6	172.7	-60.6	0	0	0	0	112.2	K17 Q18 K25	K17-S21 VanDerWaalsContact O-CB 3.24Å; K17-S21 WeakPolarHBondContact O-CB 3.44Å; K17-S21 PolarHBondContact O-N 2.82Å; K17-S21 PolarHBondContact O-OG 3.16Å; Q18-S21 PolarHBondContact O-N 3.22Å; S21-K25 WeakPolarHBondContact O-CD 3.48Å; S21-K25 WeakPolarHBondContact O-CE 3.26Å; S21-K25 VanDerWaalsContact O-CG 3.27Å; S21-K25 WeakPolarHBondContact O-CG 3.5Å
22	V	69.2	Low	75	Confident	108 Å²	108	114.2 Å²	114.2	66%	0.655	58%	0.584	S	S	*	*	H	α-helix	trans	-91.2	-34.6	174.6	175.9	0	0	0	0	111.3	Q18 S19 D20 G24 K25	Q18-V22 VanDerWaalsContact O-CG2 3.26Å; Q18-V22 WeakPolarHBondContact O-CG2 3.34Å; Q18-V22 PolarHBondContact O-N 3.19Å; S19-V22 CarbonylContact O-C 3.48Å; S19-V22 WeakPolarHBondContact O-CB 3.09Å; S19-V22 PolarHBondContact O-N 2.69Å; S19-V22 VanDerWaalsContact O-N 3.16Å; D20-V22 PolarHBondContact O-N 3.46Å; V22-G24 PolarHBondContact O-N 2.85Å; V22-G24 VanDerWaalsContact O-N 3.14Å; V22-K25 VanDerWaalsContact O-O 3.06Å
23	K	62.3	Low	74.8	Confident	173 Å²	173	113.4 Å²	113.4	75%	0.752	60%	0.595	S	S	*	*	S	Bend	trans	-88.3	80.3	-174.4	-167.8	-178.4	-175.5	-178.4	0	110	S19 D20	S19-K23 WeakPolarHBondContact O-CA 3.19Å; S19-K23 WeakPolarHBondContact O-CB 3.27Å; S19-K23 PolarHBondContact O-N 2.74Å; D20-K23 CarbonylContact O-C 3.54Å; D20-K23 PolarHBondContact O-N 3.19Å
24	G	60.6	Low	74.7	Confident	70 Å²	70	109.4 Å²	109.4	72%	0.722	59%	0.591	S	S	*	*	S	Bend	trans	144.8	-28.7	178.9	0	0	0	0	0	111.8	V22 R26	V22-G24 PolarHBondContact O-N 2.85Å; V22-G24 VanDerWaalsContact O-N 3.14Å; G24-R26 PolarHBondContact O-N 2.78Å
25	K	57.6	Low	74.6	Confident	160 Å²	160	106 Å²	106	70%	0.696	58%	0.577	S	S	*	*	S	Bend	trans	-64.1	92.3	149.3	-63.1	-171	-169.6	-165.6	0	105.3	S21 V22 R27	S21-K25 WeakPolarHBondContact O-CD 3.48Å; S21-K25 WeakPolarHBondContact O-CE 3.26Å; S21-K25 VanDerWaalsContact O-CG 3.27Å; S21-K25 WeakPolarHBondContact O-CG 3.5Å; V22-K25 VanDerWaalsContact O-O 3.06Å; K25-R27 PolarHBondContact O-N 3.05Å
26	R	58.4	Low	74.7	Confident	216 Å²	216	106.1 Å²	106.1	82%	0.815	57%	0.572	S	S	*	*			trans	-38.7	124.3	157.2	-64.1	-178.8	-173.4	122.4	0.2	103.9	G24 D28	G24-R26 PolarHBondContact O-N 2.78Å; R26-D28 PolarHBondContact O-N 3.14Å
27	R	62.1	Low	74.9	Confident	217 Å²	217	108 Å²	108	82%	0.819	58%	0.58	S	S	*	*			trans	-40.8	115.2	173.5	-74.7	-169.1	177.3	-170.3	0.2	104.4	K25 D29	K25-R27 PolarHBondContact O-N 3.05Å; R27-D29 WeakPolarHBondContact CB-OD1 3.35Å; R27-D29 PolarHBondContact O-N 3.13Å
28	D	60.9	Low	75.2	Confident	133 Å²	133	106.5 Å²	106.5	71%	0.711	58%	0.576	S	S	*	*			trans	-70.2	94	-177.7	-144.1	-20.9	0	0	0	101.2	R26 G30 R36	R26-D28 PolarHBondContact O-N 3.14Å; D28-G30 PolarHBondContact O-N 2.72Å; D28-R36 IonicContact OD1-NH2 3.04Å; D28-R36 PolarHBondContact OD1-NH2 2.85Å
29	D	73.2	Confident	75.6	Confident	80 Å²	80	104.1 Å²	104.1	43%	0.428	56%	0.561	S	S	.	*			trans	-68.4	16.8	-168.5	-67.9	-31.7	0	0	0	110.6	R27 L31 R39	R27-D29 WeakPolarHBondContact CB-OD1 3.35Å; R27-D29 PolarHBondContact O-N 3.13Å; D29-L31 HydrophobicContact CB-CB 4.43Å; D29-L31 HydrophobicContact CB-CG 4.09Å; D29-L31 PolarHBondContact O-N 3.04Å; D29-R39 IonicContact OD2-CZ 3.62Å; D29-R39 IonicContact OD2-NH1 2.7Å; D29-R39 PolarHBondContact OD2-NH1 3.48Å; D29-R39 IonicContact OD2-NH2 3.7Å
30	G	73.8	Confident	76.2	Confident	72 Å²	72	106.1 Å²	106.1	74%	0.742	57%	0.567	S	S	*	*	S	Bend	trans	61	-1.8	-169.1	0	0	0	0	0	113.2	D28 S32	D28-G30 PolarHBondContact O-N 2.72Å; G30-S32 PolarHBondContact O-N 2.89Å
31	L	79.3	Confident	77	Confident	47 Å²	47	105.2 Å²	105.2	25%	0.246	57%	0.566	C	S	.	*			trans	-78	127.9	-169.3	-73.1	-154.3	0	0	0	111.2	D29 A35 R36	D29-L31 HydrophobicContact CB-CB 4.43Å; D29-L31 HydrophobicContact CB-CG 4.09Å; D29-L31 PolarHBondContact O-N 3.04Å; L31-A35 HydrophobicContact CB-CB 4.01Å; L31-A35 HydrophobicContact CD1-CB 3.8Å; L31-A35 HydrophobicContact CD2-CB 3.89Å; L31-A35 HydrophobicContact CG-CB 4.13Å; L31-R36 HydrophobicContact CB-CG 3.81Å; L31-R36 HydrophobicContact CD1-CG 4.4Å; L31-R36 PolarHBondContact O-NE 2.7Å; L31-R36 VanDerWaalsContact O-NE 3.13Å; L31-R36 PolarHBondContact O-NH2 2.7Å
32	S	83.9	Confident	78.1	Confident	72 Å²	72	106.5 Å²	106.5	50%	0.503	57%	0.565	S	S	.	*			trans	-56	158	163.9	73.8	0	0	0	0	110.7	G30 A34 A35 R36	G30-S32 PolarHBondContact O-N 2.89Å; S32-A34 PolarHBondContact O-N 3.31Å; S32-A35 PolarHBondContact O-N 3.09Å; S32-A35 VanDerWaalsContact O-N 3.09Å; S32-A35 PolarHBondContact OG-N 3.04Å; S32-R36 PolarHBondContact O-N 3.17Å
33	A	85.7	Confident	79.3	Confident	85 Å²	85	105.8 Å²	105.8	70%	0.702	56%	0.557	S	S	*	*	H	α-helix	trans	-55.7	-34.9	178	0	0	0	0	0	112.5	R36 K37	A33-R36 PolarHBondContact O-N 2.97Å; A33-K37 PolarHBondContact O-N 3.47Å
34	A	88.6	Confident	80.8	Confident	71 Å²	71	103.1 Å²	103.1	59%	0.587	55%	0.549	S	S	*	.	H	α-helix	trans	-65	-47	175.9	0	0	0	0	0	112.2	S32 R36 K37 Q38	S32-A34 PolarHBondContact O-N 3.31Å; A34-R36 VanDerWaalsContact C-N 3.29Å; A34-R36 PolarHBondContact O-N 3.17Å; A34-K37 PolarHBondContact O-N 3.39Å; A34-Q38 PolarHBondContact O-N 3.47Å
35	A	88.8	Confident	82.4	Confident	29 Å²	29	104.9 Å²	104.9	24%	0.24	54%	0.538	C	S	.	.	H	α-helix	trans	-65	-34.3	178.9	0	0	0	0	0	111.8	L31 S32 Q38 R39	L31-A35 HydrophobicContact CB-CB 4.01Å; L31-A35 HydrophobicContact CD1-CB 3.8Å; L31-A35 HydrophobicContact CD2-CB 3.89Å; L31-A35 HydrophobicContact CG-CB 4.13Å; S32-A35 PolarHBondContact O-N 3.09Å; S32-A35 VanDerWaalsContact O-N 3.09Å; S32-A35 PolarHBondContact OG-N 3.04Å; A35-Q38 PolarHBondContact O-N 3.39Å; A35-R39 WeakPolarHBondContact O-CB 3.44Å; A35-R39 PolarHBondContact O-N 2.99Å
36	R	87.8	Confident	84.1	Confident	95 Å²	95	103.5 Å²	103.5	36%	0.358	53%	0.534	S	S	.	.	H	α-helix	trans	-63.2	-46.9	171.6	-65.9	-179	-164.7	176.9	-2.6	111.6	D28 L31 S32 A33 A34 Q38 R39 D40	D28-R36 IonicContact OD1-NH2 3.04Å; D28-R36 PolarHBondContact OD1-NH2 2.85Å; L31-R36 HydrophobicContact CB-CG 3.81Å; L31-R36 HydrophobicContact CD1-CG 4.4Å; L31-R36 PolarHBondContact O-NE 2.7Å; L31-R36 VanDerWaalsContact O-NE 3.13Å; L31-R36 PolarHBondContact O-NH2 2.7Å; S32-R36 PolarHBondContact O-N 3.17Å; A33-R36 PolarHBondContact O-N 2.97Å; A34-R36 VanDerWaalsContact C-N 3.29Å; A34-R36 PolarHBondContact O-N 3.17Å; R36-Q38 VanDerWaalsContact C-N 3.32Å; R36-Q38 PolarHBondContact O-N 3.4Å; R36-R39 PolarHBondContact O-N 3.05Å; R36-D40 WeakPolarHBondContact O-CB 3.41Å; R36-D40 VanDerWaalsContact O-CG 3.27Å; R36-D40 PolarHBondContact O-N 3.44Å
37	K	91.9	Very high	85.9	Confident	165 Å²	165	101 Å²	101	72%	0.717	53%	0.529	S	S	*	.	H	α-helix	trans	-59.4	-42.6	177.8	-174.3	177.9	179.8	-178.1	0	111.8	A33 A34 S41	A33-K37 PolarHBondContact O-N 3.47Å; A34-K37 PolarHBondContact O-N 3.39Å; K37-S41 WeakPolarHBondContact O-CB 3.32Å; K37-S41 PolarHBondContact O-N 2.98Å; K37-S41 PolarHBondContact O-OG 2.97Å
38	Q	90.6	Very high	87.4	Confident	118 Å²	118	96 Å²	96	55%	0.551	52%	0.515	S	S	*	.	H	α-helix	trans	-62.6	-50.1	176	-173.9	-179.1	-17.3	0	0	111.2	A34 A35 R36 D40 S41 E42	A34-Q38 PolarHBondContact O-N 3.47Å; A35-Q38 PolarHBondContact O-N 3.39Å; R36-Q38 VanDerWaalsContact C-N 3.32Å; R36-Q38 PolarHBondContact O-N 3.4Å; Q38-D40 PolarHBondContact O-N 2.65Å; Q38-S41 PolarHBondContact O-N 3.14Å; Q38-S41 VanDerWaalsContact O-N 3.14Å; Q38-S41 PolarHBondContact O-OG 3.42Å; Q38-E42 WeakPolarHBondContact CG-OE1 3.38Å; Q38-E42 PolarHBondContact NE2-OE1 3.25Å; Q38-E42 WeakPolarHBondContact O-CG 3.33Å; Q38-E42 PolarHBondContact O-N 3.5Å
39	R	88.9	Confident	88.9	Confident	88 Å²	88	96.1 Å²	96.1	33%	0.332	51%	0.509	S	S	.	.	H	α-helix	trans	-57	-46.8	177.2	-173	-164.2	-71.7	165.4	-16.3	112.3	D29 A35 R36 S41 E42 I43	D29-R39 IonicContact OD2-CZ 3.62Å; D29-R39 IonicContact OD2-NH1 2.7Å; D29-R39 PolarHBondContact OD2-NH1 3.48Å; D29-R39 IonicContact OD2-NH2 3.7Å; A35-R39 WeakPolarHBondContact O-CB 3.44Å; A35-R39 PolarHBondContact O-N 2.99Å; R36-R39 PolarHBondContact O-N 3.05Å; R39-S41 VanDerWaalsContact C-N 3.28Å; R39-S41 PolarHBondContact O-N 3.4Å; R39-E42 PolarHBondContact O-N 2.98Å; R39-I43 HydrophobicContact CG-CD1 3.97Å; R39-I43 VanDerWaalsContact O-CG1 3.32Å; R39-I43 WeakPolarHBondContact O-CG1 3.44Å; R39-I43 PolarHBondContact O-N 3.26Å
40	D	91.3	Very high	89.8	Confident	98 Å²	98	98.3 Å²	98.3	52%	0.524	52%	0.515	S	S	.	.	H	α-helix	trans	-63.4	-37.2	179.4	-69.6	-12.3	0	0	0	111.2	R36 Q38 M44	R36-D40 WeakPolarHBondContact O-CB 3.41Å; R36-D40 VanDerWaalsContact O-CG 3.27Å; R36-D40 PolarHBondContact O-N 3.44Å; Q38-D40 PolarHBondContact O-N 2.65Å; D40-M44 WeakPolarHBondContact O-CB 3.45Å; D40-M44 PolarHBondContact O-N 3.03Å
41	S	92.6	Very high	90.7	Very high	51 Å²	51	97 Å²	97	36%	0.357	50%	0.497	S	S	.	.	H	α-helix	trans	-65.9	-40.9	175.4	75.8	0	0	0	0	112.7	K37 Q38 R39 M44 Q45	K37-S41 WeakPolarHBondContact O-CB 3.32Å; K37-S41 PolarHBondContact O-N 2.98Å; K37-S41 PolarHBondContact O-OG 2.97Å; Q38-S41 PolarHBondContact O-N 3.14Å; Q38-S41 VanDerWaalsContact O-N 3.14Å; Q38-S41 PolarHBondContact O-OG 3.42Å; R39-S41 VanDerWaalsContact C-N 3.28Å; R39-S41 PolarHBondContact O-N 3.4Å; S41-M44 PolarHBondContact O-N 2.97Å; S41-Q45 WeakPolarHBondContact O-CG 3.38Å; S41-Q45 PolarHBondContact O-N 3.35Å
42	E	92.5	Very high	91.2	Very high	88 Å²	88	98.8 Å²	98.8	41%	0.411	51%	0.507	S	S	.	.	H	α-helix	trans	-65.6	-44.6	176.8	-71.3	171.5	-167.7	0	0	111.2	Q38 R39 M44 Q45 Q46	Q38-E42 WeakPolarHBondContact CG-OE1 3.38Å; Q38-E42 PolarHBondContact NE2-OE1 3.25Å; Q38-E42 WeakPolarHBondContact O-CG 3.33Å; Q38-E42 PolarHBondContact O-N 3.5Å; R39-E42 PolarHBondContact O-N 2.98Å; E42-M44 VanDerWaalsContact C-N 3.31Å; E42-M44 PolarHBondContact O-N 2.92Å; E42-Q45 PolarHBondContact O-N 3.31Å; E42-Q46 WeakPolarHBondContact O-CG 3.37Å; E42-Q46 PolarHBondContact O-N 2.96Å
43	I	94.2	Very high	91.4	Very high	93 Å²	93	101 Å²	101	48%	0.477	51%	0.509	S	S	.	.	H	α-helix	trans	-60.8	-41.9	175.8	-68.1	169	0	0	0	110.6	R39 Q46 K47	R39-I43 HydrophobicContact CG-CD1 3.97Å; R39-I43 VanDerWaalsContact O-CG1 3.32Å; R39-I43 WeakPolarHBondContact O-CG1 3.44Å; R39-I43 PolarHBondContact O-N 3.26Å; I43-Q46 PolarHBondContact O-N 3.47Å; I43-K47 WeakPolarHBondContact O-CB 3.39Å; I43-K47 PolarHBondContact O-N 2.95Å
44	M	94.5	Very high	91.5	Very high	118 Å²	118	103.5 Å²	103.5	58%	0.581	50%	0.504	S	S	*	.	H	α-helix	trans	-64.7	-45	178.1	-172.7	-179.4	-64	0	0	111.8	D40 S41 E42 K47 Q48	D40-M44 WeakPolarHBondContact O-CB 3.45Å; D40-M44 PolarHBondContact O-N 3.03Å; S41-M44 PolarHBondContact O-N 2.97Å; E42-M44 VanDerWaalsContact C-N 3.31Å; E42-M44 PolarHBondContact O-N 2.92Å; M44-K47 PolarHBondContact O-N 3.45Å; M44-Q48 WeakPolarHBondContact O-CG 3.37Å; M44-Q48 PolarHBondContact O-N 2.93Å
45	Q	93	Very high	91.2	Very high	107 Å²	107	108.1 Å²	108.1	50%	0.5	51%	0.511	S	S	.	.	H	α-helix	trans	-62	-44.1	176.5	-72.8	177.9	17.5	0	0	111.8	S41 E42 K47 Q48 K49	S41-Q45 WeakPolarHBondContact O-CG 3.38Å; S41-Q45 PolarHBondContact O-N 3.35Å; E42-Q45 PolarHBondContact O-N 3.31Å; Q45-K47 VanDerWaalsContact C-N 3.32Å; Q45-K47 PolarHBondContact O-N 3.48Å; Q45-Q48 PolarHBondContact O-N 3.49Å; Q45-K49 WeakPolarHBondContact O-CG 3.26Å; Q45-K49 PolarHBondContact O-N 3.41Å
46	Q	93.8	Very high	90.5	Very high	131 Å²	131	114 Å²	114	61%	0.612	53%	0.534	S	S	*	.	H	α-helix	trans	-61.1	-41.9	175.6	-73.5	178.1	0.9	0	0	111.8	E42 I43 Q48 K49 K50	E42-Q46 WeakPolarHBondContact O-CG 3.37Å; E42-Q46 PolarHBondContact O-N 2.96Å; I43-Q46 PolarHBondContact O-N 3.47Å; Q46-Q48 VanDerWaalsContact C-N 3.34Å; Q46-Q48 PolarHBondContact O-N 3.25Å; Q46-K49 PolarHBondContact O-N 2.88Å; Q46-K50 WeakPolarHBondContact O-CB 3.34Å; Q46-K50 PolarHBondContact O-N 2.92Å
47	K	96	Very high	89.4	Confident	164 Å²	164	116.3 Å²	116.3	71%	0.713	55%	0.548	S	S	*	.	H	α-helix	trans	-63.8	-39.7	176.5	-171.7	178.3	179.8	-177.7	0	111.8	I43 M44 Q45 A51	I43-K47 WeakPolarHBondContact O-CB 3.39Å; I43-K47 PolarHBondContact O-N 2.95Å; M44-K47 PolarHBondContact O-N 3.45Å; Q45-K47 VanDerWaalsContact C-N 3.32Å; Q45-K47 PolarHBondContact O-N 3.48Å; K47-A51 VanDerWaalsContact O-CB 3.25Å; K47-A51 WeakPolarHBondContact O-CB 3.25Å; K47-A51 PolarHBondContact O-N 3.17Å
48	Q	93.6	Very high	88.2	Confident	112 Å²	112	114.2 Å²	114.2	52%	0.523	55%	0.551	S	S	.	*	H	α-helix	trans	-66.3	-46.4	175.6	-73.7	176.5	-2.1	0	0	111.8	M44 Q45 Q46 K50 A51 N52	M44-Q48 WeakPolarHBondContact O-CG 3.37Å; M44-Q48 PolarHBondContact O-N 2.93Å; Q45-Q48 PolarHBondContact O-N 3.49Å; Q46-Q48 VanDerWaalsContact C-N 3.34Å; Q46-Q48 PolarHBondContact O-N 3.25Å; Q48-K50 PolarHBondContact O-N 2.94Å; Q48-A51 PolarHBondContact O-N 3.27Å; Q48-N52 PolarHBondContact O-N 3.29Å
49	K	92.9	Very high	86.8	Confident	134 Å²	134	121.9 Å²	121.9	58%	0.583	58%	0.583	S	S	*	*	H	α-helix	trans	-56.6	-51.3	175	-72.3	179.3	-179.2	-174.8	0	111.4	Q45 Q46 A51 N52 E53	Q45-K49 WeakPolarHBondContact O-CG 3.26Å; Q45-K49 PolarHBondContact O-N 3.41Å; Q46-K49 PolarHBondContact O-N 2.88Å; K49-A51 VanDerWaalsContact C-N 3.27Å; K49-A51 PolarHBondContact O-N 3.17Å; K49-N52 PolarHBondContact O-N 3.33Å; K49-E53 WeakPolarHBondContact O-CG 3.36Å; K49-E53 PolarHBondContact O-N 3.33Å
50	K	92.6	Very high	86.7	Confident	127 Å²	127	123.6 Å²	123.6	55%	0.552	60%	0.596	S	S	*	*	H	α-helix	trans	-61.6	-34	177.4	-170.3	171.2	-171.4	168.3	0	113.1	Q46 Q48 K54	Q46-K50 WeakPolarHBondContact O-CB 3.34Å; Q46-K50 PolarHBondContact O-N 2.92Å; Q48-K50 PolarHBondContact O-N 2.94Å; K50-K54 WeakPolarHBondContact O-CB 3.47Å; K50-K54 VanDerWaalsContact O-CG 3.26Å; K50-K54 WeakPolarHBondContact O-CG 3.33Å; K50-K54 PolarHBondContact O-N 2.92Å
51	A	92.1	Very high	86.5	Confident	44 Å²	44	124.9 Å²	124.9	36%	0.364	60%	0.599	S	S	.	*	H	α-helix	trans	-70.8	-34.5	175.5	0	0	0	0	0	112.1	K47 Q48 K49 K55	K47-A51 VanDerWaalsContact O-CB 3.25Å; K47-A51 WeakPolarHBondContact O-CB 3.25Å; K47-A51 PolarHBondContact O-N 3.17Å; Q48-A51 PolarHBondContact O-N 3.27Å; K49-A51 VanDerWaalsContact C-N 3.27Å; K49-A51 PolarHBondContact O-N 3.17Å; A51-K55 WeakPolarHBondContact O-CG 3.42Å; A51-K55 PolarHBondContact O-N 3.05Å
52	N	90.7	Very high	86.2	Confident	85 Å²	85	129.1 Å²	129.1	46%	0.455	61%	0.613	S	S	.	*	H	α-helix	trans	-73.3	-44	175.3	-69.8	-6.1	0	0	0	111.5	Q48 K49 K54 K55 E56	Q48-N52 PolarHBondContact O-N 3.29Å; K49-N52 PolarHBondContact O-N 3.33Å; N52-K54 VanDerWaalsContact C-N 3.29Å; N52-K54 PolarHBondContact O-N 2.87Å; N52-K55 CarbonylContact O-C 3.57Å; N52-K55 WeakPolarHBondContact O-CA 3.44Å; N52-K55 WeakPolarHBondContact O-CB 3.49Å; N52-K55 PolarHBondContact O-N 2.87Å; N52-E56 WeakPolarHBondContact O-CG 3.4Å; N52-E56 PolarHBondContact O-N 2.92Å
53	E	88.1	Confident	85.8	Confident	118 Å²	118	131.5 Å²	131.5	55%	0.551	63%	0.625	S	S	*	*	H	α-helix	trans	-54.9	-45.6	173.8	-71.9	168.6	173.4	0	0	111.3	K49 K55 E56 E57	K49-E53 WeakPolarHBondContact O-CG 3.36Å; K49-E53 PolarHBondContact O-N 3.33Å; E53-K55 PolarHBondContact O-N 3.25Å; E53-E56 CarbonylContact O-C 3.57Å; E53-E56 PolarHBondContact O-N 2.85Å; E53-E56 VanDerWaalsContact O-N 3.12Å; E53-E57 PolarHBondContact O-N 3.12Å
54	K	86.4	Confident	85.3	Confident	138 Å²	138	133.9 Å²	133.9	60%	0.6	63%	0.634	S	S	*	*	H	α-helix	trans	-64.1	-22.9	175.2	-75.7	-178.5	176	-158.4	0	114.8	K50 N52	K50-K54 WeakPolarHBondContact O-CB 3.47Å; K50-K54 VanDerWaalsContact O-CG 3.26Å; K50-K54 WeakPolarHBondContact O-CG 3.33Å; K50-K54 PolarHBondContact O-N 2.92Å; N52-K54 VanDerWaalsContact C-N 3.29Å; N52-K54 PolarHBondContact O-N 2.87Å
55	K	82.3	Confident	84.7	Confident	168 Å²	168	134.9 Å²	134.9	73%	0.73	64%	0.638	S	S	*	*	H	α-helix	trans	-85.5	-30.6	174.5	-73.9	174.6	178.8	-175.5	0	111.4	A51 N52 E53	A51-K55 WeakPolarHBondContact O-CG 3.42Å; A51-K55 PolarHBondContact O-N 3.05Å; N52-K55 CarbonylContact O-C 3.57Å; N52-K55 WeakPolarHBondContact O-CA 3.44Å; N52-K55 WeakPolarHBondContact O-CB 3.49Å; N52-K55 PolarHBondContact O-N 2.87Å; E53-K55 PolarHBondContact O-N 3.25Å
56	E	74.3	Confident	84.1	Confident	153 Å²	153	136.9 Å²	136.9	72%	0.715	65%	0.647	S	S	*	*	H	α-helix	trans	-83.2	-20.5	178.7	-72.4	-178.5	-177.9	0	0	112.9	N52 E53 P58	N52-E56 WeakPolarHBondContact O-CG 3.4Å; N52-E56 PolarHBondContact O-N 2.92Å; E53-E56 CarbonylContact O-C 3.57Å; E53-E56 PolarHBondContact O-N 2.85Å; E53-E56 VanDerWaalsContact O-N 3.12Å; E56-P58 WeakPolarHBondContact O-CD 3.09Å
57	E	65.1	Low	83.3	Confident	143 Å²	143	137.4 Å²	137.4	67%	0.668	65%	0.65	S	S	*	*	S	Bend	trans	-58.2	108.1	166.2	-82	-178	179.1	0	0	108.8	E53 K59	E53-E57 PolarHBondContact O-N 3.12Å; E57-K59 PolarHBondContact O-N 3.38Å
58	P	67.7	Low	82.3	Confident	120 Å²	120	135.2 Å²	135.2	78%	0.779	65%	0.645	S	S	*	*			trans	-69.4	129.8	175.3	30.8	-30	0	0	0	107.2	E56	E56-P58 WeakPolarHBondContact O-CD 3.09Å
59	K	61.4	Low	81.2	Confident	280 Å²	280	137.3 Å²	137.3	100%	1.217	66%	0.656	S	S	*	*			trans	-58.7	0	166	-81.6	-177.2	174.9	175.6	0	111.3	E57	E57-K59 PolarHBondContact O-N 3.38Å

Retrieved 59 of 59 residues in 248.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).