Q15ES7_SCHMA Loading...

Nuclear nucleic acid-binding protein C1D

Plays a role in the recruitment of the exosome to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA.

AlphaFold DB , UniProt , Accession Q15ES7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 140 aa.

						>Q15ES7_SCHMA|Q15ES7
MVDSSIFDEIPEEISAQLVSFSEATDDVEQLVNKISNFSNDSNTEVSDLDAIKTDLSLCYAFNALFFMYLRCNGVETQSHPIMQELDRVMNALKRCRSLVEKEGSARLKLDKEATTRFVKHALWKSAHTKTKKRRMDSST
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.5	Very low	72.9	Confident	242 Å²	242	116.9 Å²	116.9	100%	1.192	62%	0.622	S	S	*	*				0	103.6	0	-151.6	162.3	177.7	0	0	103.5	D3	M1-D3 PolarHBondContact O-N 3.04Å
2	V	60.3	Low	74	Confident	133 Å²	133	120.8 Å²	120.8	81%	0.806	63%	0.634	S	S	*	*			trans	-60.6	114.4	175.1	178.6	0	0	0	0	103.5	S4	V2-S4 PolarHBondContact O-N 3.45Å
3	D	62.5	Low	75.2	Confident	155 Å²	155	121.8 Å²	121.8	83%	0.829	63%	0.634	S	S	*	*			trans	-61.5	93.5	168.8	-145.1	2.3	0	0	0	102.7	M1 S5	M1-D3 PolarHBondContact O-N 3.04Å; D3-S5 PolarHBondContact O-N 3.39Å
4	S	62.1	Low	76.3	Confident	54 Å²	54	118.6 Å²	118.6	38%	0.378	62%	0.617	S	S	.	*			trans	-54.6	115.9	172.6	40.7	0	0	0	0	103.2	V2 I6 E9	V2-S4 PolarHBondContact O-N 3.45Å; S4-I6 PolarHBondContact O-N 2.88Å; S4-E9 PolarHBondContact OG-OE1 2.81Å; S4-E9 VanDerWaalsContact OG-OE1 3.04Å
5	S	76.4	Confident	77.2	Confident	48 Å²	48	114 Å²	114	34%	0.336	60%	0.598	S	S	.	*			trans	-53.8	135.5	177.5	-176.6	0	0	0	0	105.4	D3 F7 D8	D3-S5 PolarHBondContact O-N 3.39Å; S5-F7 PolarHBondContact O-N 3.49Å; S5-F7 VanDerWaalsContact OG-CD2 3.32Å; S5-F7 WeakPolarHBondContact OG-CD2 3.47Å; S5-D8 WeakPolarHBondContact CB-OD2 3.39Å; S5-D8 PolarHBondContact N-OD2 3.44Å; S5-D8 WeakPolarHBondContact O-CA 3.36Å; S5-D8 WeakPolarHBondContact O-CB 3.48Å; S5-D8 PolarHBondContact O-N 2.72Å
6	I	78.7	Confident	78.1	Confident	126 Å²	126	110.6 Å²	110.6	65%	0.646	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.9	-26.2	174.3	-171.2	169.1	0	0	0	111	S4 E9 I10	S4-I6 PolarHBondContact O-N 2.88Å; I6-E9 PolarHBondContact O-N 3.03Å; I6-I10 WeakPolarHBondContact O-CG1 3.38Å
7	F	74	Confident	78.9	Confident	150 Å²	150	111.2 Å²	111.2	66%	0.658	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.3	-30.6	173.2	-62.7	-77.7	0	0	0	115	S5 E9 I10	S5-F7 PolarHBondContact O-N 3.49Å; S5-F7 VanDerWaalsContact OG-CD2 3.32Å; S5-F7 WeakPolarHBondContact OG-CD2 3.47Å; F7-E9 PolarHBondContact O-N 2.94Å; F7-I10 HydrophobicContact CD1-CD1 4.12Å; F7-I10 PolarHBondContact O-N 3.04Å
8	D	81.7	Confident	79.6	Confident	121 Å²	121	109.8 Å²	109.8	65%	0.647	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.4	-20.8	177.2	-61.5	-30.6	0	0	0	112.1	S5	S5-D8 WeakPolarHBondContact CB-OD2 3.39Å; S5-D8 PolarHBondContact N-OD2 3.44Å; S5-D8 WeakPolarHBondContact O-CA 3.36Å; S5-D8 WeakPolarHBondContact O-CB 3.48Å; S5-D8 PolarHBondContact O-N 2.72Å
9	E	85.8	Confident	80.3	Confident	139 Å²	139	108.4 Å²	108.4	65%	0.65	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.2	-9.7	178.2	-66.3	-178.8	-170.2	0	0	113.2	S4 I6 F7 P11	S4-E9 PolarHBondContact OG-OE1 2.81Å; S4-E9 VanDerWaalsContact OG-OE1 3.04Å; I6-E9 PolarHBondContact O-N 3.03Å; F7-E9 PolarHBondContact O-N 2.94Å; E9-P11 WeakPolarHBondContact O-CD 3.38Å
10	I	84.7	Confident	81	Confident	45 Å²	45	106.1 Å²	106.1	23%	0.231	57%	0.571	C	S	.	*	S	Bend	trans	-78.5	125.1	-178.5	-62.9	174.6	0	0	0	109.2	I6 F7 I14 L18	I6-I10 WeakPolarHBondContact O-CG1 3.38Å; F7-I10 HydrophobicContact CD1-CD1 4.12Å; F7-I10 PolarHBondContact O-N 3.04Å; I10-I14 HydrophobicContact CG2-CB 3.64Å; I10-I14 HydrophobicContact CG2-CG2 3.63Å; I10-L18 HydrophobicContact CD1-CD1 4.06Å; I10-L18 HydrophobicContact CG2-CD1 4.43Å
11	P	91.2	Very high	81.6	Confident	73 Å²	73	105.8 Å²	105.8	47%	0.474	57%	0.565	S	S	.	*			trans	-55	143.7	172.8	-24.8	33.9	0	0	0	112.2	E9 E13 I14 S15	E9-P11 WeakPolarHBondContact O-CD 3.38Å; P11-E13 PolarHBondContact O-N 2.98Å; P11-E13 VanDerWaalsContact O-N 3.13Å; P11-I14 HydrophobicContact CB-CG1 4.24Å; P11-I14 HydrophobicContact CG-CG1 4.35Å; P11-I14 WeakPolarHBondContact O-CB 3.12Å; P11-I14 PolarHBondContact O-N 3.1Å; P11-S15 PolarHBondContact O-N 2.92Å
12	E	86.7	Confident	84	Confident	163 Å²	163	97.3 Å²	97.3	76%	0.762	53%	0.529	S	S	*	.	H	α-helix	trans	-56	-33.4	-177.1	-67.9	-175.8	179.9	0	0	112.8	I14 S15 A16	E12-I14 VanDerWaalsContact C-N 3.31Å; E12-I14 PolarHBondContact O-N 3.43Å; E12-S15 WeakPolarHBondContact CA-OG 3.45Å; E12-S15 PolarHBondContact O-N 3.22Å; E12-S15 PolarHBondContact O-OG 3.22Å; E12-A16 WeakPolarHBondContact O-CB 3.34Å; E12-A16 PolarHBondContact O-N 3.34Å
13	E	88.6	Confident	85.7	Confident	135 Å²	135	96.5 Å²	96.5	63%	0.631	52%	0.517	S	S	*	.	H	α-helix	trans	-66.5	-34.8	177.3	-59.5	82.5	178.5	0	0	112.3	P11 Q17	P11-E13 PolarHBondContact O-N 2.98Å; P11-E13 VanDerWaalsContact O-N 3.13Å; E13-Q17 WeakPolarHBondContact O-CG 3.5Å; E13-Q17 PolarHBondContact O-N 3.36Å
14	I	91	Very high	87.3	Confident	77 Å²	77	91.5 Å²	91.5	40%	0.395	50%	0.497	S	S	.	.	H	α-helix	trans	-77.6	-39.8	178.3	-58.1	-59.5	0	0	0	110	I10 P11 E12 A16 Q17 L18	I10-I14 HydrophobicContact CG2-CB 3.64Å; I10-I14 HydrophobicContact CG2-CG2 3.63Å; P11-I14 HydrophobicContact CB-CG1 4.24Å; P11-I14 HydrophobicContact CG-CG1 4.35Å; P11-I14 WeakPolarHBondContact O-CB 3.12Å; P11-I14 PolarHBondContact O-N 3.1Å; E12-I14 VanDerWaalsContact C-N 3.31Å; E12-I14 PolarHBondContact O-N 3.43Å; I14-A16 VanDerWaalsContact C-N 3.31Å; I14-A16 PolarHBondContact O-N 3.06Å; I14-Q17 WeakPolarHBondContact O-CB 3.33Å; I14-Q17 PolarHBondContact O-N 3.02Å; I14-Q17 VanDerWaalsContact O-N 3.16Å; I14-L18 HydrophobicContact CG2-CD1 4.2Å; I14-L18 HydrophobicContact CG2-CG 4.35Å; I14-L18 WeakPolarHBondContact O-CG 3.5Å; I14-L18 PolarHBondContact O-N 3.44Å
15	S	89.8	Confident	88.8	Confident	49 Å²	49	92 Å²	92	34%	0.343	50%	0.497	S	S	.	.	H	α-helix	trans	-62	-40.8	177.1	70.4	0	0	0	0	111.5	P11 E12 Q17 L18 V19	P11-S15 PolarHBondContact O-N 2.92Å; E12-S15 WeakPolarHBondContact CA-OG 3.45Å; E12-S15 PolarHBondContact O-N 3.22Å; E12-S15 PolarHBondContact O-OG 3.22Å; S15-Q17 PolarHBondContact O-N 2.89Å; S15-L18 PolarHBondContact O-N 3.3Å; S15-V19 WeakPolarHBondContact O-CG2 3.32Å; S15-V19 PolarHBondContact O-N 3.13Å
16	A	91.2	Very high	89.7	Confident	60 Å²	60	93.2 Å²	93.2	50%	0.496	50%	0.501	S	S	.	.	H	α-helix	trans	-60.8	-41.7	173.2	0	0	0	0	0	112.6	E12 I14 V19 S20	E12-A16 WeakPolarHBondContact O-CB 3.34Å; E12-A16 PolarHBondContact O-N 3.34Å; I14-A16 VanDerWaalsContact C-N 3.31Å; I14-A16 PolarHBondContact O-N 3.06Å; A16-V19 PolarHBondContact O-N 2.91Å; A16-S20 PolarHBondContact O-N 3.44Å
17	Q	92.6	Very high	90.5	Very high	120 Å²	120	92.2 Å²	92.2	56%	0.561	50%	0.497	S	S	*	.	H	α-helix	trans	-64.1	-41.3	175.2	-73	174.4	12.9	0	0	111.9	E13 I14 S15 S20 F21	E13-Q17 WeakPolarHBondContact O-CG 3.5Å; E13-Q17 PolarHBondContact O-N 3.36Å; I14-Q17 WeakPolarHBondContact O-CB 3.33Å; I14-Q17 PolarHBondContact O-N 3.02Å; I14-Q17 VanDerWaalsContact O-N 3.16Å; S15-Q17 PolarHBondContact O-N 2.89Å; Q17-S20 PolarHBondContact O-N 3.33Å; Q17-S20 PolarHBondContact O-OG 2.9Å; Q17-F21 WeakPolarHBondContact O-CB 3.48Å; Q17-F21 PolarHBondContact O-N 3.28Å
18	L	91.8	Very high	91.4	Very high	86 Å²	86	87.7 Å²	87.7	45%	0.45	48%	0.481	S	S	.	.	H	α-helix	trans	-63.4	-41.6	177.4	-70.2	173	0	0	0	112	I10 I14 S15 F21 S22	I10-L18 HydrophobicContact CD1-CD1 4.06Å; I10-L18 HydrophobicContact CG2-CD1 4.43Å; I14-L18 HydrophobicContact CG2-CD1 4.2Å; I14-L18 HydrophobicContact CG2-CG 4.35Å; I14-L18 WeakPolarHBondContact O-CG 3.5Å; I14-L18 PolarHBondContact O-N 3.44Å; S15-L18 PolarHBondContact O-N 3.3Å; L18-F21 PolarHBondContact O-N 3.43Å; L18-S22 PolarHBondContact O-N 3.39Å
19	V	92.9	Very high	91.9	Very high	83 Å²	83	87.4 Å²	87.4	50%	0.503	48%	0.476	S	S	.	.	H	α-helix	trans	-60.2	-50.7	173.9	172.7	0	0	0	0	110	S15 A16 F21 S22 E23	S15-V19 WeakPolarHBondContact O-CG2 3.32Å; S15-V19 PolarHBondContact O-N 3.13Å; A16-V19 PolarHBondContact O-N 2.91Å; V19-F21 VanDerWaalsContact C-N 3.26Å; V19-F21 PolarHBondContact O-N 3.1Å; V19-S22 WeakPolarHBondContact O-CB 3.33Å; V19-S22 PolarHBondContact O-N 3.08Å; V19-S22 VanDerWaalsContact O-N 3.13Å; V19-E23 HydrophobicContact CG1-CG 4.49Å; V19-E23 WeakPolarHBondContact O-CG 3.4Å; V19-E23 PolarHBondContact O-N 3.36Å
20	S	94.3	Very high	92.3	Very high	63 Å²	63	86.1 Å²	86.1	44%	0.441	47%	0.47	S	S	.	.	H	α-helix	trans	-61.6	-33.8	179.4	73.1	0	0	0	0	113.3	A16 Q17 A24	A16-S20 PolarHBondContact O-N 3.44Å; Q17-S20 PolarHBondContact O-N 3.33Å; Q17-S20 PolarHBondContact O-OG 2.9Å; S20-A24 WeakPolarHBondContact O-CB 3.38Å; S20-A24 PolarHBondContact O-N 3.23Å
21	F	94	Very high	92.6	Very high	100 Å²	100	88.9 Å²	88.9	44%	0.439	48%	0.484	S	S	.	.	H	α-helix	trans	-71.3	-38.9	176.5	-179.6	-100.4	0	0	0	112	Q17 L18 V19 T25	Q17-F21 WeakPolarHBondContact O-CB 3.48Å; Q17-F21 PolarHBondContact O-N 3.28Å; L18-F21 PolarHBondContact O-N 3.43Å; V19-F21 VanDerWaalsContact C-N 3.26Å; V19-F21 PolarHBondContact O-N 3.1Å; F21-T25 WeakPolarHBondContact O-CB 3.13Å; F21-T25 PolarHBondContact O-N 3Å; F21-T25 PolarHBondContact O-OG1 3.12Å
22	S	93.9	Very high	92.5	Very high	63 Å²	63	87.5 Å²	87.5	44%	0.441	48%	0.475	S	S	.	.	H	α-helix	trans	-61.9	-50.9	173.5	-168.6	0	0	0	0	110.7	L18 V19 A24 T25 D26	L18-S22 PolarHBondContact O-N 3.39Å; V19-S22 WeakPolarHBondContact O-CB 3.33Å; V19-S22 PolarHBondContact O-N 3.08Å; V19-S22 VanDerWaalsContact O-N 3.13Å; S22-A24 VanDerWaalsContact C-N 3.31Å; S22-A24 PolarHBondContact O-N 3.08Å; S22-T25 WeakPolarHBondContact O-CB 3.39Å; S22-T25 PolarHBondContact O-N 2.78Å; S22-D26 PolarHBondContact O-N 3.42Å
23	E	96.9	Very high	92.6	Very high	117 Å²	117	83.6 Å²	83.6	55%	0.547	46%	0.459	S	S	.	.	H	α-helix	trans	-57.1	-45	177.8	-70	175.9	171.6	0	0	111.5	V19 T25 D26 D27	V19-E23 HydrophobicContact CG1-CG 4.49Å; V19-E23 WeakPolarHBondContact O-CG 3.4Å; V19-E23 PolarHBondContact O-N 3.36Å; E23-T25 VanDerWaalsContact C-N 3.28Å; E23-T25 PolarHBondContact O-N 3.01Å; E23-D26 PolarHBondContact O-N 3.18Å; E23-D27 PolarHBondContact O-N 3.16Å
24	A	95.1	Very high	92.6	Very high	50 Å²	50	84.2 Å²	84.2	41%	0.413	46%	0.46	S	S	.	.	H	α-helix	trans	-63.6	-33.3	176.8	0	0	0	0	0	112.9	S20 S22 V28	S20-A24 WeakPolarHBondContact O-CB 3.38Å; S20-A24 PolarHBondContact O-N 3.23Å; S22-A24 VanDerWaalsContact C-N 3.31Å; S22-A24 PolarHBondContact O-N 3.08Å; A24-V28 VanDerWaalsContact O-CG2 3.31Å; A24-V28 WeakPolarHBondContact O-CG2 3.27Å; A24-V28 PolarHBondContact O-N 3.43Å
25	T	93.5	Very high	92.3	Very high	63 Å²	63	83.6 Å²	83.6	39%	0.387	46%	0.457	S	S	.	.	H	α-helix	trans	-71.4	-42.9	176.8	-57.3	0	0	0	0	110.8	F21 S22 E23 D27 V28 E29	F21-T25 WeakPolarHBondContact O-CB 3.13Å; F21-T25 PolarHBondContact O-N 3Å; F21-T25 PolarHBondContact O-OG1 3.12Å; S22-T25 WeakPolarHBondContact O-CB 3.39Å; S22-T25 PolarHBondContact O-N 2.78Å; E23-T25 VanDerWaalsContact C-N 3.28Å; E23-T25 PolarHBondContact O-N 3.01Å; T25-D27 VanDerWaalsContact C-N 3.32Å; T25-D27 PolarHBondContact O-N 3.45Å; T25-V28 PolarHBondContact O-N 2.97Å; T25-E29 PolarHBondContact O-N 2.76Å
26	D	96.1	Very high	92	Very high	75 Å²	75	84.2 Å²	84.2	40%	0.401	46%	0.461	S	S	.	.	H	α-helix	trans	-61.3	-41.3	175.9	-66.3	-20.5	0	0	0	111.2	S22 E23 V28 E29 Q30	S22-D26 PolarHBondContact O-N 3.42Å; E23-D26 PolarHBondContact O-N 3.18Å; D26-V28 PolarHBondContact O-N 3.23Å; D26-E29 PolarHBondContact O-N 2.94Å; D26-Q30 WeakPolarHBondContact O-CG 3.15Å; D26-Q30 PolarHBondContact O-N 3.16Å
27	D	95.6	Very high	91.7	Very high	105 Å²	105	86.4 Å²	86.4	56%	0.561	46%	0.464	S	S	*	.	H	α-helix	trans	-61.1	-42.9	175.7	-79.1	-15.6	0	0	0	112.1	E23 T25 Q30 L31	E23-D27 PolarHBondContact O-N 3.16Å; T25-D27 VanDerWaalsContact C-N 3.32Å; T25-D27 PolarHBondContact O-N 3.45Å; D27-Q30 PolarHBondContact O-N 3.03Å; D27-L31 WeakPolarHBondContact O-CB 3.3Å; D27-L31 PolarHBondContact O-N 3.43Å
28	V	92.4	Very high	91.1	Very high	55 Å²	55	86.6 Å²	86.6	33%	0.333	46%	0.463	S	S	.	.	H	α-helix	trans	-66.1	-42.6	177	173.4	0	0	0	0	110.8	A24 T25 D26 Q30 L31 V32 L65	A24-V28 VanDerWaalsContact O-CG2 3.31Å; A24-V28 WeakPolarHBondContact O-CG2 3.27Å; A24-V28 PolarHBondContact O-N 3.43Å; T25-V28 PolarHBondContact O-N 2.97Å; D26-V28 PolarHBondContact O-N 3.23Å; V28-Q30 PolarHBondContact O-N 2.88Å; V28-L31 PolarHBondContact O-N 3.27Å; V28-V32 HydrophobicContact CG1-CG2 4.31Å; V28-V32 WeakPolarHBondContact O-CG2 3.42Å; V28-V32 PolarHBondContact O-N 3.34Å; V28-L65 HydrophobicContact CG1-CD1 3.99Å; V28-L65 HydrophobicContact CG1-CD2 4.1Å; V28-L65 HydrophobicContact CG1-CG 4.49Å
29	E	92.6	Very high	90.1	Very high	115 Å²	115	86.6 Å²	86.6	54%	0.537	47%	0.471	S	S	.	.	H	α-helix	trans	-59.4	-46.5	176.1	-178.4	175	-175.4	0	0	111.4	T25 D26 L31 V32 N33	T25-E29 PolarHBondContact O-N 2.76Å; D26-E29 PolarHBondContact O-N 2.94Å; E29-L31 VanDerWaalsContact C-N 3.31Å; E29-L31 PolarHBondContact O-N 3.38Å; E29-V32 PolarHBondContact O-N 2.89Å; E29-N33 WeakPolarHBondContact O-CB 3.4Å; E29-N33 VanDerWaalsContact O-CG 3.3Å; E29-N33 PolarHBondContact O-N 2.92Å; E29-N33 PolarHBondContact O-ND2 3.32Å
30	Q	94.4	Very high	89	Confident	111 Å²	111	88.8 Å²	88.8	52%	0.519	48%	0.479	S	S	.	.	H	α-helix	trans	-60.3	-40.4	176.4	-72.2	178.5	37	0	0	112.5	D26 D27 V28 N33 K34	D26-Q30 WeakPolarHBondContact O-CG 3.15Å; D26-Q30 PolarHBondContact O-N 3.16Å; D27-Q30 PolarHBondContact O-N 3.03Å; V28-Q30 PolarHBondContact O-N 2.88Å; Q30-N33 PolarHBondContact O-N 3.32Å; Q30-K34 PolarHBondContact O-N 2.93Å
31	L	90.7	Very high	87.8	Confident	103 Å²	103	92.7 Å²	92.7	54%	0.539	50%	0.495	S	S	.	.	H	α-helix	trans	-64.7	-46.2	177.3	-177.2	65.8	0	0	0	111.6	D27 V28 E29 N33 K34 I35	D27-L31 WeakPolarHBondContact O-CB 3.3Å; D27-L31 PolarHBondContact O-N 3.43Å; V28-L31 PolarHBondContact O-N 3.27Å; E29-L31 VanDerWaalsContact C-N 3.31Å; E29-L31 PolarHBondContact O-N 3.38Å; L31-N33 VanDerWaalsContact C-N 3.32Å; L31-N33 PolarHBondContact O-N 3.12Å; L31-K34 WeakPolarHBondContact O-CB 3.5Å; L31-K34 PolarHBondContact O-N 3.49Å; L31-I35 HydrophobicContact CG-CD1 4.16Å; L31-I35 WeakPolarHBondContact O-CG1 3.41Å; L31-I35 PolarHBondContact O-N 3.24Å
32	V	88.2	Confident	86.3	Confident	45 Å²	45	89.9 Å²	89.9	27%	0.273	49%	0.488	S	S	.	.	H	α-helix	trans	-61.6	-42.8	178	172.3	0	0	0	0	110.6	V28 E29 K34 I35 S36	V28-V32 HydrophobicContact CG1-CG2 4.31Å; V28-V32 WeakPolarHBondContact O-CG2 3.42Å; V28-V32 PolarHBondContact O-N 3.34Å; E29-V32 PolarHBondContact O-N 2.89Å; V32-K34 PolarHBondContact O-N 3.49Å; V32-I35 PolarHBondContact O-N 3.5Å; V32-S36 PolarHBondContact O-N 3.25Å
33	N	89.5	Confident	84.9	Confident	80 Å²	80	95.2 Å²	95.2	43%	0.428	51%	0.511	S	S	.	.	H	α-helix	trans	-62	-40.5	176.3	-74.9	-30.4	0	0	0	112.3	E29 Q30 L31 S36 N37	E29-N33 WeakPolarHBondContact O-CB 3.4Å; E29-N33 VanDerWaalsContact O-CG 3.3Å; E29-N33 PolarHBondContact O-N 2.92Å; E29-N33 PolarHBondContact O-ND2 3.32Å; Q30-N33 PolarHBondContact O-N 3.32Å; L31-N33 VanDerWaalsContact C-N 3.32Å; L31-N33 PolarHBondContact O-N 3.12Å; N33-S36 PolarHBondContact O-N 3.41Å; N33-N37 WeakPolarHBondContact O-CB 3.35Å; N33-N37 VanDerWaalsContact O-CG 3.26Å; N33-N37 PolarHBondContact O-N 2.86Å; N33-N37 PolarHBondContact O-ND2 2.84Å
34	K	88.8	Confident	83.4	Confident	149 Å²	149	93.5 Å²	93.5	65%	0.648	51%	0.509	S	S	*	.	H	α-helix	trans	-60.7	-45.1	173.3	-85.9	176.5	177.7	167.1	0	112.4	Q30 L31 V32 N37 F38	Q30-K34 PolarHBondContact O-N 2.93Å; L31-K34 WeakPolarHBondContact O-CB 3.5Å; L31-K34 PolarHBondContact O-N 3.49Å; V32-K34 PolarHBondContact O-N 3.49Å; K34-N37 PolarHBondContact O-N 3.44Å; K34-F38 WeakPolarHBondContact O-CB 3.31Å; K34-F38 PolarHBondContact O-N 2.96Å
35	I	84.7	Confident	82.3	Confident	64 Å²	64	100.6 Å²	100.6	33%	0.328	53%	0.534	S	S	.	.	H	α-helix	trans	-64.5	-43.6	179.8	-65.7	165.9	0	0	0	110.5	L31 V32 N37 F38 S39	L31-I35 HydrophobicContact CG-CD1 4.16Å; L31-I35 WeakPolarHBondContact O-CG1 3.41Å; L31-I35 PolarHBondContact O-N 3.24Å; V32-I35 PolarHBondContact O-N 3.5Å; I35-N37 PolarHBondContact O-N 2.86Å; I35-F38 PolarHBondContact O-N 3.03Å; I35-S39 PolarHBondContact O-N 2.88Å; I35-S39 VanDerWaalsContact O-N 3.08Å
36	S	83.7	Confident	81.5	Confident	62 Å²	62	100.8 Å²	100.8	43%	0.434	54%	0.535	S	S	.	.	H	α-helix	trans	-61.5	-43.8	177.9	-174.5	0	0	0	0	112	V32 N33 S39 N40	V32-S36 PolarHBondContact O-N 3.25Å; N33-S36 PolarHBondContact O-N 3.41Å; S36-S39 PolarHBondContact O-N 3.48Å; S36-N40 PolarHBondContact O-N 3.49Å; S36-N40 PolarHBondContact O-ND2 3.28Å
37	N	84.9	Confident	81	Confident	106 Å²	106	100.7 Å²	100.7	57%	0.567	54%	0.54	S	S	*	.	H	α-helix	trans	-66.6	-38.7	177.2	-70.2	-26	0	0	0	112.6	N33 K34 I35 S39 N40 D41	N33-N37 WeakPolarHBondContact O-CB 3.35Å; N33-N37 VanDerWaalsContact O-CG 3.26Å; N33-N37 PolarHBondContact O-N 2.86Å; N33-N37 PolarHBondContact O-ND2 2.84Å; K34-N37 PolarHBondContact O-N 3.44Å; I35-N37 PolarHBondContact O-N 2.86Å; N37-S39 PolarHBondContact O-N 3.49Å; N37-N40 PolarHBondContact O-N 2.94Å; N37-D41 PolarHBondContact O-N 3.43Å
38	F	80	Confident	80.5	Confident	124 Å²	124	102.2 Å²	102.2	54%	0.544	55%	0.548	S	S	.	.	H	α-helix	trans	-61.5	-43.6	176.4	-176.6	-97.1	0	0	0	111.9	K34 I35 N40 D41 S42	K34-F38 WeakPolarHBondContact O-CB 3.31Å; K34-F38 PolarHBondContact O-N 2.96Å; I35-F38 PolarHBondContact O-N 3.03Å; F38-N40 PolarHBondContact O-N 3.36Å; F38-D41 PolarHBondContact O-N 3.37Å; F38-S42 WeakPolarHBondContact O-CB 3.36Å; F38-S42 PolarHBondContact O-N 2.94Å; F38-S42 PolarHBondContact O-OG 2.96Å
39	S	70	Confident	80.3	Confident	86 Å²	86	101.5 Å²	101.5	60%	0.601	54%	0.542	S	S	*	.	H	α-helix	trans	-62.9	-25.4	179.3	-172.9	0	0	0	0	113.7	I35 S36 N37	I35-S39 PolarHBondContact O-N 2.88Å; I35-S39 VanDerWaalsContact O-N 3.08Å; S36-S39 PolarHBondContact O-N 3.48Å; N37-S39 PolarHBondContact O-N 3.49Å
40	N	70	Confident	80.1	Confident	128 Å²	128	99.3 Å²	99.3	68%	0.684	53%	0.534	S	S	*	.	H	α-helix	trans	-82.9	-24.3	179.6	-66.2	-31.3	0	0	0	112.9	S36 N37 F38	S36-N40 PolarHBondContact O-N 3.49Å; S36-N40 PolarHBondContact O-ND2 3.28Å; N37-N40 PolarHBondContact O-N 2.94Å; F38-N40 PolarHBondContact O-N 3.36Å
41	D	68.1	Low	79.8	Confident	146 Å²	146	95.7 Å²	95.7	78%	0.781	52%	0.523	S	S	*	.	H	α-helix	trans	-97.6	-20.2	-172.7	-161.6	20.5	0	0	0	112.6	N37 F38 N43	N37-D41 PolarHBondContact O-N 3.43Å; F38-D41 PolarHBondContact O-N 3.37Å; D41-N43 PolarHBondContact O-N 3.48Å
42	S	63.3	Low	79.8	Confident	40 Å²	40	95 Å²	95	28%	0.28	52%	0.519	S	S	.	.			trans	-94	101.8	-163.2	78.4	0	0	0	0	114	F38 T44	F38-S42 WeakPolarHBondContact O-CB 3.36Å; F38-S42 PolarHBondContact O-N 2.94Å; F38-S42 PolarHBondContact O-OG 2.96Å; S42-T44 VanDerWaalsContact CB-OG1 3.3Å; S42-T44 WeakPolarHBondContact CB-OG1 3.49Å; S42-T44 PolarHBondContact O-N 3.27Å
43	N	64.1	Low	79.9	Confident	175 Å²	175	96.4 Å²	96.4	94%	0.936	52%	0.522	S	S	*	.			trans	-75.4	17.6	151	-82.6	-32.2	0	0	0	111.7	D41 E45	D41-N43 PolarHBondContact O-N 3.48Å; N43-E45 PolarHBondContact O-N 3.34Å
44	T	66.5	Low	79.9	Confident	82 Å²	82	96 Å²	96	50%	0.503	52%	0.522	S	S	.	.			trans	-77.7	125	-176.9	52	0	0	0	0	110.3	S42 V46	S42-T44 VanDerWaalsContact CB-OG1 3.3Å; S42-T44 WeakPolarHBondContact CB-OG1 3.49Å; S42-T44 PolarHBondContact O-N 3.27Å; T44-V46 VanDerWaalsContact C-N 3.33Å; T44-V46 PolarHBondContact O-N 3.29Å
45	E	71.1	Confident	80	Confident	199 Å²	199	94 Å²	94	93%	0.93	52%	0.519	S	S	*	.			trans	-62.1	95	165.3	-65.2	-178.6	172.6	0	0	108.8	N43	N43-E45 PolarHBondContact O-N 3.34Å
46	V	76.9	Confident	80.5	Confident	67 Å²	67	92.5 Å²	92.5	41%	0.406	51%	0.511	S	S	.	.			trans	-77.9	136.6	169.3	-173.8	0	0	0	0	107.3	T44 D48 D50 A51	T44-V46 VanDerWaalsContact C-N 3.33Å; T44-V46 PolarHBondContact O-N 3.29Å; V46-D48 PolarHBondContact O-N 3.03Å; V46-D50 HydrophobicContact CG1-CB 3.78Å; V46-A51 HydrophobicContact CG1-CB 4.31Å
47	S	84.6	Confident	80.8	Confident	72 Å²	72	92.7 Å²	92.7	50%	0.503	51%	0.513	S	S	.	.			trans	-56.1	136.3	171.2	177.8	0	0	0	0	109.8	L49 D50 A51	S47-L49 PolarHBondContact O-N 2.95Å; S47-D50 PolarHBondContact O-N 3.13Å; S47-A51 PolarHBondContact O-N 2.8Å
48	D	86.9	Confident	81.1	Confident	137 Å²	137	89.9 Å²	89.9	73%	0.733	50%	0.497	S	S	*	.	H	α-helix	trans	-46.1	-38.2	178.1	-64.5	-17.4	0	0	0	112.4	V46 I52	V46-D48 PolarHBondContact O-N 3.03Å; D48-I52 WeakPolarHBondContact O-CD1 3.42Å; D48-I52 WeakPolarHBondContact O-CG1 3.41Å; D48-I52 PolarHBondContact O-N 3.36Å
49	L	87.7	Confident	81.8	Confident	40 Å²	40	85.9 Å²	85.9	21%	0.209	48%	0.484	C	S	.	.	H	α-helix	trans	-72.1	-36.8	-178.7	-178.4	150.3	0	0	0	112.8	S47 K53 V100 E103	S47-L49 PolarHBondContact O-N 2.95Å; L49-K53 HydrophobicContact CD2-CD 4.09Å; L49-K53 WeakPolarHBondContact O-CG 3.37Å; L49-K53 PolarHBondContact O-N 3.02Å; L49-V100 HydrophobicContact CD1-CG2 4.01Å; L49-V100 HydrophobicContact CD2-CG2 4.04Å; L49-V100 HydrophobicContact CG-CG2 4.21Å; L49-E103 WeakPolarHBondContact CD1-OE2 3.17Å
50	D	87	Confident	83	Confident	69 Å²	69	87.1 Å²	87.1	37%	0.369	48%	0.476	S	S	.	.	H	α-helix	trans	-76.1	-31.8	176.8	-70.8	-26.1	0	0	0	111.7	V46 S47 K53 T54	V46-D50 HydrophobicContact CG1-CB 3.78Å; S47-D50 PolarHBondContact O-N 3.13Å; D50-K53 PolarHBondContact O-N 3Å; D50-K53 IonicContact OD1-NZ 2.75Å; D50-K53 PolarHBondContact OD1-NZ 2.92Å; D50-T54 WeakPolarHBondContact O-CB 3.46Å; D50-T54 PolarHBondContact O-N 2.85Å; D50-T54 PolarHBondContact O-OG1 3.27Å
51	A	88.2	Confident	84.1	Confident	36 Å²	36	82.7 Å²	82.7	30%	0.298	46%	0.458	S	S	.	.	H	α-helix	trans	-60.3	-50.8	168.7	0	0	0	0	0	110.8	V46 S47 K53 T54 D55	V46-A51 HydrophobicContact CG1-CB 4.31Å; S47-A51 PolarHBondContact O-N 2.8Å; A51-K53 VanDerWaalsContact C-N 3.33Å; A51-K53 PolarHBondContact O-N 3.36Å; A51-T54 PolarHBondContact O-N 3.27Å; A51-T54 VanDerWaalsContact O-N 3.09Å; A51-D55 PolarHBondContact O-N 3.42Å
52	I	91.4	Very high	85.3	Confident	88 Å²	88	80.8 Å²	80.8	45%	0.451	44%	0.443	S	S	.	.	H	α-helix	trans	-58.7	-42.3	177.6	-68.6	165.5	0	0	0	112	D48 T54 L56	D48-I52 WeakPolarHBondContact O-CD1 3.42Å; D48-I52 WeakPolarHBondContact O-CG1 3.41Å; D48-I52 PolarHBondContact O-N 3.36Å; I52-T54 VanDerWaalsContact C-N 3.34Å; I52-L56 HydrophobicContact CG2-CD1 3.85Å; I52-L56 HydrophobicContact CG2-CG 4.36Å; I52-L56 WeakPolarHBondContact O-CB 3.31Å; I52-L56 VanDerWaalsContact O-CG 3.27Å; I52-L56 WeakPolarHBondContact O-CG 3.5Å; I52-L56 PolarHBondContact O-N 2.87Å
53	K	91	Very high	86.8	Confident	74 Å²	74	80.2 Å²	80.2	32%	0.322	44%	0.437	S	S	.	.	H	α-helix	trans	-61.6	-43.9	176.1	-75.9	173.8	-170.5	153.8	0	111.6	L49 D50 A51 S57	L49-K53 HydrophobicContact CD2-CD 4.09Å; L49-K53 WeakPolarHBondContact O-CG 3.37Å; L49-K53 PolarHBondContact O-N 3.02Å; D50-K53 PolarHBondContact O-N 3Å; D50-K53 IonicContact OD1-NZ 2.75Å; D50-K53 PolarHBondContact OD1-NZ 2.92Å; A51-K53 VanDerWaalsContact C-N 3.33Å; A51-K53 PolarHBondContact O-N 3.36Å; K53-S57 VanDerWaalsContact O-CB 3.3Å; K53-S57 WeakPolarHBondContact O-CB 3.34Å; K53-S57 PolarHBondContact O-N 3.05Å; K53-S57 PolarHBondContact O-OG 3.42Å
54	T	88.8	Confident	88.2	Confident	72 Å²	72	72.6 Å²	72.6	44%	0.442	40%	0.398	S	S	.	.	H	α-helix	trans	-64.3	-49.2	-178.7	-56.5	0	0	0	0	110.2	D50 A51 I52 L56 S57 L58	D50-T54 WeakPolarHBondContact O-CB 3.46Å; D50-T54 PolarHBondContact O-N 2.85Å; D50-T54 PolarHBondContact O-OG1 3.27Å; A51-T54 PolarHBondContact O-N 3.27Å; A51-T54 VanDerWaalsContact O-N 3.09Å; I52-T54 VanDerWaalsContact C-N 3.34Å; T54-L56 PolarHBondContact O-N 3.43Å; T54-S57 PolarHBondContact O-N 3.12Å; T54-L58 WeakPolarHBondContact O-CB 3.48Å; T54-L58 PolarHBondContact O-N 3.33Å
55	D	91.1	Very high	89.6	Confident	107 Å²	107	71.9 Å²	71.9	57%	0.572	39%	0.391	S	S	*	.	H	α-helix	trans	-61.7	-43.4	179	-71.4	-16.5	0	0	0	112.5	A51 S57 L58 C59	A51-D55 PolarHBondContact O-N 3.42Å; D55-S57 VanDerWaalsContact C-N 3.35Å; D55-L58 PolarHBondContact O-N 3.34Å; D55-C59 VanDerWaalsContact O-CB 3.27Å; D55-C59 WeakPolarHBondContact O-CB 3.3Å; D55-C59 PolarHBondContact O-N 2.88Å
56	L	94.3	Very high	90.7	Very high	33 Å²	33	67 Å²	67	17%	0.173	37%	0.367	C	S	.	.	H	α-helix	trans	-66.4	-37.8	176.7	-73.9	175.5	0	0	0	112.2	I52 T54 C59 Y60 A92 L93 C96	I52-L56 HydrophobicContact CG2-CD1 3.85Å; I52-L56 HydrophobicContact CG2-CG 4.36Å; I52-L56 WeakPolarHBondContact O-CB 3.31Å; I52-L56 VanDerWaalsContact O-CG 3.27Å; I52-L56 WeakPolarHBondContact O-CG 3.5Å; I52-L56 PolarHBondContact O-N 2.87Å; T54-L56 PolarHBondContact O-N 3.43Å; L56-C59 PolarHBondContact O-N 3.48Å; L56-Y60 WeakPolarHBondContact O-CB 3.46Å; L56-Y60 PolarHBondContact O-N 3.06Å; L56-A92 HydrophobicContact CD2-CB 3.61Å; L56-L93 HydrophobicContact CB-CD2 3.62Å; L56-L93 HydrophobicContact CB-CG 4.28Å; L56-L93 HydrophobicContact CD1-CD2 4.4Å; L56-C96 HydrophobicContact CD1-CB 3.63Å
57	S	91.4	Very high	91.7	Very high	66 Å²	66	66.6 Å²	66.6	46%	0.462	36%	0.359	S	S	.	.	H	α-helix	trans	-66.3	-42.5	176.8	-58.5	0	0	0	0	111	K53 T54 D55 Y60 A61	K53-S57 VanDerWaalsContact O-CB 3.3Å; K53-S57 WeakPolarHBondContact O-CB 3.34Å; K53-S57 PolarHBondContact O-N 3.05Å; K53-S57 PolarHBondContact O-OG 3.42Å; T54-S57 PolarHBondContact O-N 3.12Å; D55-S57 VanDerWaalsContact C-N 3.35Å; S57-Y60 PolarHBondContact O-N 3.34Å; S57-A61 WeakPolarHBondContact O-CB 3.33Å; S57-A61 PolarHBondContact O-N 3.47Å
58	L	91.1	Very high	92.1	Very high	47 Å²	47	67.4 Å²	67.4	25%	0.246	36%	0.357	C	S	.	.	H	α-helix	trans	-65.4	-43.1	176.3	-173.2	64.1	0	0	0	111.5	T54 D55 Y60 A61 F62	T54-L58 WeakPolarHBondContact O-CB 3.48Å; T54-L58 PolarHBondContact O-N 3.33Å; D55-L58 PolarHBondContact O-N 3.34Å; L58-Y60 VanDerWaalsContact C-N 3.31Å; L58-Y60 PolarHBondContact O-N 3.18Å; L58-A61 PolarHBondContact O-N 3.2Å; L58-F62 HydrophobicContact CD1-CD2 4.3Å; L58-F62 HydrophobicContact CD1-CE1 4.14Å; L58-F62 HydrophobicContact CD1-CE2 3.67Å; L58-F62 HydrophobicContact CD1-CZ 3.56Å; L58-F62 HydrophobicContact CD2-CE2 3.81Å; L58-F62 HydrophobicContact CD2-CZ 4.23Å; L58-F62 HydrophobicContact CG-CD2 3.96Å; L58-F62 HydrophobicContact CG-CE2 3.42Å; L58-F62 VanDerWaalsContact CG-CE2 3.42Å; L58-F62 HydrophobicContact CG-CZ 3.87Å; L58-F62 WeakPolarHBondContact O-CD2 3.45Å; L58-F62 PolarHBondContact O-N 2.95Å
59	C	94.5	Very high	92.5	Very high	40 Å²	40	67.3 Å²	67.3	27%	0.27	35%	0.347	S	S	.	.	H	α-helix	trans	-59.3	-42.9	174.7	-171.5	0	0	0	0	111.5	D55 L56 N63	D55-C59 VanDerWaalsContact O-CB 3.27Å; D55-C59 WeakPolarHBondContact O-CB 3.3Å; D55-C59 PolarHBondContact O-N 2.88Å; L56-C59 PolarHBondContact O-N 3.48Å; C59-N63 PolarHBondContact O-N 2.78Å; C59-N63 PolarHBondContact O-ND2 3.46Å
60	Y	95	Very high	93	Very high	111 Å²	111	66 Å²	66	44%	0.435	34%	0.34	S	S	.	.	H	α-helix	trans	-63.8	-46.2	174.8	178.8	-100.1	0	0	0	111.8	L56 S57 L58 F62 N63 A64 L86 V89 L93	L56-Y60 WeakPolarHBondContact O-CB 3.46Å; L56-Y60 PolarHBondContact O-N 3.06Å; S57-Y60 PolarHBondContact O-N 3.34Å; L58-Y60 VanDerWaalsContact C-N 3.31Å; L58-Y60 PolarHBondContact O-N 3.18Å; Y60-F62 PolarHBondContact O-N 2.95Å; Y60-N63 PolarHBondContact O-N 2.75Å; Y60-A64 HydrophobicContact CE1-CB 4.42Å; Y60-A64 WeakPolarHBondContact O-CB 3.44Å; Y60-A64 PolarHBondContact O-N 2.94Å; Y60-L86 HydrophobicContact CD2-CD2 4.33Å; Y60-L86 HydrophobicContact CE2-CD2 4.08Å; Y60-V89 HydrophobicContact CD2-CG1 4.2Å; Y60-V89 HydrophobicContact CG-CG1 4.46Å; Y60-L93 HydrophobicContact CD2-CD1 4.27Å; Y60-L93 HydrophobicContact CG-CD1 4.18Å
61	A	92.3	Very high	93.3	Very high	36 Å²	36	70.1 Å²	70.1	30%	0.298	35%	0.35	S	S	.	.	H	α-helix	trans	-57.6	-47.6	179.6	0	0	0	0	0	111.9	S57 L58 N63 A64 L65	S57-A61 WeakPolarHBondContact O-CB 3.33Å; S57-A61 PolarHBondContact O-N 3.47Å; L58-A61 PolarHBondContact O-N 3.2Å; A61-N63 PolarHBondContact O-N 3.23Å; A61-A64 PolarHBondContact O-N 3.31Å; A61-L65 WeakPolarHBondContact O-CB 3.48Å; A61-L65 WeakPolarHBondContact O-CG 3.3Å; A61-L65 PolarHBondContact O-N 3.29Å
62	F	93.4	Very high	93.5	Very high	105 Å²	105	72.5 Å²	72.5	46%	0.461	36%	0.364	S	S	.	.	H	α-helix	trans	-63.2	-42.1	177.8	-68.7	-39.3	0	0	0	113.1	L58 Y60 A64 L65 F66	L58-F62 HydrophobicContact CD1-CD2 4.3Å; L58-F62 HydrophobicContact CD1-CE1 4.14Å; L58-F62 HydrophobicContact CD1-CE2 3.67Å; L58-F62 HydrophobicContact CD1-CZ 3.56Å; L58-F62 HydrophobicContact CD2-CE2 3.81Å; L58-F62 HydrophobicContact CD2-CZ 4.23Å; L58-F62 HydrophobicContact CG-CD2 3.96Å; L58-F62 HydrophobicContact CG-CE2 3.42Å; L58-F62 VanDerWaalsContact CG-CE2 3.42Å; L58-F62 HydrophobicContact CG-CZ 3.87Å; L58-F62 WeakPolarHBondContact O-CD2 3.45Å; L58-F62 PolarHBondContact O-N 2.95Å; Y60-F62 PolarHBondContact O-N 2.95Å; F62-A64 VanDerWaalsContact C-N 3.34Å; F62-L65 PolarHBondContact O-N 2.95Å; F62-F66 WeakPolarHBondContact O-CB 3.42Å; F62-F66 PolarHBondContact O-N 2.95Å
63	N	95.1	Very high	93.7	Very high	28 Å²	28	72.9 Å²	72.9	15%	0.15	37%	0.367	C	S	.	.	H	α-helix	trans	-65.9	-38.2	176.4	-79.3	-78.3	0	0	0	111.9	C59 Y60 A61 F66 F67 I82 L86	C59-N63 PolarHBondContact O-N 2.78Å; C59-N63 PolarHBondContact O-ND2 3.46Å; Y60-N63 PolarHBondContact O-N 2.75Å; A61-N63 PolarHBondContact O-N 3.23Å; N63-F66 PolarHBondContact O-N 3.24Å; N63-F67 WeakPolarHBondContact O-CB 3.47Å; N63-F67 PolarHBondContact O-N 3.14Å; N63-I82 HydrophobicContact CB-CD1 4.33Å; N63-L86 HydrophobicContact CB-CD2 3.84Å; N63-L86 HydrophobicContact CB-CG 4.45Å
64	A	94.7	Very high	93.8	Very high	15 Å²	15	72.7 Å²	72.7	12%	0.124	39%	0.386	C	S	.	.	H	α-helix	trans	-65.9	-43.2	176	0	0	0	0	0	111.8	Y60 A61 F62 F66 F67 M68	Y60-A64 HydrophobicContact CE1-CB 4.42Å; Y60-A64 WeakPolarHBondContact O-CB 3.44Å; Y60-A64 PolarHBondContact O-N 2.94Å; A61-A64 PolarHBondContact O-N 3.31Å; F62-A64 VanDerWaalsContact C-N 3.34Å; A64-F66 VanDerWaalsContact C-N 3.35Å; A64-F66 PolarHBondContact O-N 3.48Å; A64-F67 WeakPolarHBondContact O-CB 3.46Å; A64-F67 PolarHBondContact O-N 3.03Å; A64-M68 VanDerWaalsContact O-CG 3.31Å; A64-M68 WeakPolarHBondContact O-CG 3.33Å; A64-M68 PolarHBondContact O-N 3.27Å
65	L	94.4	Very high	94.1	Very high	67 Å²	67	72 Å²	72	35%	0.351	38%	0.382	S	S	.	.	H	α-helix	trans	-61.9	-42.4	174.7	-75	172.4	0	0	0	111.8	V28 A61 F62 F67 M68 Y69	V28-L65 HydrophobicContact CG1-CD1 3.99Å; V28-L65 HydrophobicContact CG1-CD2 4.1Å; V28-L65 HydrophobicContact CG1-CG 4.49Å; A61-L65 WeakPolarHBondContact O-CB 3.48Å; A61-L65 WeakPolarHBondContact O-CG 3.3Å; A61-L65 PolarHBondContact O-N 3.29Å; F62-L65 PolarHBondContact O-N 2.95Å; L65-F67 VanDerWaalsContact C-N 3.35Å; L65-F67 PolarHBondContact O-N 2.91Å; L65-M68 HydrophobicContact CD2-SD 4.41Å; L65-M68 PolarHBondContact O-N 3.42Å; L65-Y69 WeakPolarHBondContact O-CB 3.34Å; L65-Y69 PolarHBondContact O-N 2.95Å
66	F	95.7	Very high	94.2	Very high	98 Å²	98	72.9 Å²	72.9	43%	0.43	38%	0.382	S	S	.	.	H	α-helix	trans	-65	-39.8	175.7	-171.7	-110.5	0	0	0	112	F62 N63 A64 M68 Y69 L70 I82	F62-F66 WeakPolarHBondContact O-CB 3.42Å; F62-F66 PolarHBondContact O-N 2.95Å; N63-F66 PolarHBondContact O-N 3.24Å; A64-F66 VanDerWaalsContact C-N 3.35Å; A64-F66 PolarHBondContact O-N 3.48Å; F66-M68 PolarHBondContact O-N 2.9Å; F66-Y69 HydrophobicContact CD2-CD1 4.24Å; F66-Y69 HydrophobicContact CE2-CD1 4.12Å; F66-Y69 HydrophobicContact CE2-CE1 4.48Å; F66-Y69 WeakPolarHBondContact O-CB 3.33Å; F66-Y69 PolarHBondContact O-N 3.29Å; F66-L70 HydrophobicContact CD1-CD1 4Å; F66-L70 HydrophobicContact CD1-CG 4.45Å; F66-L70 HydrophobicContact CE1-CD1 3.7Å; F66-L70 HydrophobicContact CE1-CD2 4.46Å; F66-L70 HydrophobicContact CE1-CG 4.17Å; F66-L70 HydrophobicContact CZ-CD1 4.3Å; F66-L70 HydrophobicContact CZ-CD2 4.24Å; F66-L70 HydrophobicContact CZ-CG 4.33Å; F66-L70 WeakPolarHBondContact O-CG 3.34Å; F66-L70 PolarHBondContact O-N 2.69Å; F66-I82 HydrophobicContact CD1-CD1 3.78Å; F66-I82 HydrophobicContact CD1-CG1 4.14Å
67	F	96.4	Very high	94.2	Very high	57 Å²	57	71.7 Å²	71.7	25%	0.25	38%	0.376	C	S	.	.	H	α-helix	trans	-59.5	-44.1	171.6	168.4	-96.2	0	0	0	112.4	N63 A64 L65 L70 R71 T77 I82 M83 L86	N63-F67 WeakPolarHBondContact O-CB 3.47Å; N63-F67 PolarHBondContact O-N 3.14Å; A64-F67 WeakPolarHBondContact O-CB 3.46Å; A64-F67 PolarHBondContact O-N 3.03Å; L65-F67 VanDerWaalsContact C-N 3.35Å; L65-F67 PolarHBondContact O-N 2.91Å; F67-L70 PolarHBondContact O-N 2.88Å; F67-R71 HydrophobicContact CD1-CG 4.5Å; F67-R71 HydrophobicContact CE1-CG 4.08Å; F67-R71 HydrophobicContact CE2-CG 4.28Å; F67-R71 HydrophobicContact CZ-CG 3.97Å; F67-R71 WeakPolarHBondContact O-CG 3.49Å; F67-R71 PolarHBondContact O-N 2.91Å; F67-R71 VanDerWaalsContact O-N 3.08Å; F67-T77 HydrophobicContact CD2-CG2 3.75Å; F67-T77 VanDerWaalsContact CE2-CB 3.45Å; F67-T77 HydrophobicContact CE2-CG2 3.68Å; F67-T77 VanDerWaalsContact CE2-OG1 3.27Å; F67-T77 WeakPolarHBondContact CE2-OG1 3.49Å; F67-I82 HydrophobicContact CB-CG1 4Å; F67-I82 HydrophobicContact CD2-CG2 4.2Å; F67-M83 HydrophobicContact CD2-CE 3.23Å; F67-M83 HydrophobicContact CE2-CE 3.19Å; F67-M83 HydrophobicContact CE2-SD 4.39Å; F67-M83 HydrophobicContact CG-CE 4.35Å; F67-M83 HydrophobicContact CZ-CE 4.32Å; F67-L86 HydrophobicContact CB-CD1 4.11Å; F67-L86 HydrophobicContact CD2-CD1 4.2Å; F67-L86 HydrophobicContact CG-CD1 4.14Å
68	M	94.8	Very high	94.2	Very high	90 Å²	90	76.3 Å²	76.3	44%	0.443	39%	0.391	S	S	.	.	H	α-helix	trans	-62.4	-44.8	175.7	-68.8	172	-168.6	0	0	111.2	A64 L65 F66 L70 R71 C72	A64-M68 VanDerWaalsContact O-CG 3.31Å; A64-M68 WeakPolarHBondContact O-CG 3.33Å; A64-M68 PolarHBondContact O-N 3.27Å; L65-M68 HydrophobicContact CD2-SD 4.41Å; L65-M68 PolarHBondContact O-N 3.42Å; F66-M68 PolarHBondContact O-N 2.9Å; M68-L70 VanDerWaalsContact C-N 3.34Å; M68-L70 PolarHBondContact O-N 3.22Å; M68-R71 WeakPolarHBondContact O-CB 3.41Å; M68-R71 PolarHBondContact O-N 3.33Å; M68-R71 VanDerWaalsContact O-N 3.12Å; M68-C72 PolarHBondContact O-N 3.49Å; M68-C72 PolarHBondContact O-SG 3.02Å; M68-C72 VanDerWaalsContact O-SG 3.33Å
69	Y	95.4	Very high	94.2	Very high	135 Å²	135	78.5 Å²	78.5	53%	0.529	41%	0.41	S	S	.	.	H	α-helix	trans	-55.1	-47.5	175.1	168	-98.7	0	0	0	111.9	L65 F66 R71 C72 N73	L65-Y69 WeakPolarHBondContact O-CB 3.34Å; L65-Y69 PolarHBondContact O-N 2.95Å; F66-Y69 HydrophobicContact CD2-CD1 4.24Å; F66-Y69 HydrophobicContact CE2-CD1 4.12Å; F66-Y69 HydrophobicContact CE2-CE1 4.48Å; F66-Y69 WeakPolarHBondContact O-CB 3.33Å; F66-Y69 PolarHBondContact O-N 3.29Å; Y69-R71 VanDerWaalsContact C-N 3.33Å; Y69-R71 PolarHBondContact O-N 3.09Å; Y69-C72 PolarHBondContact O-N 3.41Å; Y69-N73 WeakPolarHBondContact CD2-ND2 3.32Å; Y69-N73 WeakPolarHBondContact CE2-ND2 3.31Å; Y69-N73 VanDerWaalsContact CZ-ND2 3.32Å; Y69-N73 PolarHBondContact O-N 3.46Å; Y69-N73 VanDerWaalsContact O-N 3.08Å; Y69-N73 PolarHBondContact O-ND2 2.96Å
70	L	97.2	Very high	94.2	Very high	13 Å²	13	79.2 Å²	79.2	7%	0.068	41%	0.409	C	S	.	.	H	α-helix	trans	-60.2	-43.1	176.9	-69.3	173.1	0	0	0	111.9	F66 F67 M68 N73 G74 V75 T77 H80 I82	F66-L70 HydrophobicContact CD1-CD1 4Å; F66-L70 HydrophobicContact CD1-CG 4.45Å; F66-L70 HydrophobicContact CE1-CD1 3.7Å; F66-L70 HydrophobicContact CE1-CD2 4.46Å; F66-L70 HydrophobicContact CE1-CG 4.17Å; F66-L70 HydrophobicContact CZ-CD1 4.3Å; F66-L70 HydrophobicContact CZ-CD2 4.24Å; F66-L70 HydrophobicContact CZ-CG 4.33Å; F66-L70 WeakPolarHBondContact O-CG 3.34Å; F66-L70 PolarHBondContact O-N 2.69Å; F67-L70 PolarHBondContact O-N 2.88Å; M68-L70 VanDerWaalsContact C-N 3.34Å; M68-L70 PolarHBondContact O-N 3.22Å; L70-N73 PolarHBondContact O-N 3.05Å; L70-G74 PolarHBondContact O-N 3.24Å; L70-V75 HydrophobicContact CB-CB 4.18Å; L70-V75 HydrophobicContact CD2-CB 4.33Å; L70-V75 HydrophobicContact CD2-CG1 4.35Å; L70-V75 HydrophobicContact CD2-CG2 4.24Å; L70-V75 WeakPolarHBondContact O-CB 3.33Å; L70-V75 PolarHBondContact O-N 3.46Å; L70-T77 HydrophobicContact CB-CG2 3.97Å; L70-H80 VanDerWaalsContact CD1-CE1 3.42Å; L70-H80 WeakPolarHBondContact CD1-CE1 3.27Å; L70-H80 WeakPolarHBondContact CD1-ND1 3.45Å; L70-I82 HydrophobicContact CD1-CB 4.23Å; L70-I82 HydrophobicContact CD1-CG2 3.97Å
71	R	94.4	Very high	94.2	Very high	154 Å²	154	77.7 Å²	77.7	58%	0.581	41%	0.413	S	S	*	.	H	α-helix	trans	-61.9	-42.6	176.9	-73.8	-74.6	-61.4	177.7	3.2	112.3	F67 M68 Y69 N73 G74 T77	F67-R71 HydrophobicContact CD1-CG 4.5Å; F67-R71 HydrophobicContact CE1-CG 4.08Å; F67-R71 HydrophobicContact CE2-CG 4.28Å; F67-R71 HydrophobicContact CZ-CG 3.97Å; F67-R71 WeakPolarHBondContact O-CG 3.49Å; F67-R71 PolarHBondContact O-N 2.91Å; F67-R71 VanDerWaalsContact O-N 3.08Å; M68-R71 WeakPolarHBondContact O-CB 3.41Å; M68-R71 PolarHBondContact O-N 3.33Å; M68-R71 VanDerWaalsContact O-N 3.12Å; Y69-R71 VanDerWaalsContact C-N 3.33Å; Y69-R71 PolarHBondContact O-N 3.09Å; R71-N73 VanDerWaalsContact C-N 3.27Å; R71-N73 PolarHBondContact O-N 3.25Å; R71-G74 PolarHBondContact O-N 2.96Å; R71-G74 VanDerWaalsContact O-N 3.1Å; R71-T77 HydrophobicContact CG-CG2 3.83Å
72	C	92.4	Very high	94.4	Very high	87 Å²	87	76.2 Å²	76.2	59%	0.588	40%	0.4	S	S	*	.	H	α-helix	trans	-65.2	-31	176.9	-68.1	0	0	0	0	112.5	M68 Y69 G74	M68-C72 PolarHBondContact O-N 3.49Å; M68-C72 PolarHBondContact O-SG 3.02Å; M68-C72 VanDerWaalsContact O-SG 3.33Å; Y69-C72 PolarHBondContact O-N 3.41Å; C72-G74 PolarHBondContact O-N 2.86Å
73	N	94.8	Very high	94.5	Very high	95 Å²	95	73.8 Å²	73.8	51%	0.508	39%	0.391	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82.4	6.6	174.4	-73.7	-85.4	0	0	0	113.5	Y69 L70 R71 V75	Y69-N73 WeakPolarHBondContact CD2-ND2 3.32Å; Y69-N73 WeakPolarHBondContact CE2-ND2 3.31Å; Y69-N73 VanDerWaalsContact CZ-ND2 3.32Å; Y69-N73 PolarHBondContact O-N 3.46Å; Y69-N73 VanDerWaalsContact O-N 3.08Å; Y69-N73 PolarHBondContact O-ND2 2.96Å; L70-N73 PolarHBondContact O-N 3.05Å; R71-N73 VanDerWaalsContact C-N 3.27Å; R71-N73 PolarHBondContact O-N 3.25Å; N73-V75 HydrophobicContact CB-CG2 4.25Å; N73-V75 PolarHBondContact O-N 3.49Å
74	G	93.8	Very high	94.6	Very high	70 Å²	70	79.2 Å²	79.2	72%	0.722	42%	0.415	S	S	*	.	T	Hydrogen-bonded Turn	trans	71.7	15.2	-180	0	0	0	0	0	114.4	L70 R71 C72	L70-G74 PolarHBondContact O-N 3.24Å; R71-G74 PolarHBondContact O-N 2.96Å; R71-G74 VanDerWaalsContact O-N 3.1Å; C72-G74 PolarHBondContact O-N 2.86Å
75	V	94.4	Very high	94.7	Very high	59 Å²	59	81.9 Å²	81.9	36%	0.358	43%	0.425	S	S	.	.			trans	-75.2	131.9	177.3	-178.6	0	0	0	0	109.6	L70 N73 T77	L70-V75 HydrophobicContact CB-CB 4.18Å; L70-V75 HydrophobicContact CD2-CB 4.33Å; L70-V75 HydrophobicContact CD2-CG1 4.35Å; L70-V75 HydrophobicContact CD2-CG2 4.24Å; L70-V75 WeakPolarHBondContact O-CB 3.33Å; L70-V75 PolarHBondContact O-N 3.46Å; N73-V75 HydrophobicContact CB-CG2 4.25Å; N73-V75 PolarHBondContact O-N 3.49Å; V75-T77 PolarHBondContact O-N 3.29Å
76	E	93	Very high	94.7	Very high	125 Å²	125	80 Å²	80	58%	0.584	42%	0.415	S	S	*	.			trans	-68.7	115.3	172.6	-174.7	177.4	-135.6	0	0	110.2	S79	E76-S79 PolarHBondContact OE2-OG 2.92Å
77	T	93.3	Very high	94.8	Very high	8 Å²	8	79.4 Å²	79.4	5%	0.049	42%	0.416	C	S	.	.			trans	-88.7	-19	-173.8	50.8	0	0	0	0	114.4	F67 L70 R71 V75 S79 H80 M83	F67-T77 HydrophobicContact CD2-CG2 3.75Å; F67-T77 VanDerWaalsContact CE2-CB 3.45Å; F67-T77 HydrophobicContact CE2-CG2 3.68Å; F67-T77 VanDerWaalsContact CE2-OG1 3.27Å; F67-T77 WeakPolarHBondContact CE2-OG1 3.49Å; L70-T77 HydrophobicContact CB-CG2 3.97Å; R71-T77 HydrophobicContact CG-CG2 3.83Å; V75-T77 PolarHBondContact O-N 3.29Å; T77-S79 VanDerWaalsContact C-N 3.35Å; T77-S79 PolarHBondContact O-N 3.38Å; T77-H80 WeakPolarHBondContact O-CB 3.48Å; T77-H80 PolarHBondContact O-N 3.01Å; T77-H80 VanDerWaalsContact O-N 3.1Å; T77-M83 WeakPolarHBondContact O-CG 3.44Å
78	Q	91.4	Very high	94.8	Very high	163 Å²	163	82.3 Å²	82.3	76%	0.762	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.7	-38.3	-176.3	-69.3	-176.6	86.5	0	0	112.8	H80	Q78-H80 VanDerWaalsContact C-N 3.33Å
79	S	91.6	Very high	94.9	Very high	92 Å²	92	78 Å²	78	64%	0.643	41%	0.405	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.7	-4.1	176	54	0	0	0	0	112.7	E76 T77	E76-S79 PolarHBondContact OE2-OG 2.92Å; T77-S79 VanDerWaalsContact C-N 3.35Å; T77-S79 PolarHBondContact O-N 3.38Å
80	H	95.1	Very high	94.9	Very high	56 Å²	56	75.1 Å²	75.1	26%	0.259	40%	0.397	S	S	.	.	S	Bend	trans	-86.1	140.6	-172.9	-168.5	-89.2	0	0	0	111.7	L70 T77 Q78 I82 M83	L70-H80 VanDerWaalsContact CD1-CE1 3.42Å; L70-H80 WeakPolarHBondContact CD1-CE1 3.27Å; L70-H80 WeakPolarHBondContact CD1-ND1 3.45Å; T77-H80 WeakPolarHBondContact O-CB 3.48Å; T77-H80 PolarHBondContact O-N 3.01Å; T77-H80 VanDerWaalsContact O-N 3.1Å; Q78-H80 VanDerWaalsContact C-N 3.33Å; H80-I82 HydrophobicContact CB-CG2 3.94Å; H80-I82 VanDerWaalsContact ND1-CB 3.3Å; H80-I82 WeakPolarHBondContact ND1-CB 3.34Å; H80-I82 WeakPolarHBondContact ND1-CG2 3.27Å; H80-I82 PolarHBondContact ND1-N 3.46Å; H80-I82 VanDerWaalsContact ND1-N 3.16Å; H80-I82 PolarHBondContact O-N 3.22Å; H80-M83 PolarHBondContact O-N 3.26Å; H80-M83 VanDerWaalsContact O-N 3.12Å
81	P	95.6	Very high	94.8	Very high	78 Å²	78	78.2 Å²	78.2	51%	0.506	41%	0.413	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.6	-19	178.8	-28.1	35.4	0	0	0	115.6	M83 Q84 E85	P81-M83 PolarHBondContact O-N 3.17Å; P81-Q84 WeakPolarHBondContact O-CB 3.4Å; P81-Q84 PolarHBondContact O-N 3.46Å; P81-E85 PolarHBondContact O-N 2.98Å
82	I	95.8	Very high	94.9	Very high	6 Å²	6	71.5 Å²	71.5	3%	0.031	39%	0.391	C	S	.	.	H	α-helix	trans	-57.6	-28.5	176.1	-168.1	51.9	0	0	0	112.9	N63 F66 F67 L70 H80 Q84 E85 L86	N63-I82 HydrophobicContact CB-CD1 4.33Å; F66-I82 HydrophobicContact CD1-CD1 3.78Å; F66-I82 HydrophobicContact CD1-CG1 4.14Å; F67-I82 HydrophobicContact CB-CG1 4Å; F67-I82 HydrophobicContact CD2-CG2 4.2Å; L70-I82 HydrophobicContact CD1-CB 4.23Å; L70-I82 HydrophobicContact CD1-CG2 3.97Å; H80-I82 HydrophobicContact CB-CG2 3.94Å; H80-I82 VanDerWaalsContact ND1-CB 3.3Å; H80-I82 WeakPolarHBondContact ND1-CB 3.34Å; H80-I82 WeakPolarHBondContact ND1-CG2 3.27Å; H80-I82 PolarHBondContact ND1-N 3.46Å; H80-I82 VanDerWaalsContact ND1-N 3.16Å; H80-I82 PolarHBondContact O-N 3.22Å; I82-Q84 VanDerWaalsContact C-N 3.33Å; I82-E85 HydrophobicContact CD1-CB 4.28Å; I82-E85 PolarHBondContact O-N 3.27Å; I82-L86 WeakPolarHBondContact O-CG 3.38Å; I82-L86 PolarHBondContact O-N 3.48Å
83	M	95.8	Very high	95	Very high	54 Å²	54	70 Å²	70	27%	0.266	38%	0.376	S	S	.	.	H	α-helix	trans	-63.1	-41.7	174.5	-65.5	-65.3	95.2	0	0	111.6	F67 T77 H80 P81 E85 L86 D87	F67-M83 HydrophobicContact CD2-CE 3.23Å; F67-M83 HydrophobicContact CE2-CE 3.19Å; F67-M83 HydrophobicContact CE2-SD 4.39Å; F67-M83 HydrophobicContact CG-CE 4.35Å; F67-M83 HydrophobicContact CZ-CE 4.32Å; T77-M83 WeakPolarHBondContact O-CG 3.44Å; H80-M83 PolarHBondContact O-N 3.26Å; H80-M83 VanDerWaalsContact O-N 3.12Å; P81-M83 PolarHBondContact O-N 3.17Å; M83-E85 VanDerWaalsContact C-N 3.33Å; M83-E85 PolarHBondContact O-N 3.05Å; M83-L86 HydrophobicContact CE-CD1 3.72Å; M83-L86 PolarHBondContact O-N 2.68Å; M83-D87 WeakPolarHBondContact O-CB 3.42Å; M83-D87 PolarHBondContact O-N 3.09Å
84	Q	96.1	Very high	95	Very high	141 Å²	141	71.1 Å²	71.1	66%	0.659	38%	0.377	S	S	*	.	H	α-helix	trans	-66.4	-38.5	178.1	-58.3	177	18.3	0	0	111	P81 I82 D87 R88	P81-Q84 WeakPolarHBondContact O-CB 3.4Å; P81-Q84 PolarHBondContact O-N 3.46Å; I82-Q84 VanDerWaalsContact C-N 3.33Å; Q84-D87 PolarHBondContact O-N 2.99Å; Q84-R88 VanDerWaalsContact O-CB 3.3Å; Q84-R88 WeakPolarHBondContact O-CB 3.37Å; Q84-R88 PolarHBondContact O-N 3.22Å
85	E	96.3	Very high	95	Very high	72 Å²	72	75.4 Å²	75.4	34%	0.336	37%	0.371	S	S	.	.	H	α-helix	trans	-66.7	-42.8	175.9	-74.9	-56.9	107.8	0	0	112.2	P81 I82 M83 D87 R88 V89	P81-E85 PolarHBondContact O-N 2.98Å; I82-E85 HydrophobicContact CD1-CB 4.28Å; I82-E85 PolarHBondContact O-N 3.27Å; M83-E85 VanDerWaalsContact C-N 3.33Å; M83-E85 PolarHBondContact O-N 3.05Å; E85-D87 PolarHBondContact O-N 2.88Å; E85-R88 WeakPolarHBondContact O-CB 3.5Å; E85-R88 PolarHBondContact O-N 3Å; E85-R88 IonicContact OE1-NE 3.79Å; E85-R88 PolarHBondContact OE1-NE 3.42Å; E85-R88 IonicContact OE2-CZ 3.29Å; E85-R88 VanDerWaalsContact OE2-CZ 3.28Å; E85-R88 IonicContact OE2-NE 3.28Å; E85-R88 PolarHBondContact OE2-NE 3.33Å; E85-R88 IonicContact OE2-NH2 2.95Å; E85-R88 PolarHBondContact OE2-NH2 3.44Å; E85-V89 WeakPolarHBondContact O-CG2 3.47Å; E85-V89 PolarHBondContact O-N 3.33Å
86	L	96.3	Very high	94.9	Very high	28 Å²	28	73.3 Å²	73.3	15%	0.147	36%	0.359	C	S	.	.	H	α-helix	trans	-61.5	-43.6	173.8	-77.3	171.4	0	0	0	111.8	Y60 N63 F67 I82 M83 R88 V89 M90	Y60-L86 HydrophobicContact CD2-CD2 4.33Å; Y60-L86 HydrophobicContact CE2-CD2 4.08Å; N63-L86 HydrophobicContact CB-CD2 3.84Å; N63-L86 HydrophobicContact CB-CG 4.45Å; F67-L86 HydrophobicContact CB-CD1 4.11Å; F67-L86 HydrophobicContact CD2-CD1 4.2Å; F67-L86 HydrophobicContact CG-CD1 4.14Å; I82-L86 WeakPolarHBondContact O-CG 3.38Å; I82-L86 PolarHBondContact O-N 3.48Å; M83-L86 HydrophobicContact CE-CD1 3.72Å; M83-L86 PolarHBondContact O-N 2.68Å; L86-R88 PolarHBondContact O-N 3Å; L86-V89 PolarHBondContact O-N 2.95Å; L86-M90 VanDerWaalsContact O-CB 3.3Å; L86-M90 WeakPolarHBondContact O-CB 3.44Å; L86-M90 PolarHBondContact O-N 3.19Å
87	D	96.3	Very high	94.8	Very high	84 Å²	84	75.4 Å²	75.4	45%	0.449	36%	0.362	S	S	.	.	H	α-helix	trans	-62.5	-42	175.3	-81.4	-30.2	0	0	0	111.9	M83 Q84 E85 V89 M90 N91	M83-D87 WeakPolarHBondContact O-CB 3.42Å; M83-D87 PolarHBondContact O-N 3.09Å; Q84-D87 PolarHBondContact O-N 2.99Å; E85-D87 PolarHBondContact O-N 2.88Å; D87-V89 PolarHBondContact O-N 3.42Å; D87-M90 PolarHBondContact O-N 3.44Å; D87-M90 WeakPolarHBondContact OD1-CE 3.47Å; D87-N91 VanDerWaalsContact O-CB 3.31Å; D87-N91 WeakPolarHBondContact O-CB 3.44Å; D87-N91 PolarHBondContact O-N 2.93Å; D87-N91 PolarHBondContact O-ND2 2.93Å
88	R	97.2	Very high	94.7	Very high	118 Å²	118	77.1 Å²	77.1	45%	0.445	37%	0.374	S	S	.	.	H	α-helix	trans	-59.1	-47.5	176.5	-173.5	-175	67	70.5	3.1	111.1	Q84 E85 L86 N91 A92	Q84-R88 VanDerWaalsContact O-CB 3.3Å; Q84-R88 WeakPolarHBondContact O-CB 3.37Å; Q84-R88 PolarHBondContact O-N 3.22Å; E85-R88 WeakPolarHBondContact O-CB 3.5Å; E85-R88 PolarHBondContact O-N 3Å; E85-R88 IonicContact OE1-NE 3.79Å; E85-R88 PolarHBondContact OE1-NE 3.42Å; E85-R88 IonicContact OE2-CZ 3.29Å; E85-R88 VanDerWaalsContact OE2-CZ 3.28Å; E85-R88 IonicContact OE2-NE 3.28Å; E85-R88 PolarHBondContact OE2-NE 3.33Å; E85-R88 IonicContact OE2-NH2 2.95Å; E85-R88 PolarHBondContact OE2-NH2 3.44Å; L86-R88 PolarHBondContact O-N 3Å; R88-N91 PolarHBondContact O-N 3.45Å; R88-A92 PolarHBondContact O-N 2.95Å
89	V	96.4	Very high	94.5	Very high	1 Å²	1	74.5 Å²	74.5	1%	0.006	36%	0.364	C	S	.	.	H	α-helix	trans	-68.7	-43.2	179.3	178.2	0	0	0	0	111.1	Y60 E85 L86 D87 N91 A92 L93	Y60-V89 HydrophobicContact CD2-CG1 4.2Å; Y60-V89 HydrophobicContact CG-CG1 4.46Å; E85-V89 WeakPolarHBondContact O-CG2 3.47Å; E85-V89 PolarHBondContact O-N 3.33Å; L86-V89 PolarHBondContact O-N 2.95Å; D87-V89 PolarHBondContact O-N 3.42Å; V89-N91 VanDerWaalsContact C-N 3.28Å; V89-N91 PolarHBondContact O-N 3.34Å; V89-A92 WeakPolarHBondContact O-CA 3.34Å; V89-A92 WeakPolarHBondContact O-CB 3.3Å; V89-A92 PolarHBondContact O-N 3.31Å; V89-L93 HydrophobicContact CG1-CD1 4.31Å; V89-L93 PolarHBondContact O-N 3.05Å
90	M	94.8	Very high	94.3	Very high	73 Å²	73	72.5 Å²	72.5	36%	0.36	35%	0.348	S	S	.	.	H	α-helix	trans	-58.7	-40.6	175.1	-179.6	178.2	51	0	0	111.5	L86 D87 A92 L93 K94	L86-M90 VanDerWaalsContact O-CB 3.3Å; L86-M90 WeakPolarHBondContact O-CB 3.44Å; L86-M90 PolarHBondContact O-N 3.19Å; D87-M90 PolarHBondContact O-N 3.44Å; D87-M90 WeakPolarHBondContact OD1-CE 3.47Å; M90-A92 VanDerWaalsContact C-N 3.35Å; M90-L93 PolarHBondContact O-N 2.91Å; M90-K94 HydrophobicContact CG-CD 4.36Å; M90-K94 WeakPolarHBondContact O-CG 3.4Å; M90-K94 PolarHBondContact O-N 3.23Å
91	N	96.8	Very high	93.8	Very high	79 Å²	79	74.7 Å²	74.7	42%	0.422	36%	0.358	S	S	.	.	H	α-helix	trans	-67	-34.6	175.7	-72.8	-32	0	0	0	112.4	D87 R88 V89 R95	D87-N91 VanDerWaalsContact O-CB 3.31Å; D87-N91 WeakPolarHBondContact O-CB 3.44Å; D87-N91 PolarHBondContact O-N 2.93Å; D87-N91 PolarHBondContact O-ND2 2.93Å; R88-N91 PolarHBondContact O-N 3.45Å; V89-N91 VanDerWaalsContact C-N 3.28Å; V89-N91 PolarHBondContact O-N 3.34Å; N91-R95 WeakPolarHBondContact O-CG 3.2Å; N91-R95 PolarHBondContact O-N 3.34Å; N91-R95 VanDerWaalsContact O-N 3.12Å; N91-R95 PolarHBondContact O-NE 2.75Å
92	A	95.8	Very high	93.1	Very high	13 Å²	13	77.4 Å²	77.4	11%	0.107	36%	0.362	C	S	.	.	H	α-helix	trans	-66.2	-43.8	171.7	0	0	0	0	0	112	L56 R88 V89 M90 R95 C96	L56-A92 HydrophobicContact CD2-CB 3.61Å; R88-A92 PolarHBondContact O-N 2.95Å; V89-A92 WeakPolarHBondContact O-CA 3.34Å; V89-A92 WeakPolarHBondContact O-CB 3.3Å; V89-A92 PolarHBondContact O-N 3.31Å; M90-A92 VanDerWaalsContact C-N 3.35Å; A92-R95 PolarHBondContact O-N 3.32Å; A92-C96 PolarHBondContact O-N 2.85Å
93	L	95.1	Very high	92.1	Very high	54 Å²	54	83.3 Å²	83.3	28%	0.283	39%	0.39	S	S	.	.	H	α-helix	trans	-61	-44.1	174.8	-76.1	169	0	0	0	112.4	L56 Y60 V89 M90 R95 C96 R97	L56-L93 HydrophobicContact CB-CD2 3.62Å; L56-L93 HydrophobicContact CB-CG 4.28Å; L56-L93 HydrophobicContact CD1-CD2 4.4Å; Y60-L93 HydrophobicContact CD2-CD1 4.27Å; Y60-L93 HydrophobicContact CG-CD1 4.18Å; V89-L93 HydrophobicContact CG1-CD1 4.31Å; V89-L93 PolarHBondContact O-N 3.05Å; M90-L93 PolarHBondContact O-N 2.91Å; L93-R95 VanDerWaalsContact C-N 3.33Å; L93-R95 PolarHBondContact O-N 3.46Å; L93-C96 PolarHBondContact O-N 3.26Å; L93-R97 WeakPolarHBondContact O-CB 3.49Å; L93-R97 PolarHBondContact O-N 3.04Å
94	K	94.6	Very high	90.9	Very high	120 Å²	120	83.1 Å²	83.1	52%	0.522	40%	0.402	S	S	.	.	H	α-helix	trans	-59.1	-42.9	174.9	-74.8	172.1	-177.2	169.2	0	111.9	M90 R97 S98	M90-K94 HydrophobicContact CG-CD 4.36Å; M90-K94 WeakPolarHBondContact O-CG 3.4Å; M90-K94 PolarHBondContact O-N 3.23Å; K94-R97 PolarHBondContact O-N 2.77Å; K94-S98 PolarHBondContact O-N 3.48Å
95	R	93.8	Very high	89.4	Confident	160 Å²	160	79.8 Å²	79.8	60%	0.604	39%	0.394	S	S	*	.	H	α-helix	trans	-63.1	-48.6	175.5	-74.7	-178.4	-66.9	164.5	0.7	111.2	N91 A92 L93 R97 S98 L99	N91-R95 WeakPolarHBondContact O-CG 3.2Å; N91-R95 PolarHBondContact O-N 3.34Å; N91-R95 VanDerWaalsContact O-N 3.12Å; N91-R95 PolarHBondContact O-NE 2.75Å; A92-R95 PolarHBondContact O-N 3.32Å; L93-R95 VanDerWaalsContact C-N 3.33Å; L93-R95 PolarHBondContact O-N 3.46Å; R95-R97 VanDerWaalsContact C-N 3.35Å; R95-R97 PolarHBondContact O-N 3.08Å; R95-S98 PolarHBondContact O-N 2.98Å; R95-S98 VanDerWaalsContact O-N 3.14Å; R95-S98 PolarHBondContact O-OG 3.21Å; R95-L99 WeakPolarHBondContact O-CG 3.41Å; R95-L99 PolarHBondContact O-N 2.98Å; R95-L99 VanDerWaalsContact O-N 3.09Å
96	C	92.7	Very high	87.8	Confident	14 Å²	14	79.5 Å²	79.5	10%	0.095	40%	0.404	C	S	.	.	H	α-helix	trans	-54.5	-50.6	176	-179.5	0	0	0	0	111.1	L56 A92 L93 S98 L99 V100	L56-C96 HydrophobicContact CD1-CB 3.63Å; A92-C96 PolarHBondContact O-N 2.85Å; L93-C96 PolarHBondContact O-N 3.26Å; C96-S98 VanDerWaalsContact C-N 3.31Å; C96-S98 PolarHBondContact O-N 3.43Å; C96-L99 WeakPolarHBondContact O-CB 3.39Å; C96-L99 PolarHBondContact O-N 3.02Å; C96-V100 WeakPolarHBondContact O-CG2 3.15Å; C96-V100 PolarHBondContact O-N 3.45Å
97	R	90.6	Very high	86.2	Confident	170 Å²	170	89.3 Å²	89.3	64%	0.642	44%	0.439	S	S	*	.	H	α-helix	trans	-54.8	-44.9	176.3	-177.6	176.9	176.6	161.7	4.1	112.7	L93 K94 R95 L99 V100 E101	L93-R97 WeakPolarHBondContact O-CB 3.49Å; L93-R97 PolarHBondContact O-N 3.04Å; K94-R97 PolarHBondContact O-N 2.77Å; R95-R97 VanDerWaalsContact C-N 3.35Å; R95-R97 PolarHBondContact O-N 3.08Å; R97-L99 VanDerWaalsContact C-N 3.25Å; R97-L99 PolarHBondContact O-N 3.32Å; R97-V100 PolarHBondContact O-N 2.87Å; R97-E101 IonicContact CZ-OE1 3.74Å; R97-E101 IonicContact NE-OE1 2.85Å; R97-E101 PolarHBondContact NE-OE1 2.98Å; R97-E101 IonicContact NH2-OE1 2.95Å; R97-E101 WeakPolarHBondContact O-CG 3.43Å; R97-E101 PolarHBondContact O-N 2.97Å
98	S	90	Very high	84.8	Confident	44 Å²	44	92.3 Å²	92.3	31%	0.308	45%	0.454	S	S	.	.	H	α-helix	trans	-63.9	-29.8	178.4	79	0	0	0	0	113.4	K94 R95 C96 K102	K94-S98 PolarHBondContact O-N 3.48Å; R95-S98 PolarHBondContact O-N 2.98Å; R95-S98 VanDerWaalsContact O-N 3.14Å; R95-S98 PolarHBondContact O-OG 3.21Å; C96-S98 VanDerWaalsContact C-N 3.31Å; C96-S98 PolarHBondContact O-N 3.43Å; S98-K102 WeakPolarHBondContact O-CB 3.46Å; S98-K102 WeakPolarHBondContact O-CD 3.41Å; S98-K102 WeakPolarHBondContact O-CG 3.15Å; S98-K102 PolarHBondContact O-N 3.19Å
99	L	88.4	Confident	83.5	Confident	107 Å²	107	95.4 Å²	95.4	56%	0.56	47%	0.471	S	S	*	.	H	α-helix	trans	-73	-44.2	175.8	-66.4	172.7	0	0	0	110.6	R95 C96 R97 E101 K102 E103	R95-L99 WeakPolarHBondContact O-CG 3.41Å; R95-L99 PolarHBondContact O-N 2.98Å; R95-L99 VanDerWaalsContact O-N 3.09Å; C96-L99 WeakPolarHBondContact O-CB 3.39Å; C96-L99 PolarHBondContact O-N 3.02Å; R97-L99 VanDerWaalsContact C-N 3.25Å; R97-L99 PolarHBondContact O-N 3.32Å; L99-E101 PolarHBondContact O-N 3.04Å; L99-K102 PolarHBondContact O-N 3.44Å; L99-E103 PolarHBondContact O-N 2.96Å
100	V	86.8	Confident	82.4	Confident	50 Å²	50	101.5 Å²	101.5	30%	0.303	50%	0.503	S	S	.	.	H	α-helix	trans	-58.7	-46.5	175.7	-179.9	0	0	0	0	111.2	L49 C96 R97 K102 E103 G104	L49-V100 HydrophobicContact CD1-CG2 4.01Å; L49-V100 HydrophobicContact CD2-CG2 4.04Å; L49-V100 HydrophobicContact CG-CG2 4.21Å; C96-V100 WeakPolarHBondContact O-CG2 3.15Å; C96-V100 PolarHBondContact O-N 3.45Å; R97-V100 PolarHBondContact O-N 2.87Å; V100-K102 VanDerWaalsContact C-N 3.35Å; V100-K102 PolarHBondContact O-N 3.42Å; V100-E103 PolarHBondContact O-N 2.97Å; V100-G104 PolarHBondContact O-N 3.11Å
101	E	85	Confident	81.8	Confident	102 Å²	102	102.4 Å²	102.4	48%	0.477	51%	0.509	S	S	.	.	H	α-helix	trans	-65.7	-36.6	179.4	-72.4	174.2	-175.8	0	0	112.5	R97 L99 S105	R97-E101 IonicContact CZ-OE1 3.74Å; R97-E101 IonicContact NE-OE1 2.85Å; R97-E101 PolarHBondContact NE-OE1 2.98Å; R97-E101 IonicContact NH2-OE1 2.95Å; R97-E101 WeakPolarHBondContact O-CG 3.43Å; R97-E101 PolarHBondContact O-N 2.97Å; L99-E101 PolarHBondContact O-N 3.04Å; E101-S105 WeakPolarHBondContact O-CB 3.37Å; E101-S105 PolarHBondContact O-N 3.28Å; E101-S105 PolarHBondContact O-OG 3.44Å
102	K	81	Confident	81.4	Confident	135 Å²	135	106.5 Å²	106.5	59%	0.587	52%	0.523	S	S	*	.	H	α-helix	trans	-67.1	-38.8	175.3	-80	173.4	-175.9	175.2	0	112.1	S98 L99 V100 G104 S105 A106	S98-K102 WeakPolarHBondContact O-CB 3.46Å; S98-K102 WeakPolarHBondContact O-CD 3.41Å; S98-K102 WeakPolarHBondContact O-CG 3.15Å; S98-K102 PolarHBondContact O-N 3.19Å; L99-K102 PolarHBondContact O-N 3.44Å; V100-K102 VanDerWaalsContact C-N 3.35Å; V100-K102 PolarHBondContact O-N 3.42Å; K102-G104 VanDerWaalsContact C-N 3.35Å; K102-S105 PolarHBondContact O-N 3.22Å; K102-A106 WeakPolarHBondContact O-CB 3.46Å; K102-A106 PolarHBondContact O-N 3.29Å
103	E	73.9	Confident	81.1	Confident	130 Å²	130	111.4 Å²	111.4	61%	0.607	54%	0.544	S	S	*	.	H	α-helix	trans	-62.9	-43	177.3	-165.3	178.5	169.4	0	0	111.3	L49 L99 V100 S105	L49-E103 WeakPolarHBondContact CD1-OE2 3.17Å; L99-E103 PolarHBondContact O-N 2.96Å; V100-E103 PolarHBondContact O-N 2.97Å; E103-S105 PolarHBondContact O-N 3.32Å
104	G	70.5	Confident	80.8	Confident	50 Å²	50	110 Å²	110	52%	0.515	54%	0.54	S	S	.	.	H	α-helix	trans	-63.4	-38.2	173.5	0	0	0	0	0	113.5	V100 K102	V100-G104 PolarHBondContact O-N 3.11Å; K102-G104 VanDerWaalsContact C-N 3.35Å
105	S	66.1	Low	80.6	Confident	71 Å²	71	106.6 Å²	106.6	50%	0.497	53%	0.529	S	S	.	.	H	α-helix	trans	-86.6	-31.2	-175.5	-58.2	0	0	0	0	114.4	E101 K102 E103 R107 L108 K109	E101-S105 WeakPolarHBondContact O-CB 3.37Å; E101-S105 PolarHBondContact O-N 3.28Å; E101-S105 PolarHBondContact O-OG 3.44Å; K102-S105 PolarHBondContact O-N 3.22Å; E103-S105 PolarHBondContact O-N 3.32Å; S105-R107 PolarHBondContact O-N 3.2Å; S105-L108 WeakPolarHBondContact O-CB 3.33Å; S105-L108 PolarHBondContact O-N 3.23Å; S105-K109 PolarHBondContact O-N 2.72Å
106	A	61.4	Low	80.6	Confident	67 Å²	67	102.2 Å²	102.2	55%	0.554	52%	0.521	S	S	*	.	H	α-helix	trans	-61.6	-34.7	-179.6	0	0	0	0	0	111	K102 L108 K109	K102-A106 WeakPolarHBondContact O-CB 3.46Å; K102-A106 PolarHBondContact O-N 3.29Å; A106-L108 PolarHBondContact O-N 3.5Å; A106-K109 PolarHBondContact O-N 2.9Å
107	R	62.6	Low	80.6	Confident	234 Å²	234	108.8 Å²	108.8	88%	0.883	54%	0.543	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.8	-20.4	174.2	-154.4	174.9	-172.5	176.1	2.7	113.5	S105	S105-R107 PolarHBondContact O-N 3.2Å
108	L	67.7	Low	80.7	Confident	146 Å²	146	107.9 Å²	107.9	76%	0.764	54%	0.544	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.9	-5.8	-179.2	-61	176.9	0	0	0	113.8	S105 A106 L110	S105-L108 WeakPolarHBondContact O-CB 3.33Å; S105-L108 PolarHBondContact O-N 3.23Å; A106-L108 PolarHBondContact O-N 3.5Å; L108-L110 PolarHBondContact O-N 2.91Å
109	K	70.1	Confident	80.9	Confident	184 Å²	184	109.6 Å²	109.6	80%	0.8	55%	0.553	S	S	*	*			trans	-70.2	103	173.8	-83.8	-169	176.2	-177	0	109.3	S105 A106 D111	S105-K109 PolarHBondContact O-N 2.72Å; A106-K109 PolarHBondContact O-N 2.9Å; K109-D111 PolarHBondContact O-N 3.44Å; K109-D111 VanDerWaalsContact O-N 3.11Å
110	L	72.8	Confident	81.1	Confident	128 Å²	128	111.2 Å²	111.2	67%	0.67	56%	0.555	S	S	*	*			trans	-56.5	114.5	169.2	-178.1	70.6	0	0	0	109.3	L108 K112 T115	L108-L110 PolarHBondContact O-N 2.91Å; L110-K112 PolarHBondContact O-N 3.35Å; L110-T115 WeakPolarHBondContact CD1-OG1 3.45Å
111	D	82.5	Confident	81.4	Confident	93 Å²	93	113.5 Å²	113.5	50%	0.497	56%	0.562	S	S	.	*			trans	-68.5	98.4	169.2	-177.7	-15.1	0	0	0	108.6	K109 E113 A114 T115	K109-D111 PolarHBondContact O-N 3.44Å; K109-D111 VanDerWaalsContact O-N 3.11Å; D111-E113 PolarHBondContact O-N 3.41Å; D111-E113 WeakPolarHBondContact OD1-CA 3.34Å; D111-E113 WeakPolarHBondContact OD1-CB 3.37Å; D111-E113 PolarHBondContact OD1-N 3.36Å; D111-A114 HydrophobicContact CB-CB 3.84Å; D111-A114 VanDerWaalsContact CG-CB 3.41Å; D111-A114 PolarHBondContact O-N 2.92Å; D111-A114 PolarHBondContact OD1-N 3.24Å; D111-A114 WeakPolarHBondContact OD2-CB 3.45Å; D111-T115 WeakPolarHBondContact O-CB 3.31Å; D111-T115 PolarHBondContact O-N 2.93Å; D111-T115 PolarHBondContact O-OG1 2.87Å
112	K	87.3	Confident	81.8	Confident	165 Å²	165	111.4 Å²	111.4	72%	0.717	56%	0.563	S	S	*	*	H	α-helix	trans	-61.4	-33.5	179.9	-64.2	-174.5	-179.7	-177.3	0	111.7	L110 T116	L110-K112 PolarHBondContact O-N 3.35Å; K112-T116 WeakPolarHBondContact O-CB 3.41Å; K112-T116 PolarHBondContact O-N 2.88Å; K112-T116 PolarHBondContact O-OG1 3.16Å
113	E	89.3	Confident	82.3	Confident	116 Å²	116	110.2 Å²	110.2	54%	0.542	56%	0.562	S	S	.	*	H	α-helix	trans	-72.6	-48.8	-179	-163.2	-177.3	174.1	0	0	110	D111 T115 T116 R117	D111-E113 PolarHBondContact O-N 3.41Å; D111-E113 WeakPolarHBondContact OD1-CA 3.34Å; D111-E113 WeakPolarHBondContact OD1-CB 3.37Å; D111-E113 PolarHBondContact OD1-N 3.36Å; E113-T115 VanDerWaalsContact C-N 3.32Å; E113-T115 PolarHBondContact O-N 3.43Å; E113-T116 WeakPolarHBondContact O-CB 3.45Å; E113-T116 PolarHBondContact O-N 3.13Å; E113-T116 VanDerWaalsContact O-N 3.16Å; E113-R117 WeakPolarHBondContact O-CG 3.42Å; E113-R117 PolarHBondContact O-N 3.42Å; E113-R117 IonicContact OE1-CZ 3.29Å; E113-R117 VanDerWaalsContact OE1-CZ 3.29Å; E113-R117 IonicContact OE1-NH1 3.55Å; E113-R117 IonicContact OE1-NH2 2.65Å; E113-R117 PolarHBondContact OE1-NH2 2.65Å; E113-R117 IonicContact OE2-NH2 3.36Å; E113-R117 PolarHBondContact OE2-NH2 3.49Å
114	A	89.2	Confident	83.2	Confident	23 Å²	23	111.2 Å²	111.2	19%	0.19	56%	0.561	C	S	.	*	H	α-helix	trans	-58.3	-44.2	173	0	0	0	0	0	111.7	D111 T116 R117 F118	D111-A114 HydrophobicContact CB-CB 3.84Å; D111-A114 VanDerWaalsContact CG-CB 3.41Å; D111-A114 PolarHBondContact O-N 2.92Å; D111-A114 PolarHBondContact OD1-N 3.24Å; D111-A114 WeakPolarHBondContact OD2-CB 3.45Å; A114-T116 VanDerWaalsContact C-N 3.32Å; A114-T116 PolarHBondContact O-N 2.94Å; A114-R117 WeakPolarHBondContact O-CB 3.48Å; A114-R117 PolarHBondContact O-N 2.89Å; A114-R117 VanDerWaalsContact O-N 3.13Å; A114-F118 HydrophobicContact CB-CD2 4.49Å; A114-F118 HydrophobicContact CB-CE2 4.18Å; A114-F118 WeakPolarHBondContact O-CD2 3.35Å; A114-F118 WeakPolarHBondContact O-CG 3.31Å; A114-F118 PolarHBondContact O-N 3.46Å
115	T	90.1	Very high	84.1	Confident	50 Å²	50	114.2 Å²	114.2	31%	0.307	56%	0.559	S	S	.	*	H	α-helix	trans	-57.4	-45.3	175.2	-55.3	0	0	0	0	111.3	L110 D111 E113 R117 F118 V119	L110-T115 WeakPolarHBondContact CD1-OG1 3.45Å; D111-T115 WeakPolarHBondContact O-CB 3.31Å; D111-T115 PolarHBondContact O-N 2.93Å; D111-T115 PolarHBondContact O-OG1 2.87Å; E113-T115 VanDerWaalsContact C-N 3.32Å; E113-T115 PolarHBondContact O-N 3.43Å; T115-R117 VanDerWaalsContact C-N 3.33Å; T115-R117 PolarHBondContact O-N 2.71Å; T115-F118 PolarHBondContact O-N 2.96Å; T115-V119 VanDerWaalsContact O-CG2 3.31Å; T115-V119 WeakPolarHBondContact O-CG2 3.08Å; T115-V119 PolarHBondContact O-N 3.35Å
116	T	93.8	Very high	85.2	Confident	68 Å²	68	113.3 Å²	113.3	42%	0.417	55%	0.553	S	S	.	*	H	α-helix	trans	-62.3	-40.3	177.1	-58.8	0	0	0	0	111.6	K112 E113 A114 K120	K112-T116 WeakPolarHBondContact O-CB 3.41Å; K112-T116 PolarHBondContact O-N 2.88Å; K112-T116 PolarHBondContact O-OG1 3.16Å; E113-T116 WeakPolarHBondContact O-CB 3.45Å; E113-T116 PolarHBondContact O-N 3.13Å; E113-T116 VanDerWaalsContact O-N 3.16Å; A114-T116 VanDerWaalsContact C-N 3.32Å; A114-T116 PolarHBondContact O-N 2.94Å; T116-K120 HydrophobicContact CG2-CD 4.17Å; T116-K120 WeakPolarHBondContact O-CB 3.4Å; T116-K120 VanDerWaalsContact O-CG 3.31Å; T116-K120 WeakPolarHBondContact O-CG 3.27Å; T116-K120 PolarHBondContact O-N 3.38Å
117	R	93.7	Very high	86.4	Confident	151 Å²	151	112.5 Å²	112.5	57%	0.57	55%	0.546	S	S	*	.	H	α-helix	trans	-63.3	-45.6	174.5	-65.2	-177.2	-137	-99.1	6.9	111.4	E113 A114 T115 V119 K120 H121	E113-R117 WeakPolarHBondContact O-CG 3.42Å; E113-R117 PolarHBondContact O-N 3.42Å; E113-R117 IonicContact OE1-CZ 3.29Å; E113-R117 VanDerWaalsContact OE1-CZ 3.29Å; E113-R117 IonicContact OE1-NH1 3.55Å; E113-R117 IonicContact OE1-NH2 2.65Å; E113-R117 PolarHBondContact OE1-NH2 2.65Å; E113-R117 IonicContact OE2-NH2 3.36Å; E113-R117 PolarHBondContact OE2-NH2 3.49Å; A114-R117 WeakPolarHBondContact O-CB 3.48Å; A114-R117 PolarHBondContact O-N 2.89Å; A114-R117 VanDerWaalsContact O-N 3.13Å; T115-R117 VanDerWaalsContact C-N 3.33Å; T115-R117 PolarHBondContact O-N 2.71Å; R117-V119 PolarHBondContact O-N 2.95Å; R117-K120 PolarHBondContact O-N 3.32Å; R117-H121 VanDerWaalsContact O-CB 3.28Å; R117-H121 WeakPolarHBondContact O-CB 3.49Å; R117-H121 PolarHBondContact O-N 2.93Å
118	F	92.8	Very high	87.4	Confident	151 Å²	151	105.9 Å²	105.9	66%	0.662	53%	0.525	S	S	*	.	H	α-helix	trans	-60.3	-45.5	177.4	-72.2	-54.3	0	0	0	112	A114 T115 H121 A122	A114-F118 HydrophobicContact CB-CD2 4.49Å; A114-F118 HydrophobicContact CB-CE2 4.18Å; A114-F118 WeakPolarHBondContact O-CD2 3.35Å; A114-F118 WeakPolarHBondContact O-CG 3.31Å; A114-F118 PolarHBondContact O-N 3.46Å; T115-F118 PolarHBondContact O-N 2.96Å; F118-H121 PolarHBondContact O-N 3.34Å; F118-A122 WeakPolarHBondContact O-CB 3.36Å; F118-A122 PolarHBondContact O-N 3.45Å
119	V	93.8	Very high	88.2	Confident	80 Å²	80	103.3 Å²	103.3	49%	0.485	52%	0.516	S	S	.	.	H	α-helix	trans	-61.5	-50	176.9	172.1	0	0	0	0	110.8	T115 R117 H121 A122 L123	T115-V119 VanDerWaalsContact O-CG2 3.31Å; T115-V119 WeakPolarHBondContact O-CG2 3.08Å; T115-V119 PolarHBondContact O-N 3.35Å; R117-V119 PolarHBondContact O-N 2.95Å; V119-H121 VanDerWaalsContact C-N 3.35Å; V119-H121 PolarHBondContact O-N 3.43Å; V119-A122 PolarHBondContact O-N 3.41Å; V119-L123 HydrophobicContact CG1-CD1 3.93Å; V119-L123 HydrophobicContact CG1-CG 4.39Å; V119-L123 WeakPolarHBondContact O-CB 3.45Å; V119-L123 VanDerWaalsContact O-CG 3.27Å; V119-L123 WeakPolarHBondContact O-CG 3.48Å; V119-L123 PolarHBondContact O-N 2.91Å
120	K	93.2	Very high	88.5	Confident	141 Å²	141	101.6 Å²	101.6	61%	0.613	51%	0.508	S	S	*	.	H	α-helix	trans	-59.3	-44.8	179	-76	178.4	179.2	-179.1	0	112.2	T116 R117 L123 W124	T116-K120 HydrophobicContact CG2-CD 4.17Å; T116-K120 WeakPolarHBondContact O-CB 3.4Å; T116-K120 VanDerWaalsContact O-CG 3.31Å; T116-K120 WeakPolarHBondContact O-CG 3.27Å; T116-K120 PolarHBondContact O-N 3.38Å; R117-K120 PolarHBondContact O-N 3.32Å; K120-L123 PolarHBondContact O-N 3.38Å; K120-W124 WeakPolarHBondContact O-CB 3.3Å; K120-W124 PolarHBondContact O-N 3.39Å
121	H	93.1	Very high	88.8	Confident	98 Å²	98	99 Å²	99	45%	0.454	50%	0.498	S	S	.	.	H	α-helix	trans	-67.1	-40.2	-179.9	176.7	-103.2	0	0	0	112.4	R117 F118 V119 W124 K125	R117-H121 VanDerWaalsContact O-CB 3.28Å; R117-H121 WeakPolarHBondContact O-CB 3.49Å; R117-H121 PolarHBondContact O-N 2.93Å; F118-H121 PolarHBondContact O-N 3.34Å; V119-H121 VanDerWaalsContact C-N 3.35Å; V119-H121 PolarHBondContact O-N 3.43Å; H121-W124 PolarHBondContact O-N 3.3Å; H121-K125 WeakPolarHBondContact CE1-CE 3.32Å; H121-K125 PolarHBondContact CE1-NZ 3.4Å; H121-K125 VanDerWaalsContact CE1-NZ 3.32Å; H121-K125 VanDerWaalsContact NE2-CE 3.27Å; H121-K125 WeakPolarHBondContact NE2-CE 3.28Å; H121-K125 WeakPolarHBondContact O-CB 3.27Å; H121-K125 PolarHBondContact O-N 2.73Å
122	A	92.8	Very high	88.7	Confident	59 Å²	59	101.4 Å²	101.4	49%	0.488	50%	0.504	S	S	.	.	H	α-helix	trans	-63.1	-44.7	174.5	0	0	0	0	0	111.9	F118 V119 K125 S126	F118-A122 WeakPolarHBondContact O-CB 3.36Å; F118-A122 PolarHBondContact O-N 3.45Å; V119-A122 PolarHBondContact O-N 3.41Å; A122-K125 PolarHBondContact O-N 2.91Å; A122-S126 WeakPolarHBondContact O-CB 3.17Å; A122-S126 PolarHBondContact O-N 3.27Å
123	L	92.6	Very high	88.3	Confident	110 Å²	110	100.2 Å²	100.2	58%	0.576	50%	0.499	S	S	*	.	H	α-helix	trans	-60.6	-46.4	175.1	-69.6	174.5	0	0	0	111.3	V119 K120 K125 S126 A127	V119-L123 HydrophobicContact CG1-CD1 3.93Å; V119-L123 HydrophobicContact CG1-CG 4.39Å; V119-L123 WeakPolarHBondContact O-CB 3.45Å; V119-L123 VanDerWaalsContact O-CG 3.27Å; V119-L123 WeakPolarHBondContact O-CG 3.48Å; V119-L123 PolarHBondContact O-N 2.91Å; K120-L123 PolarHBondContact O-N 3.38Å; L123-K125 PolarHBondContact O-N 3.07Å; L123-S126 PolarHBondContact O-N 3.46Å; L123-S126 PolarHBondContact O-OG 3.5Å; L123-A127 PolarHBondContact O-N 3.43Å
124	W	92.5	Very high	87.8	Confident	151 Å²	151	104.1 Å²	104.1	57%	0.572	51%	0.508	S	S	*	.	H	α-helix	trans	-61.4	-45.9	178.5	-174.3	92	0	0	0	112.3	K120 H121 S126 A127 H128	K120-W124 WeakPolarHBondContact O-CB 3.3Å; K120-W124 PolarHBondContact O-N 3.39Å; H121-W124 PolarHBondContact O-N 3.3Å; W124-S126 PolarHBondContact O-N 2.97Å; W124-A127 PolarHBondContact O-N 3.09Å; W124-H128 AromaticContact CD1-CE1 3.65Å; W124-H128 AromaticContact CD1-ND1 3.96Å; W124-H128 AromaticContact CD2-CE1 3.8Å; W124-H128 AromaticContact CD2-ND1 3.59Å; W124-H128 AromaticContact CE2-CE1 3.18Å; W124-H128 AromaticContact CE2-ND1 3.42Å; W124-H128 AromaticContact CE2-NE2 3.67Å; W124-H128 AromaticContact CG-ND1 3.93Å; W124-H128 AromaticContact CZ2-CD2 3.79Å; W124-H128 AromaticContact CZ2-CE1 3.53Å; W124-H128 AromaticContact CZ2-CG 3.97Å; W124-H128 AromaticContact CZ2-ND1 3.8Å; W124-H128 AromaticContact CZ2-NE2 3.52Å; W124-H128 AromaticContact NE1-CE1 3.09Å; W124-H128 PolarHBondContact NE1-CE1 3.15Å; W124-H128 AromaticContact NE1-ND1 3.68Å; W124-H128 AromaticContact NE1-NE2 3.8Å; W124-H128 PolarHBondContact O-N 2.94Å; W124-H128 VanDerWaalsContact O-N 3.11Å; W124-H128 PolarHBondContact O-ND1 2.83Å
125	K	89.6	Confident	87.2	Confident	113 Å²	113	111.8 Å²	111.8	49%	0.491	53%	0.533	S	S	.	.	H	α-helix	trans	-60	-44.2	175.3	-81	-171.8	167.6	-179.9	0	111.7	H121 A122 L123 A127 H128 T129	H121-K125 WeakPolarHBondContact CE1-CE 3.32Å; H121-K125 PolarHBondContact CE1-NZ 3.4Å; H121-K125 VanDerWaalsContact CE1-NZ 3.32Å; H121-K125 VanDerWaalsContact NE2-CE 3.27Å; H121-K125 WeakPolarHBondContact NE2-CE 3.28Å; H121-K125 WeakPolarHBondContact O-CB 3.27Å; H121-K125 PolarHBondContact O-N 2.73Å; A122-K125 PolarHBondContact O-N 2.91Å; L123-K125 PolarHBondContact O-N 3.07Å; K125-A127 VanDerWaalsContact C-N 3.3Å; K125-A127 PolarHBondContact O-N 2.87Å; K125-H128 PolarHBondContact O-N 3.32Å; K125-T129 WeakPolarHBondContact O-CG2 3.34Å; K125-T129 PolarHBondContact O-N 3.48Å; K125-T129 PolarHBondContact O-OG1 3.34Å; K125-T129 VanDerWaalsContact O-OG1 3.05Å
126	S	88.3	Confident	86.5	Confident	52 Å²	52	115.2 Å²	115.2	36%	0.364	55%	0.546	S	S	.	.	H	α-helix	trans	-62.9	-35.2	179.5	78.6	0	0	0	0	113.1	A122 L123 W124 T129 K130	A122-S126 WeakPolarHBondContact O-CB 3.17Å; A122-S126 PolarHBondContact O-N 3.27Å; L123-S126 PolarHBondContact O-N 3.46Å; L123-S126 PolarHBondContact O-OG 3.5Å; W124-S126 PolarHBondContact O-N 2.97Å; S126-T129 PolarHBondContact O-OG1 3.07Å; S126-K130 VanDerWaalsContact O-CG 3.3Å; S126-K130 WeakPolarHBondContact O-CG 3.39Å; S126-K130 PolarHBondContact O-N 3.45Å
127	A	86.7	Confident	85.7	Confident	50 Å²	50	116.9 Å²	116.9	41%	0.413	55%	0.553	S	S	.	*	H	α-helix	trans	-70.4	-41	176.4	0	0	0	0	0	111.8	L123 W124 K125 T131	L123-A127 PolarHBondContact O-N 3.43Å; W124-A127 PolarHBondContact O-N 3.09Å; K125-A127 VanDerWaalsContact C-N 3.3Å; K125-A127 PolarHBondContact O-N 2.87Å; A127-T131 PolarHBondContact O-N 3.05Å; A127-T131 VanDerWaalsContact O-N 3.15Å; A127-T131 PolarHBondContact O-OG1 3.11Å
128	H	84.2	Confident	84.9	Confident	95 Å²	95	114 Å²	114	44%	0.44	56%	0.556	S	S	.	*	H	α-helix	trans	-75.3	-36.4	-178.4	-74	72	0	0	0	112.8	W124 K125 T131 K132	W124-H128 AromaticContact CD1-CE1 3.65Å; W124-H128 AromaticContact CD1-ND1 3.96Å; W124-H128 AromaticContact CD2-CE1 3.8Å; W124-H128 AromaticContact CD2-ND1 3.59Å; W124-H128 AromaticContact CE2-CE1 3.18Å; W124-H128 AromaticContact CE2-ND1 3.42Å; W124-H128 AromaticContact CE2-NE2 3.67Å; W124-H128 AromaticContact CG-ND1 3.93Å; W124-H128 AromaticContact CZ2-CD2 3.79Å; W124-H128 AromaticContact CZ2-CE1 3.53Å; W124-H128 AromaticContact CZ2-CG 3.97Å; W124-H128 AromaticContact CZ2-ND1 3.8Å; W124-H128 AromaticContact CZ2-NE2 3.52Å; W124-H128 AromaticContact NE1-CE1 3.09Å; W124-H128 PolarHBondContact NE1-CE1 3.15Å; W124-H128 AromaticContact NE1-ND1 3.68Å; W124-H128 AromaticContact NE1-NE2 3.8Å; W124-H128 PolarHBondContact O-N 2.94Å; W124-H128 VanDerWaalsContact O-N 3.11Å; W124-H128 PolarHBondContact O-ND1 2.83Å; K125-H128 PolarHBondContact O-N 3.32Å; H128-T131 PolarHBondContact O-N 2.92Å; H128-K132 WeakPolarHBondContact O-CB 3.3Å; H128-K132 PolarHBondContact O-N 3.28Å
129	T	82.9	Confident	83.8	Confident	91 Å²	91	111.9 Å²	111.9	56%	0.558	56%	0.559	S	S	*	*	H	α-helix	trans	-66.4	-41.4	175.8	53.3	0	0	0	0	111.8	K125 S126 T131 K132 K133	K125-T129 WeakPolarHBondContact O-CG2 3.34Å; K125-T129 PolarHBondContact O-N 3.48Å; K125-T129 PolarHBondContact O-OG1 3.34Å; K125-T129 VanDerWaalsContact O-OG1 3.05Å; S126-T129 PolarHBondContact O-OG1 3.07Å; T129-T131 VanDerWaalsContact C-N 3.34Å; T129-T131 PolarHBondContact O-N 3.27Å; T129-K132 PolarHBondContact O-N 3.29Å; T129-K133 WeakPolarHBondContact O-CB 3.43Å; T129-K133 PolarHBondContact O-N 3.41Å
130	K	78.4	Confident	82.2	Confident	148 Å²	148	116.8 Å²	116.8	64%	0.643	59%	0.59	S	S	*	*	H	α-helix	trans	-60.1	-43.8	173	-75.5	179.9	-179.9	-177.6	0	111.8	S126 K133 R134	S126-K130 VanDerWaalsContact O-CG 3.3Å; S126-K130 WeakPolarHBondContact O-CG 3.39Å; S126-K130 PolarHBondContact O-N 3.45Å; K130-K133 PolarHBondContact O-N 3.33Å; K130-R134 WeakPolarHBondContact O-CG 3.44Å; K130-R134 PolarHBondContact O-N 3.19Å; K130-R134 VanDerWaalsContact O-N 3.07Å
131	T	78.4	Confident	81.6	Confident	74 Å²	74	115.6 Å²	115.6	45%	0.454	59%	0.589	S	S	.	*	H	α-helix	trans	-67	-41.8	179	-54.8	0	0	0	0	111.8	A127 H128 T129 R134 R135	A127-T131 PolarHBondContact O-N 3.05Å; A127-T131 VanDerWaalsContact O-N 3.15Å; A127-T131 PolarHBondContact O-OG1 3.11Å; H128-T131 PolarHBondContact O-N 2.92Å; T129-T131 VanDerWaalsContact C-N 3.34Å; T129-T131 PolarHBondContact O-N 3.27Å; T131-R134 PolarHBondContact O-N 2.95Å; T131-R135 PolarHBondContact O-N 3.04Å; T131-R135 VanDerWaalsContact O-N 3.13Å
132	K	79.5	Confident	81	Confident	144 Å²	144	116.5 Å²	116.5	63%	0.626	60%	0.596	S	S	*	*	H	α-helix	trans	-62.8	-43.1	175.8	-172.5	177.6	179.9	-178.3	0	111.6	H128 T129 R135 M136	H128-K132 WeakPolarHBondContact O-CB 3.3Å; H128-K132 PolarHBondContact O-N 3.28Å; T129-K132 PolarHBondContact O-N 3.29Å; K132-R135 PolarHBondContact O-N 2.87Å; K132-M136 HydrophobicContact CG-SD 4.44Å; K132-M136 WeakPolarHBondContact O-CG 3.38Å; K132-M136 PolarHBondContact O-N 3.13Å
133	K	79	Confident	80.3	Confident	139 Å²	139	119.7 Å²	119.7	60%	0.604	60%	0.602	S	S	*	*	H	α-helix	trans	-59.9	-48.1	176.1	-176.2	171.6	178.4	174.6	0	111.7	T129 K130 R135 M136 D137	T129-K133 WeakPolarHBondContact O-CB 3.43Å; T129-K133 PolarHBondContact O-N 3.41Å; K130-K133 PolarHBondContact O-N 3.33Å; K133-R135 VanDerWaalsContact C-N 3.28Å; K133-R135 PolarHBondContact O-N 3.39Å; K133-M136 PolarHBondContact O-N 3.3Å; K133-M136 VanDerWaalsContact O-N 3.11Å; K133-D137 VanDerWaalsContact O-CG 3.3Å; K133-D137 PolarHBondContact O-N 3.41Å
134	R	78.5	Confident	79.6	Confident	198 Å²	198	120.2 Å²	120.2	75%	0.747	60%	0.603	S	S	*	*	H	α-helix	trans	-59.4	-35.8	177.2	-70.2	179.5	74.6	-178.3	4.6	113.5	K130 T131 S138	K130-R134 WeakPolarHBondContact O-CG 3.44Å; K130-R134 PolarHBondContact O-N 3.19Å; K130-R134 VanDerWaalsContact O-N 3.07Å; T131-R134 PolarHBondContact O-N 2.95Å; R134-S138 PolarHBondContact O-N 3.11Å; R134-S138 PolarHBondContact O-OG 2.93Å
135	R	77.1	Confident	78.8	Confident	185 Å²	185	118.3 Å²	118.3	70%	0.698	61%	0.605	S	S	*	*	H	α-helix	trans	-70.5	-38.7	175.7	-74.2	-174.1	173.9	-174.2	-1.6	112.4	T131 K132 K133 S138 S139	T131-R135 PolarHBondContact O-N 3.04Å; T131-R135 VanDerWaalsContact O-N 3.13Å; K132-R135 PolarHBondContact O-N 2.87Å; K133-R135 VanDerWaalsContact C-N 3.28Å; K133-R135 PolarHBondContact O-N 3.39Å; R135-S138 PolarHBondContact O-N 3.29Å; R135-S138 PolarHBondContact O-OG 3.17Å; R135-S139 PolarHBondContact O-OG 2.79Å
136	M	76	Confident	78.1	Confident	121 Å²	121	118.7 Å²	118.7	60%	0.596	61%	0.613	S	S	*	*	H	α-helix	trans	-67.1	-41.7	176.2	-69.4	-177	70.8	0	0	111.7	K132 K133 S138 S139	K132-M136 HydrophobicContact CG-SD 4.44Å; K132-M136 WeakPolarHBondContact O-CG 3.38Å; K132-M136 PolarHBondContact O-N 3.13Å; K133-M136 PolarHBondContact O-N 3.3Å; K133-M136 VanDerWaalsContact O-N 3.11Å; M136-S138 PolarHBondContact O-N 3.26Å; M136-S139 PolarHBondContact O-N 3.41Å; M136-S139 VanDerWaalsContact O-N 3.17Å
137	D	76.2	Confident	77.4	Confident	104 Å²	104	123.4 Å²	123.4	56%	0.556	63%	0.631	S	S	*	*	H	α-helix	trans	-64.9	-25.3	177.8	-63.4	-19.6	0	0	0	112.5	K133	K133-D137 VanDerWaalsContact O-CG 3.3Å; K133-D137 PolarHBondContact O-N 3.41Å
138	S	76.7	Confident	76.7	Confident	90 Å²	90	129.1 Å²	129.1	63%	0.629	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.9	-8.9	176.6	62.1	0	0	0	0	115.1	R134 R135 M136	R134-S138 PolarHBondContact O-N 3.11Å; R134-S138 PolarHBondContact O-OG 2.93Å; R135-S138 PolarHBondContact O-N 3.29Å; R135-S138 PolarHBondContact O-OG 3.17Å; M136-S138 PolarHBondContact O-N 3.26Å
139	S	69.8	Low	76	Confident	106 Å²	106	131.9 Å²	131.9	74%	0.741	67%	0.665	S	S	*	*			trans	-108	5.6	-177.2	-59.3	0	0	0	0	113.5	R135 M136	R135-S139 PolarHBondContact O-OG 2.79Å; M136-S139 PolarHBondContact O-N 3.41Å; M136-S139 VanDerWaalsContact O-N 3.17Å
140	T	60	Low	75.4	Confident	183 Å²	183	135.6 Å²	135.6	100%	1.123	67%	0.674	S	S	*	*			trans	-108.4	0	170	-50.2	0	0	0	0	108.4

Retrieved 140 of 140 residues in 28.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).