IF5A_SCHMA Loading...

Eukaryotic translation initiation factor 5A

Translation factor that promotes translation elongation and termination, particularly upon ribosome stalling at specific amino acid sequence contexts (By similarity). Binds between the exit (E) and peptidyl (P) site of the ribosome and promotes rescue of stalled ribosome: specifically required for efficient translation of polyproline-containing peptides as well as other motifs that stall the ribosome (By similarity). Acts as a ribosome quality control (RQC) cofactor by joining the RQC complex to facilitate peptidyl transfer during CAT tailing step (By similarity).

AlphaFold DB , UniProt , Accession Q26571, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 52 aa.

						>IF5A_SCHMA|Q26571
MGDFGASKTLPKQCSALRKGGHVVMKDRPCKIVEMSTSKTGKHGSAKVHLVG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.5	Low	79.1	Confident	242 Å²	242	136.2 Å²	136.2	100%	1.192	80%	0.799	S	S	*	*				0	100	0	-161.9	70.5	171.3	0	0	106.1
2	G	65.7	Low	80.3	Confident	58 Å²	58	136.8 Å²	136.8	60%	0.598	78%	0.784	S	S	*	*			trans	-89.1	125.6	-169.6	0	0	0	0	0	111.5	F4	G2-F4 VanDerWaalsContact C-N 3.27Å; G2-F4 WeakPolarHBondContact O-CD2 3.35Å; G2-F4 PolarHBondContact O-N 3.29Å
3	D	71.1	Confident	81.3	Confident	168 Å²	168	137.3 Å²	137.3	90%	0.898	78%	0.776	S	S	*	*			trans	-63.6	90.4	161.3	-74.6	-89.1	0	0	0	108.3	G5	D3-G5 PolarHBondContact O-N 3.21Å
4	F	72.2	Confident	82	Confident	195 Å²	195	132.7 Å²	132.7	86%	0.855	76%	0.756	S	S	*	*			trans	-65.3	85.6	171.4	-75	-83.2	0	0	0	109.3	G2 A6	G2-F4 VanDerWaalsContact C-N 3.27Å; G2-F4 WeakPolarHBondContact O-CD2 3.35Å; G2-F4 PolarHBondContact O-N 3.29Å; F4-A6 PolarHBondContact O-N 2.81Å
5	G	77.2	Confident	82.5	Confident	82 Å²	82	127.8 Å²	127.8	85%	0.845	73%	0.733	S	S	*	*			trans	40.4	21.1	152.1	0	0	0	0	0	119.5	D3 S7	D3-G5 PolarHBondContact O-N 3.21Å; G5-S7 PolarHBondContact O-N 2.83Å
6	A	83.3	Confident	83.1	Confident	86 Å²	86	122.3 Å²	122.3	71%	0.711	71%	0.707	S	S	*	*			trans	-71.1	130.4	-171.8	0	0	0	0	0	109.1	F4 K8	F4-A6 PolarHBondContact O-N 2.81Å; A6-K8 PolarHBondContact O-N 3.18Å
7	S	85.1	Confident	83.7	Confident	86 Å²	86	116 Å²	116	60%	0.601	67%	0.67	S	S	*	*			trans	-61.6	129.9	175.8	-179.9	0	0	0	0	109.8	G5 T9	G5-S7 PolarHBondContact O-N 2.83Å; S7-T9 PolarHBondContact O-N 2.9Å; S7-T9 PolarHBondContact OG-N 2.76Å; S7-T9 PolarHBondContact OG-O 3.02Å
8	K	86.2	Confident	84.1	Confident	212 Å²	212	119.2 Å²	119.2	92%	0.922	67%	0.67	S	S	*	*	S	Bend	trans	-76	-5.1	174.7	-60.9	-179.6	-178.3	179	0	112.8	A6	A6-K8 PolarHBondContact O-N 3.18Å
9	T	91.5	Very high	84.6	Confident	77 Å²	77	121.5 Å²	121.5	47%	0.472	67%	0.672	S	S	.	*			trans	-135.3	149.6	-174.7	65.4	0	0	0	0	111	S7 V24	S7-T9 PolarHBondContact O-N 2.9Å; S7-T9 PolarHBondContact OG-N 2.76Å; S7-T9 PolarHBondContact OG-O 3.02Å; T9-V24 HydrophobicContact CG2-CG2 3.81Å
10	L	91.7	Very high	85.1	Confident	159 Å²	159	117.2 Å²	117.2	83%	0.832	66%	0.656	S	S	*	*			trans	-124.6	134.3	176.5	-63.7	171.6	0	0	0	109
11	P	93	Very high	85.5	Confident	133 Å²	133	112.8 Å²	112.8	86%	0.864	64%	0.638	S	S	*	*			trans	-70	140.2	175.4	29.4	-33.8	0	0	0	110.4
12	K	93.2	Very high	87.5	Confident	143 Å²	143	108.4 Å²	108.4	62%	0.622	61%	0.614	S	S	*	*			trans	-144.8	145.4	175.6	-169.4	167.8	-179	-179.5	0	110.3	C14 A16 L17	K12-C14 PolarHBondContact O-N 2.99Å; K12-A16 HydrophobicContact CD-CB 4.43Å; K12-A16 VanDerWaalsContact CE-O 3.31Å; K12-A16 WeakPolarHBondContact CE-O 3.37Å; K12-A16 HydrophobicContact CG-CB 4.15Å; K12-A16 PolarHBondContact NZ-O 3.28Å; K12-L17 HydrophobicContact CD-CD2 4.32Å
13	Q	93.2	Very high	88.9	Confident	144 Å²	144	107.1 Å²	107.1	67%	0.673	59%	0.594	S	S	*	*			trans	-62.4	134.6	175.3	-165.6	-177.5	8.2	0	0	110.3	S15 A16	Q13-S15 VanDerWaalsContact CG-OG 3.31Å; Q13-S15 WeakPolarHBondContact CG-OG 3.31Å; Q13-S15 PolarHBondContact NE2-OG 3.46Å; Q13-S15 PolarHBondContact O-N 3.33Å; Q13-S15 PolarHBondContact OE1-OG 3.38Å; Q13-A16 HydrophobicContact CB-CB 4.44Å; Q13-A16 WeakPolarHBondContact O-CB 3.31Å; Q13-A16 PolarHBondContact O-N 2.94Å
14	C	90.6	Very high	90.1	Very high	73 Å²	73	102.5 Å²	102.5	49%	0.493	57%	0.572	S	S	.	*	G	3₁₀ helix	trans	-57.8	-33.3	-177.8	-73	0	0	0	0	113.3	K12 A16 L17 M35 V48	K12-C14 PolarHBondContact O-N 2.99Å; C14-A16 VanDerWaalsContact C-N 3.25Å; C14-A16 PolarHBondContact O-N 3.18Å; C14-L17 WeakPolarHBondContact O-CB 3.44Å; C14-L17 PolarHBondContact O-N 3.37Å; C14-M35 WeakPolarHBondContact O-CE 3.39Å; C14-V48 HydrophobicContact CB-CB 4.46Å; C14-V48 HydrophobicContact CB-CG2 4.41Å
15	S	89.8	Confident	91.1	Very high	59 Å²	59	95.6 Å²	95.6	41%	0.413	54%	0.543	S	S	.	.	G	3₁₀ helix	trans	-68.5	-21.9	176.5	54.4	0	0	0	0	113.8	Q13 L17	Q13-S15 VanDerWaalsContact CG-OG 3.31Å; Q13-S15 WeakPolarHBondContact CG-OG 3.31Å; Q13-S15 PolarHBondContact NE2-OG 3.46Å; Q13-S15 PolarHBondContact O-N 3.33Å; Q13-S15 PolarHBondContact OE1-OG 3.38Å; S15-L17 VanDerWaalsContact C-N 3.32Å
16	A	92.4	Very high	91.8	Very high	39 Å²	39	100.7 Å²	100.7	32%	0.322	54%	0.542	S	S	.	.	G	3₁₀ helix	trans	-88.4	-2.1	178.3	0	0	0	0	0	112.8	K12 Q13 C14	K12-A16 HydrophobicContact CD-CB 4.43Å; K12-A16 VanDerWaalsContact CE-O 3.31Å; K12-A16 WeakPolarHBondContact CE-O 3.37Å; K12-A16 HydrophobicContact CG-CB 4.15Å; K12-A16 PolarHBondContact NZ-O 3.28Å; Q13-A16 HydrophobicContact CB-CB 4.44Å; Q13-A16 WeakPolarHBondContact O-CB 3.31Å; Q13-A16 PolarHBondContact O-N 2.94Å; C14-A16 VanDerWaalsContact C-N 3.25Å; C14-A16 PolarHBondContact O-N 3.18Å
17	L	92.6	Very high	92.3	Very high	16 Å²	16	104.1 Å²	104.1	8%	0.084	55%	0.548	C	S	.	.			trans	-74.5	152.9	170.5	-61.7	176.4	0	0	0	110.3	K12 C14 S15 V23 I32 M35 L50	K12-L17 HydrophobicContact CD-CD2 4.32Å; C14-L17 WeakPolarHBondContact O-CB 3.44Å; C14-L17 PolarHBondContact O-N 3.37Å; S15-L17 VanDerWaalsContact C-N 3.32Å; L17-V23 HydrophobicContact CD1-CB 4.39Å; L17-V23 HydrophobicContact CD1-CG2 4.07Å; L17-I32 HydrophobicContact CB-CD1 3.78Å; L17-I32 HydrophobicContact CD1-CD1 4.18Å; L17-I32 HydrophobicContact CD2-CD1 4.27Å; L17-I32 HydrophobicContact CG-CD1 4.3Å; L17-M35 WeakPolarHBondContact O-CE 3.31Å; L17-L50 HydrophobicContact CD1-CD1 3.57Å
18	R	92.1	Very high	92.7	Very high	174 Å²	174	108 Å²	108	66%	0.657	55%	0.55	S	S	*	.			trans	-141.8	156	-179.8	-63.2	-65.3	-173.3	-154.8	3	109.4	G20 G21	R18-G20 PolarHBondContact O-N 3.42Å; R18-G21 PolarHBondContact O-N 2.85Å
19	K	94	Very high	93.1	Very high	162 Å²	162	103.4 Å²	103.4	70%	0.704	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.8	135.2	169.9	-178	171.2	177.1	164	0	110	G21 V33	K19-G21 VanDerWaalsContact C-N 3.28Å; K19-G21 PolarHBondContact O-N 3.06Å; K19-V33 VanDerWaalsContact CD-O 3.31Å; K19-V33 WeakPolarHBondContact CD-O 3.48Å; K19-V33 WeakPolarHBondContact CE-O 3.33Å; K19-V33 PolarHBondContact NZ-O 2.86Å
20	G	93.8	Very high	93.4	Very high	35 Å²	35	100.7 Å²	100.7	36%	0.361	53%	0.526	S	S	.	.	T	Hydrogen-bonded Turn	trans	85	-11.5	-173.9	0	0	0	0	0	115	R18 I32	R18-G20 PolarHBondContact O-N 3.42Å; G20-I32 PolarHBondContact N-O 3.43Å
21	G	94.2	Very high	93.6	Very high	26 Å²	26	99 Å²	99	27%	0.268	51%	0.512	S	S	.	.			trans	-72.2	171.5	172.2	0	0	0	0	0	113	R18 K19 K31 I32	R18-G21 PolarHBondContact O-N 2.85Å; K19-G21 VanDerWaalsContact C-N 3.28Å; K19-G21 PolarHBondContact O-N 3.06Å; G21-K31 WeakPolarHBondContact O-CA 3.2Å; G21-I32 PolarHBondContact O-N 3.35Å
22	H	94.9	Very high	93.7	Very high	149 Å²	149	92.7 Å²	92.7	69%	0.69	47%	0.47	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108	139.9	177.7	-61.7	88.9	0	0	0	110.5	C30	H22-C30 WeakPolarHBondContact CA-O 3.42Å
23	V	95.3	Very high	93.9	Very high	32 Å²	32	89.6 Å²	89.6	19%	0.194	46%	0.463	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.8	149.6	175.7	62.6	0	0	0	0	108.6	L17 M25 C30 I32	L17-V23 HydrophobicContact CD1-CB 4.39Å; L17-V23 HydrophobicContact CD1-CG2 4.07Å; V23-M25 HydrophobicContact CG1-CE 3.38Å; V23-M25 HydrophobicContact CG1-CG 3.94Å; V23-C30 PolarHBondContact N-O 3.38Å; V23-C30 PolarHBondContact O-N 2.84Å; V23-I32 HydrophobicContact CB-CD1 4.21Å; V23-I32 HydrophobicContact CB-CG1 4.27Å; V23-I32 HydrophobicContact CG1-CD1 4.02Å; V23-I32 HydrophobicContact CG1-CG1 3.57Å
24	V	95.4	Very high	93.9	Very high	71 Å²	71	88.3 Å²	88.3	43%	0.43	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.7	116	173.2	-178.2	0	0	0	0	108.3	T9 R28	T9-V24 HydrophobicContact CG2-CG2 3.81Å; V24-R28 CarbonylContact C-O 3.59Å; V24-R28 WeakPolarHBondContact CA-O 3.43Å
25	M	93.2	Very high	94.1	Very high	50 Å²	50	87.2 Å²	87.2	25%	0.246	45%	0.445	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	118.2	175.4	-58.2	-169.3	-166.8	0	0	109.3	V23 D27 R28 C30 L50	V23-M25 HydrophobicContact CG1-CE 3.38Å; V23-M25 HydrophobicContact CG1-CG 3.94Å; M25-D27 PolarHBondContact O-N 3.08Å; M25-R28 PolarHBondContact N-O 3.19Å; M25-R28 PolarHBondContact O-N 3.43Å; M25-C30 HydrophobicContact CG-CB 4.26Å; M25-C30 HydrophobicContact SD-CB 4.46Å; M25-L50 HydrophobicContact CE-CB 3.75Å
26	K	93.1	Very high	94.2	Very high	189 Å²	189	87.3 Å²	87.3	82%	0.822	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.1	54.3	-178.2	-55.9	179.1	179.5	-178.5	0	111.9	R28	K26-R28 PolarHBondContact O-N 2.84Å
27	D	92.5	Very high	94.2	Very high	158 Å²	158	89.5 Å²	89.5	85%	0.845	46%	0.456	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.8	9.1	-177.8	-58.1	-66.1	0	0	0	116.2	M25	M25-D27 PolarHBondContact O-N 3.08Å
28	R	94.7	Very high	94.1	Very high	168 Å²	168	90.6 Å²	90.6	63%	0.634	47%	0.465	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.9	128.7	177	-63.6	-172.8	-62.4	170.7	4.3	111.4	V24 M25 K26 C30	V24-R28 CarbonylContact C-O 3.59Å; V24-R28 WeakPolarHBondContact CA-O 3.43Å; M25-R28 PolarHBondContact N-O 3.19Å; M25-R28 PolarHBondContact O-N 3.43Å; K26-R28 PolarHBondContact O-N 2.84Å; R28-C30 PolarHBondContact O-N 3.35Å
29	P	94.8	Very high	94	Very high	114 Å²	114	89.6 Å²	89.6	74%	0.74	47%	0.465	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.9	124	171.8	28.6	-32.6	0	0	0	110
30	C	96.3	Very high	93.7	Very high	21 Å²	21	86 Å²	86	14%	0.142	46%	0.457	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	148.8	-176.1	-80.4	0	0	0	0	110.4	H22 V23 M25 R28 G52	H22-C30 WeakPolarHBondContact CA-O 3.42Å; V23-C30 PolarHBondContact N-O 3.38Å; V23-C30 PolarHBondContact O-N 2.84Å; M25-C30 HydrophobicContact CG-CB 4.26Å; M25-C30 HydrophobicContact SD-CB 4.46Å; R28-C30 PolarHBondContact O-N 3.35Å; C30-G52 WeakPolarHBondContact CB-OXT 3.38Å; C30-G52 PolarHBondContact SG-OXT 2.98Å; C30-G52 VanDerWaalsContact SG-OXT 3.35Å
31	K	95.9	Very high	93.5	Very high	124 Å²	124	86.2 Å²	86.2	54%	0.539	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95	126.5	171.6	-179.6	-179.3	179.8	178.5	0	108.6	G21 V33 G52	G21-K31 WeakPolarHBondContact O-CA 3.2Å; K31-V33 PolarHBondContact O-N 2.96Å; K31-V33 VanDerWaalsContact O-N 3.08Å; K31-G52 WeakPolarHBondContact O-CA 3.42Å
32	I	95.9	Very high	93.2	Very high	0 Å²	0	94.3 Å²	94.3	0%	0	49%	0.487	C	S	.	.			trans	-68.4	110.6	-179.9	-57.1	168.7	0	0	0	109.1	L17 G20 G21 V23 E34 M35 L50 V51	L17-I32 HydrophobicContact CB-CD1 3.78Å; L17-I32 HydrophobicContact CD1-CD1 4.18Å; L17-I32 HydrophobicContact CD2-CD1 4.27Å; L17-I32 HydrophobicContact CG-CD1 4.3Å; G20-I32 PolarHBondContact N-O 3.43Å; G21-I32 PolarHBondContact O-N 3.35Å; V23-I32 HydrophobicContact CB-CD1 4.21Å; V23-I32 HydrophobicContact CB-CG1 4.27Å; V23-I32 HydrophobicContact CG1-CD1 4.02Å; V23-I32 HydrophobicContact CG1-CG1 3.57Å; I32-E34 WeakPolarHBondContact CG2-O 3.36Å; I32-M35 HydrophobicContact CG2-CB 4.33Å; I32-L50 HydrophobicContact CD1-CD2 4.29Å; I32-L50 HydrophobicContact CG2-CD2 4.05Å; I32-V51 CarbonylContact C-O 3.54Å
33	V	96.7	Very high	93.2	Very high	78 Å²	78	95.4 Å²	95.4	47%	0.473	49%	0.492	S	S	.	.			trans	-90.3	-28.1	175.9	-63.6	0	0	0	0	112	K19 K31 V51	K19-V33 VanDerWaalsContact CD-O 3.31Å; K19-V33 WeakPolarHBondContact CD-O 3.48Å; K19-V33 WeakPolarHBondContact CE-O 3.33Å; K19-V33 PolarHBondContact NZ-O 2.86Å; K31-V33 PolarHBondContact O-N 2.96Å; K31-V33 VanDerWaalsContact O-N 3.08Å; V33-V51 HydrophobicContact CG2-CB 4.11Å; V33-V51 HydrophobicContact CG2-CG1 3.88Å; V33-V51 WeakPolarHBondContact CG2-O 3.4Å; V33-V51 PolarHBondContact N-O 2.8Å
34	E	94	Very high	92.8	Very high	117 Å²	117	95 Å²	95	55%	0.547	49%	0.494	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.7	144.7	179.5	-159.8	-177.7	142.8	0	0	111.1	I32 V51	I32-E34 WeakPolarHBondContact CG2-O 3.36Å; E34-V51 HydrophobicContact CB-CB 3.97Å; E34-V51 HydrophobicContact CB-CG2 4.22Å; E34-V51 PolarHBondContact N-O 2.63Å; E34-V51 PolarHBondContact O-N 2.91Å
35	M	94	Very high	92.6	Very high	49 Å²	49	96.3 Å²	96.3	24%	0.241	51%	0.507	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.8	126.1	175.1	178	-175.9	-173.7	0	0	108.9	C14 L17 I32 V48 H49 L50	C14-M35 WeakPolarHBondContact O-CE 3.39Å; L17-M35 WeakPolarHBondContact O-CE 3.31Å; I32-M35 HydrophobicContact CG2-CB 4.33Å; M35-V48 HydrophobicContact CE-CG1 3.51Å; M35-V48 HydrophobicContact CE-CG2 4.25Å; M35-V48 HydrophobicContact CG-CG1 3.88Å; M35-V48 HydrophobicContact SD-CG1 4.47Å; M35-H49 WeakPolarHBondContact CA-O 3.48Å; M35-L50 HydrophobicContact CB-CD2 3.94Å; M35-L50 HydrophobicContact CG-CD2 3.69Å; M35-L50 HydrophobicContact SD-CD2 4.31Å
36	S	92.8	Very high	92.6	Very high	62 Å²	62	96.3 Å²	96.3	43%	0.434	52%	0.515	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.2	147.4	174.3	-178.4	0	0	0	0	110.1	V48 H49	S36-V48 CarbonylContact O-C 3.56Å; S36-V48 WeakPolarHBondContact O-CA 3.31Å; S36-H49 PolarHBondContact N-O 3.23Å; S36-H49 PolarHBondContact O-N 2.73Å
37	T	91.8	Very high	92.6	Very high	84 Å²	84	92.9 Å²	92.9	52%	0.515	50%	0.5	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	129.1	178.2	-57.9	0	0	0	0	109.4	A46 K47	T37-A46 HydrophobicContact CG2-CB 3.81Å; T37-K47 CarbonylContact C-O 3.54Å; T37-K47 VanDerWaalsContact CA-O 3.31Å; T37-K47 WeakPolarHBondContact CA-O 3.07Å
38	S	91.9	Very high	92.6	Very high	40 Å²	40	87.4 Å²	87.4	28%	0.28	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.1	149.7	179.6	63.4	0	0	0	0	111.1	A46 K47 H49	S38-A46 CarbonylContact O-C 3.57Å; S38-A46 WeakPolarHBondContact O-CA 3.08Å; S38-K47 PolarHBondContact N-O 3.39Å; S38-K47 PolarHBondContact O-N 3.31Å; S38-H49 PolarHBondContact OG-NE2 3.33Å
39	K	88.8	Confident	92.6	Very high	152 Å²	152	84.4 Å²	84.4	66%	0.661	47%	0.465	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.7	127.9	172	-76	-76.4	-171.2	171.9	0	108.1	G41 A46	K39-G41 VanDerWaalsContact C-N 3.33Å; K39-A46 HydrophobicContact CD-CB 4.12Å
40	T	87.9	Confident	92.5	Very high	86 Å²	86	81.2 Å²	81.2	53%	0.528	44%	0.441	S	S	.	.			trans	-89.9	7.1	-178	58	0	0	0	0	114.3	K47	T40-K47 HydrophobicContact CG2-CD 3.59Å; T40-K47 VanDerWaalsContact CG2-CE 3.46Å; T40-K47 HydrophobicContact CG2-CG 4.16Å
41	G	89	Confident	92.4	Very high	41 Å²	41	83.9 Å²	83.9	42%	0.423	46%	0.457	S	S	.	.	S	Bend	trans	160.1	175.7	179.3	0	0	0	0	0	112.3	K39 H43 G44	K39-G41 VanDerWaalsContact C-N 3.33Å; G41-H43 VanDerWaalsContact C-N 3.29Å; G41-H43 PolarHBondContact O-N 2.8Å; G41-G44 PolarHBondContact O-N 3.49Å
42	K	89.6	Confident	92.1	Very high	196 Å²	196	80.7 Å²	80.7	85%	0.852	46%	0.459	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.1	-39	-177.1	-176.5	178.5	178.9	-175.8	0	113.5
43	H	93.1	Very high	91.9	Very high	172 Å²	172	84.8 Å²	84.8	80%	0.796	48%	0.482	S	S	*	.	T	Hydrogen-bonded Turn	trans	-109.8	6.6	-179.7	-56.4	-69.2	0	0	0	112.7	G41	G41-H43 VanDerWaalsContact C-N 3.29Å; G41-H43 PolarHBondContact O-N 2.8Å
44	G	88.1	Confident	91.7	Very high	22 Å²	22	85.1 Å²	85.1	23%	0.227	48%	0.483	C	S	.	.	P	Polyproline II helix	trans	-76.1	143.8	-177.1	0	0	0	0	0	112.7	G41	G41-G44 PolarHBondContact O-N 3.49Å
45	S	91.6	Very high	91.5	Very high	100 Å²	100	83.3 Å²	83.3	70%	0.699	48%	0.479	S	S	*	.	P	Polyproline II helix	trans	-58.7	145.8	166.6	-64	0	0	0	0	110.6
46	A	92.1	Very high	91.4	Very high	50 Å²	50	85.4 Å²	85.4	41%	0.413	49%	0.493	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.6	141.5	170.7	0	0	0	0	0	109.6	T37 S38 K39	T37-A46 HydrophobicContact CG2-CB 3.81Å; S38-A46 CarbonylContact O-C 3.57Å; S38-A46 WeakPolarHBondContact O-CA 3.08Å; K39-A46 HydrophobicContact CD-CB 4.12Å
47	K	92.6	Very high	91.3	Very high	117 Å²	117	86.8 Å²	86.8	51%	0.509	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	131.5	173.1	-62.8	-173.3	179.3	-178.7	0	108.4	T37 S38 T40	T37-K47 CarbonylContact C-O 3.54Å; T37-K47 VanDerWaalsContact CA-O 3.31Å; T37-K47 WeakPolarHBondContact CA-O 3.07Å; S38-K47 PolarHBondContact N-O 3.39Å; S38-K47 PolarHBondContact O-N 3.31Å; T40-K47 HydrophobicContact CG2-CD 3.59Å; T40-K47 VanDerWaalsContact CG2-CE 3.46Å; T40-K47 HydrophobicContact CG2-CG 4.16Å
48	V	93.6	Very high	91.3	Very high	43 Å²	43	87 Å²	87	26%	0.261	50%	0.496	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.2	126.2	176	-178.5	0	0	0	0	108.2	C14 M35 S36 L50	C14-V48 HydrophobicContact CB-CB 4.46Å; C14-V48 HydrophobicContact CB-CG2 4.41Å; M35-V48 HydrophobicContact CE-CG1 3.51Å; M35-V48 HydrophobicContact CE-CG2 4.25Å; M35-V48 HydrophobicContact CG-CG1 3.88Å; M35-V48 HydrophobicContact SD-CG1 4.47Å; S36-V48 CarbonylContact O-C 3.56Å; S36-V48 WeakPolarHBondContact O-CA 3.31Å; V48-L50 HydrophobicContact CG1-CD2 3.8Å; V48-L50 HydrophobicContact CG1-CG 3.95Å
49	H	93.7	Very high	91.2	Very high	105 Å²	105	90.4 Å²	90.4	49%	0.486	51%	0.511	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	121	171.8	-65	-101.6	0	0	0	108	M35 S36 S38	M35-H49 WeakPolarHBondContact CA-O 3.48Å; S36-H49 PolarHBondContact N-O 3.23Å; S36-H49 PolarHBondContact O-N 2.73Å; S38-H49 PolarHBondContact OG-NE2 3.33Å
50	L	93.9	Very high	91.4	Very high	47 Å²	47	85.6 Å²	85.6	25%	0.246	50%	0.5	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	136.7	179.6	-61.7	170.4	0	0	0	109.4	L17 M25 I32 M35 V48	L17-L50 HydrophobicContact CD1-CD1 3.57Å; M25-L50 HydrophobicContact CE-CB 3.75Å; I32-L50 HydrophobicContact CD1-CD2 4.29Å; I32-L50 HydrophobicContact CG2-CD2 4.05Å; M35-L50 HydrophobicContact CB-CD2 3.94Å; M35-L50 HydrophobicContact CG-CD2 3.69Å; M35-L50 HydrophobicContact SD-CD2 4.31Å; V48-L50 HydrophobicContact CG1-CD2 3.8Å; V48-L50 HydrophobicContact CG1-CG 3.95Å
51	V	94.4	Very high	91.7	Very high	76 Å²	76	85.6 Å²	85.6	46%	0.461	50%	0.498	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	131	169.1	-172.4	0	0	0	0	107.1	I32 V33 E34	I32-V51 CarbonylContact C-O 3.54Å; V33-V51 HydrophobicContact CG2-CB 4.11Å; V33-V51 HydrophobicContact CG2-CG1 3.88Å; V33-V51 WeakPolarHBondContact CG2-O 3.4Å; V33-V51 PolarHBondContact N-O 2.8Å; E34-V51 HydrophobicContact CB-CB 3.97Å; E34-V51 HydrophobicContact CB-CG2 4.22Å; E34-V51 PolarHBondContact N-O 2.63Å; E34-V51 PolarHBondContact O-N 2.91Å
52	G	89.2	Confident	92	Very high	58 Å²	58	89.6 Å²	89.6	60%	0.598	50%	0.504	S	S	*	.			trans	-163.7	0	-178.7	0	0	0	0	0	112.6	C30 K31	C30-G52 WeakPolarHBondContact CB-OXT 3.38Å; C30-G52 PolarHBondContact SG-OXT 2.98Å; C30-G52 VanDerWaalsContact SG-OXT 3.35Å; K31-G52 WeakPolarHBondContact O-CA 3.42Å

Retrieved 52 of 52 residues in 10.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).