SYBL_SCHMA Loading...

Synaptobrevin-like protein

Unknown, but synaptobrevins are presumed to be involved in targeting and fusion of synaptic vesicles with the presynaptic membrane as well as in neurotransmitter release.

AlphaFold DB , UniProt , Accession Q27236, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 131 aa.

						>SYBL_SCHMA|Q27236
MLHITTMTDKAPIKTNKRLQQTQAQVNEVVDIMRVNVDKVLERDKNLSELDGRADALQAGASQFEASAGKLKRKFWWKNCKMLAVLGVLVVILIIVLIVWVVSEQKNKVEQSEHSSHHLVMDNSSHLLSEQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.6	Very low	55.7	Low	240 Å²	240	146.4 Å²	146.4	100%	1.182	78%	0.776	S	S	*	*				0	127.1	0	-155.5	-173.4	-73.3	0	0	106.5
2	L	48.5	Very low	56.1	Low	145 Å²	145	141.2 Å²	141.2	76%	0.759	76%	0.757	S	S	*	*			trans	-46.4	130.1	-157.4	-113.5	68.1	0	0	0	116.7	I4	L2-I4 HydrophobicContact CD2-CD1 3.49Å; L2-I4 VanDerWaalsContact CD2-CD1 3.49Å; L2-I4 HydrophobicContact CD2-CG1 3.79Å; L2-I4 HydrophobicContact CG-CD1 4.38Å; L2-I4 HydrophobicContact CG-CG1 4.17Å
3	H	46	Very low	56.4	Low	185 Å²	185	138.5 Å²	138.5	86%	0.856	74%	0.74	S	S	*	*			trans	-90.4	119.2	150.3	-68.5	155	0	0	0	107.9
4	I	62.6	Low	57.1	Low	123 Å²	123	141.6 Å²	141.6	63%	0.631	74%	0.744	S	S	*	*			trans	-129.5	101.1	157.1	-49.8	-177.1	0	0	0	107.5	L2 T6	L2-I4 HydrophobicContact CD2-CD1 3.49Å; L2-I4 VanDerWaalsContact CD2-CD1 3.49Å; L2-I4 HydrophobicContact CD2-CG1 3.79Å; L2-I4 HydrophobicContact CG-CD1 4.38Å; L2-I4 HydrophobicContact CG-CG1 4.17Å; I4-T6 HydrophobicContact CG2-CG2 3.79Å; I4-T6 PolarHBondContact O-N 3.09Å; I4-T6 VanDerWaalsContact O-N 3.13Å
5	T	60.3	Low	58.2	Low	116 Å²	116	138 Å²	138	71%	0.712	73%	0.73	S	S	*	*			trans	-72.3	90.9	166.4	-59.2	0	0	0	0	108.2	M7	T5-M7 HydrophobicContact CG2-CE 4.13Å; T5-M7 HydrophobicContact CG2-CG 3.6Å
6	T	58.1	Low	59.4	Low	109 Å²	109	135.4 Å²	135.4	67%	0.669	72%	0.717	S	S	*	*			trans	-95.5	79.6	161.1	57.6	0	0	0	0	108.7	I4 T8	I4-T6 HydrophobicContact CG2-CG2 3.79Å; I4-T6 PolarHBondContact O-N 3.09Å; I4-T6 VanDerWaalsContact O-N 3.13Å; T6-T8 PolarHBondContact O-N 3.13Å; T6-T8 VanDerWaalsContact O-N 3.09Å
7	M	56.3	Low	60.8	Low	165 Å²	165	135.5 Å²	135.5	81%	0.813	71%	0.71	S	S	*	*			trans	-78	87.8	161.4	-57.7	-77.5	179.3	0	0	105.8	T5 D9	T5-M7 HydrophobicContact CG2-CE 4.13Å; T5-M7 HydrophobicContact CG2-CG 3.6Å; M7-D9 VanDerWaalsContact C-N 3.32Å; M7-D9 PolarHBondContact O-N 2.96Å
8	T	64.2	Low	61.9	Low	122 Å²	122	137.9 Å²	137.9	75%	0.748	71%	0.708	S	S	*	*			trans	-66.8	95.1	169	47.2	0	0	0	0	108.2	T6 K10	T6-T8 PolarHBondContact O-N 3.13Å; T6-T8 VanDerWaalsContact O-N 3.09Å; T8-K10 VanDerWaalsContact C-N 3.33Å; T8-K10 PolarHBondContact O-N 2.96Å
9	D	51.8	Low	63	Low	147 Å²	147	135.9 Å²	135.9	79%	0.786	70%	0.698	S	S	*	*			trans	-64.2	95	165.1	-177.2	21.6	0	0	0	108.7	M7	M7-D9 VanDerWaalsContact C-N 3.32Å; M7-D9 PolarHBondContact O-N 2.96Å
10	K	56.1	Low	64.1	Low	192 Å²	192	135.4 Å²	135.4	84%	0.835	69%	0.693	S	S	*	*			trans	-129.4	82.4	159.3	-77.8	-163.4	-178.9	-173.1	0	107.2	T8 P12	T8-K10 VanDerWaalsContact C-N 3.33Å; T8-K10 PolarHBondContact O-N 2.96Å; K10-P12 WeakPolarHBondContact O-CD 3.05Å
11	A	59.6	Low	65.1	Low	66 Å²	66	134.6 Å²	134.6	55%	0.545	69%	0.686	S	S	.	*			trans	-95.5	92	164.6	0	0	0	0	0	109.5	I13	A11-I13 HydrophobicContact CB-CG1 3.96Å; A11-I13 PolarHBondContact O-N 3.27Å
12	P	60.6	Low	66.8	Low	84 Å²	84	126.7 Å²	126.7	55%	0.545	65%	0.652	S	S	.	*			trans	-77.7	57.8	174	36.3	-36.9	0	0	0	110	K10	K10-P12 WeakPolarHBondContact O-CD 3.05Å
13	I	59.3	Low	68.6	Low	106 Å²	106	125.9 Å²	125.9	54%	0.544	64%	0.644	S	S	.	*	H	α-helix	trans	-88.3	-14	-176.4	-55	-58.4	0	0	0	111.6	A11	A11-I13 HydrophobicContact CB-CG1 3.96Å; A11-I13 PolarHBondContact O-N 3.27Å
14	K	66.2	Low	70.8	Confident	182 Å²	182	119.8 Å²	119.8	79%	0.791	63%	0.626	S	S	*	*	H	α-helix	trans	-81.3	-32.5	178.7	-60.8	-170.2	-176.8	-176	0	113.4
15	T	74.2	Confident	72.1	Confident	88 Å²	88	119.8 Å²	119.8	54%	0.54	62%	0.623	S	S	.	*	H	α-helix	trans	-70.4	-43.4	-174.9	-45.2	0	0	0	0	112.9	K17 R18 L19	T15-K17 PolarHBondContact O-N 3.42Å; T15-R18 PolarHBondContact O-N 3.1Å; T15-L19 HydrophobicContact CG2-CD1 4.34Å; T15-L19 PolarHBondContact O-N 2.84Å; T15-L19 VanDerWaalsContact O-N 3.1Å
16	N	77.2	Confident	73.6	Confident	96 Å²	96	117.9 Å²	117.9	51%	0.513	61%	0.611	S	S	.	*	H	α-helix	trans	-61.7	-42.2	-178.9	-78.8	-68.1	0	0	0	112.9	R18 L19 Q20	N16-R18 VanDerWaalsContact C-N 3.34Å; N16-R18 PolarHBondContact O-N 2.84Å; N16-L19 PolarHBondContact O-N 3.26Å; N16-Q20 WeakPolarHBondContact O-CG 3.44Å; N16-Q20 PolarHBondContact O-N 3.43Å
17	K	82.5	Confident	75.3	Confident	138 Å²	138	117.5 Å²	117.5	60%	0.6	61%	0.605	S	S	*	*	H	α-helix	trans	-62.3	-40.3	178	-69.3	-174.6	177.9	-178.6	0	112.1	T15 Q21	T15-K17 PolarHBondContact O-N 3.42Å; K17-Q21 WeakPolarHBondContact O-CB 3.36Å; K17-Q21 VanDerWaalsContact O-CG 3.27Å; K17-Q21 WeakPolarHBondContact O-CG 3.26Å; K17-Q21 PolarHBondContact O-N 3.38Å
18	R	81.5	Confident	77.1	Confident	179 Å²	179	115.5 Å²	115.5	68%	0.675	59%	0.593	S	S	*	*	H	α-helix	trans	-66.6	-43.1	178	-69.7	-71.8	174.8	166.4	-3	111.7	T15 N16 Q21 T22	T15-R18 PolarHBondContact O-N 3.1Å; N16-R18 VanDerWaalsContact C-N 3.34Å; N16-R18 PolarHBondContact O-N 2.84Å; R18-Q21 PolarHBondContact O-N 2.97Å; R18-T22 PolarHBondContact O-N 2.99Å; R18-T22 PolarHBondContact O-OG1 3.33Å; R18-T22 VanDerWaalsContact O-OG1 3.08Å
19	L	82.7	Confident	78.5	Confident	99 Å²	99	113.2 Å²	113.2	52%	0.518	58%	0.579	S	S	.	*	H	α-helix	trans	-64.3	-41.9	176.2	-69	175.3	0	0	0	112.5	T15 N16 T22 Q23	T15-L19 HydrophobicContact CG2-CD1 4.34Å; T15-L19 PolarHBondContact O-N 2.84Å; T15-L19 VanDerWaalsContact O-N 3.1Å; N16-L19 PolarHBondContact O-N 3.26Å; L19-T22 PolarHBondContact O-N 3.36Å; L19-Q23 WeakPolarHBondContact O-CG 3.27Å; L19-Q23 PolarHBondContact O-N 3.47Å
20	Q	84.2	Confident	80.6	Confident	126 Å²	126	109 Å²	109	59%	0.589	56%	0.559	S	S	*	*	H	α-helix	trans	-63	-41.1	175.1	-73.2	176.7	4.3	0	0	111.9	N16 Q23 A24	N16-Q20 WeakPolarHBondContact O-CG 3.44Å; N16-Q20 PolarHBondContact O-N 3.43Å; Q20-Q23 PolarHBondContact O-N 2.91Å; Q20-A24 WeakPolarHBondContact O-CB 3.47Å; Q20-A24 PolarHBondContact O-N 3.25Å
21	Q	85.3	Confident	82.4	Confident	118 Å²	118	103.6 Å²	103.6	55%	0.551	54%	0.539	S	S	*	.	H	α-helix	trans	-61.1	-43.7	173.1	-75.7	176.4	-32.3	0	0	111.7	K17 R18 A24 Q25	K17-Q21 WeakPolarHBondContact O-CB 3.36Å; K17-Q21 VanDerWaalsContact O-CG 3.27Å; K17-Q21 WeakPolarHBondContact O-CG 3.26Å; K17-Q21 PolarHBondContact O-N 3.38Å; R18-Q21 PolarHBondContact O-N 2.97Å; Q21-A24 PolarHBondContact O-N 3.34Å; Q21-Q25 WeakPolarHBondContact O-CB 3.37Å; Q21-Q25 PolarHBondContact O-N 2.98Å
22	T	86.3	Confident	84.1	Confident	75 Å²	75	104.5 Å²	104.5	46%	0.46	53%	0.534	S	S	.	.	H	α-helix	trans	-65.7	-41.2	176.4	-58.3	0	0	0	0	112.1	R18 L19 Q25 V26	R18-T22 PolarHBondContact O-N 2.99Å; R18-T22 PolarHBondContact O-OG1 3.33Å; R18-T22 VanDerWaalsContact O-OG1 3.08Å; L19-T22 PolarHBondContact O-N 3.36Å; T22-Q25 PolarHBondContact O-N 2.78Å; T22-V26 HydrophobicContact CG2-CG2 4.42Å; T22-V26 WeakPolarHBondContact O-CB 3.38Å; T22-V26 VanDerWaalsContact O-CG2 3.27Å; T22-V26 WeakPolarHBondContact O-CG2 3.3Å; T22-V26 PolarHBondContact O-N 3.43Å
23	Q	86.7	Confident	85.8	Confident	128 Å²	128	105.4 Å²	105.4	60%	0.598	53%	0.532	S	S	*	.	H	α-helix	trans	-63.1	-43.3	175.1	-76.9	-179.4	-11.4	0	0	111.9	L19 Q20 V26 N27	L19-Q23 WeakPolarHBondContact O-CG 3.27Å; L19-Q23 PolarHBondContact O-N 3.47Å; Q20-Q23 PolarHBondContact O-N 2.91Å; Q23-V26 PolarHBondContact O-N 2.91Å; Q23-N27 WeakPolarHBondContact O-CB 3.27Å; Q23-N27 PolarHBondContact O-N 2.88Å; Q23-N27 PolarHBondContact O-ND2 3.33Å
24	A	90.5	Very high	87.6	Confident	57 Å²	57	107.5 Å²	107.5	47%	0.471	53%	0.533	S	S	.	.	H	α-helix	trans	-61.8	-44.1	175.6	0	0	0	0	0	111.6	Q20 Q21 N27 E28	Q20-A24 WeakPolarHBondContact O-CB 3.47Å; Q20-A24 PolarHBondContact O-N 3.25Å; Q21-A24 PolarHBondContact O-N 3.34Å; A24-N27 PolarHBondContact O-N 3.37Å; A24-E28 PolarHBondContact O-N 2.96Å
25	Q	91.5	Very high	89	Confident	122 Å²	122	102.3 Å²	102.3	57%	0.57	52%	0.516	S	S	*	.	H	α-helix	trans	-63.8	-41.5	177	-174.4	178.3	40.8	0	0	112.3	Q21 T22 E28 V29	Q21-Q25 WeakPolarHBondContact O-CB 3.37Å; Q21-Q25 PolarHBondContact O-N 2.98Å; T22-Q25 PolarHBondContact O-N 2.78Å; Q25-E28 PolarHBondContact O-N 3.47Å; Q25-V29 VanDerWaalsContact O-CG2 3.31Å; Q25-V29 WeakPolarHBondContact O-CG2 3.49Å; Q25-V29 PolarHBondContact O-N 3Å
26	V	91.6	Very high	90	Very high	77 Å²	77	101.4 Å²	101.4	47%	0.467	51%	0.508	S	S	.	.	H	α-helix	trans	-65.1	-42.9	176.6	170.7	0	0	0	0	110.7	T22 Q23 E28 V29 V30	T22-V26 HydrophobicContact CG2-CG2 4.42Å; T22-V26 WeakPolarHBondContact O-CB 3.38Å; T22-V26 VanDerWaalsContact O-CG2 3.27Å; T22-V26 WeakPolarHBondContact O-CG2 3.3Å; T22-V26 PolarHBondContact O-N 3.43Å; Q23-V26 PolarHBondContact O-N 2.91Å; V26-E28 VanDerWaalsContact C-N 3.34Å; V26-E28 PolarHBondContact O-N 3.28Å; V26-V29 PolarHBondContact O-N 3.48Å; V26-V30 HydrophobicContact CG1-CG2 4.23Å; V26-V30 WeakPolarHBondContact O-CB 3.31Å; V26-V30 VanDerWaalsContact O-CG2 3.26Å; V26-V30 WeakPolarHBondContact O-CG2 3.5Å; V26-V30 PolarHBondContact O-N 2.82Å
27	N	93.3	Very high	90.9	Very high	101 Å²	101	100.2 Å²	100.2	54%	0.54	50%	0.504	S	S	.	.	H	α-helix	trans	-60.4	-45	176.5	-70.5	-20.8	0	0	0	111.4	Q23 A24 V29 V30 D31	Q23-N27 WeakPolarHBondContact O-CB 3.27Å; Q23-N27 PolarHBondContact O-N 2.88Å; Q23-N27 PolarHBondContact O-ND2 3.33Å; A24-N27 PolarHBondContact O-N 3.37Å; N27-V29 PolarHBondContact O-N 3.36Å; N27-V30 PolarHBondContact O-N 3.08Å; N27-D31 VanDerWaalsContact O-CG 3.29Å; N27-D31 PolarHBondContact O-N 2.94Å
28	E	94.6	Very high	91.5	Very high	122 Å²	122	98.6 Å²	98.6	57%	0.57	50%	0.502	S	S	*	.	H	α-helix	trans	-59.4	-46.1	175.4	-177.7	178.9	-167	0	0	111.9	A24 Q25 V26 V30 D31 I32	A24-E28 PolarHBondContact O-N 2.96Å; Q25-E28 PolarHBondContact O-N 3.47Å; V26-E28 VanDerWaalsContact C-N 3.34Å; V26-E28 PolarHBondContact O-N 3.28Å; E28-V30 PolarHBondContact O-N 3.22Å; E28-D31 PolarHBondContact O-N 3.41Å; E28-I32 HydrophobicContact CG-CD1 4.14Å; E28-I32 VanDerWaalsContact O-CG1 3.29Å; E28-I32 WeakPolarHBondContact O-CG1 3.44Å; E28-I32 PolarHBondContact O-N 3.1Å
29	V	93.4	Very high	92.2	Very high	74 Å²	74	95.6 Å²	95.6	45%	0.448	49%	0.494	S	S	.	.	H	α-helix	trans	-65.5	-38.7	177.1	172.7	0	0	0	0	111.7	Q25 V26 N27 D31 I32 M33	Q25-V29 VanDerWaalsContact O-CG2 3.31Å; Q25-V29 WeakPolarHBondContact O-CG2 3.49Å; Q25-V29 PolarHBondContact O-N 3Å; V26-V29 PolarHBondContact O-N 3.48Å; N27-V29 PolarHBondContact O-N 3.36Å; V29-D31 VanDerWaalsContact C-N 3.32Å; V29-D31 PolarHBondContact O-N 2.96Å; V29-I32 PolarHBondContact O-N 2.82Å; V29-M33 HydrophobicContact CG1-CG 4.31Å; V29-M33 WeakPolarHBondContact O-CB 3.48Å; V29-M33 VanDerWaalsContact O-CG 3.3Å; V29-M33 WeakPolarHBondContact O-CG 3.33Å; V29-M33 PolarHBondContact O-N 3.35Å
30	V	94.4	Very high	92.9	Very high	60 Å²	60	94.4 Å²	94.4	36%	0.364	49%	0.49	S	S	.	.	H	α-helix	trans	-62	-42.2	175	167.1	0	0	0	0	110.5	V26 N27 E28 M33 R34	V26-V30 HydrophobicContact CG1-CG2 4.23Å; V26-V30 WeakPolarHBondContact O-CB 3.31Å; V26-V30 VanDerWaalsContact O-CG2 3.26Å; V26-V30 WeakPolarHBondContact O-CG2 3.5Å; V26-V30 PolarHBondContact O-N 2.82Å; N27-V30 PolarHBondContact O-N 3.08Å; E28-V30 PolarHBondContact O-N 3.22Å; V30-M33 PolarHBondContact O-N 2.87Å; V30-R34 WeakPolarHBondContact O-CG 3.43Å; V30-R34 PolarHBondContact O-N 3.46Å
31	D	95.5	Very high	93.4	Very high	78 Å²	78	92.8 Å²	92.8	42%	0.417	49%	0.485	S	S	.	.	H	α-helix	trans	-64.9	-41.9	176.2	-68.6	-27	0	0	0	111.5	N27 E28 V29 M33 R34 V35	N27-D31 VanDerWaalsContact O-CG 3.29Å; N27-D31 PolarHBondContact O-N 2.94Å; E28-D31 PolarHBondContact O-N 3.41Å; V29-D31 VanDerWaalsContact C-N 3.32Å; V29-D31 PolarHBondContact O-N 2.96Å; D31-M33 VanDerWaalsContact C-N 3.34Å; D31-M33 PolarHBondContact O-N 3.47Å; D31-R34 PolarHBondContact O-N 3.35Å; D31-R34 IonicContact OD1-CZ 3.89Å; D31-R34 IonicContact OD1-NH1 2.78Å; D31-R34 PolarHBondContact OD1-NH1 3.25Å; D31-V35 WeakPolarHBondContact O-CG2 3.31Å; D31-V35 PolarHBondContact O-N 2.81Å; D31-V35 VanDerWaalsContact O-N 3.12Å
32	I	95.5	Very high	93.9	Very high	84 Å²	84	93.1 Å²	93.1	43%	0.431	49%	0.487	S	S	.	.	H	α-helix	trans	-60.5	-43.2	172.4	-67.9	165.4	0	0	0	111	E28 V29 V35 N36	E28-I32 HydrophobicContact CG-CD1 4.14Å; E28-I32 VanDerWaalsContact O-CG1 3.29Å; E28-I32 WeakPolarHBondContact O-CG1 3.44Å; E28-I32 PolarHBondContact O-N 3.1Å; V29-I32 PolarHBondContact O-N 2.82Å; I32-V35 PolarHBondContact O-N 3.31Å; I32-N36 WeakPolarHBondContact O-CB 3.32Å; I32-N36 PolarHBondContact O-N 3.31Å; I32-N36 PolarHBondContact O-ND2 3.23Å; I32-N36 PolarHBondContact O-OD1 2.85Å
33	M	95.2	Very high	94.3	Very high	103 Å²	103	96.7 Å²	96.7	51%	0.507	49%	0.492	S	S	.	.	H	α-helix	trans	-67.4	-36.9	179.4	-76	-62.3	-66.9	0	0	112.4	V29 V30 D31 N36 V37	V29-M33 HydrophobicContact CG1-CG 4.31Å; V29-M33 WeakPolarHBondContact O-CB 3.48Å; V29-M33 VanDerWaalsContact O-CG 3.3Å; V29-M33 WeakPolarHBondContact O-CG 3.33Å; V29-M33 PolarHBondContact O-N 3.35Å; V30-M33 PolarHBondContact O-N 2.87Å; D31-M33 VanDerWaalsContact C-N 3.34Å; D31-M33 PolarHBondContact O-N 3.47Å; M33-N36 PolarHBondContact O-N 2.91Å; M33-V37 VanDerWaalsContact O-CG2 3.31Å; M33-V37 WeakPolarHBondContact O-CG2 3.43Å; M33-V37 PolarHBondContact O-N 3.49Å
34	R	96.5	Very high	94.8	Very high	151 Å²	151	95.6 Å²	95.6	57%	0.57	49%	0.49	S	S	*	.	H	α-helix	trans	-57.7	-51.5	171.5	-74.8	172.1	178.4	151.5	-4.3	110.6	V30 D31 N36 V37 D38	V30-R34 WeakPolarHBondContact O-CG 3.43Å; V30-R34 PolarHBondContact O-N 3.46Å; D31-R34 PolarHBondContact O-N 3.35Å; D31-R34 IonicContact OD1-CZ 3.89Å; D31-R34 IonicContact OD1-NH1 2.78Å; D31-R34 PolarHBondContact OD1-NH1 3.25Å; R34-N36 VanDerWaalsContact C-N 3.27Å; R34-N36 PolarHBondContact O-N 3.5Å; R34-V37 PolarHBondContact O-N 2.96Å; R34-V37 VanDerWaalsContact O-N 3.1Å; R34-D38 PolarHBondContact O-N 3Å
35	V	95.8	Very high	95	Very high	72 Å²	72	100 Å²	100	44%	0.436	50%	0.499	S	S	.	.	H	α-helix	trans	-60.5	-37.7	176.6	174.3	0	0	0	0	111.5	D31 I32 D38 K39	D31-V35 WeakPolarHBondContact O-CG2 3.31Å; D31-V35 PolarHBondContact O-N 2.81Å; D31-V35 VanDerWaalsContact O-N 3.12Å; I32-V35 PolarHBondContact O-N 3.31Å; V35-D38 PolarHBondContact O-N 3.12Å; V35-K39 HydrophobicContact CG1-CD 4.18Å; V35-K39 WeakPolarHBondContact O-CB 3.4Å; V35-K39 VanDerWaalsContact O-CG 3.26Å; V35-K39 WeakPolarHBondContact O-CG 3.29Å; V35-K39 PolarHBondContact O-N 3.45Å
36	N	95.1	Very high	95.2	Very high	70 Å²	70	98.3 Å²	98.3	37%	0.374	49%	0.493	S	S	.	.	H	α-helix	trans	-68.6	-35.8	176.4	-71.4	-15.6	0	0	0	112.7	I32 M33 R34 K39 V40	I32-N36 WeakPolarHBondContact O-CB 3.32Å; I32-N36 PolarHBondContact O-N 3.31Å; I32-N36 PolarHBondContact O-ND2 3.23Å; I32-N36 PolarHBondContact O-OD1 2.85Å; M33-N36 PolarHBondContact O-N 2.91Å; R34-N36 VanDerWaalsContact C-N 3.27Å; R34-N36 PolarHBondContact O-N 3.5Å; N36-K39 PolarHBondContact O-N 3.27Å; N36-V40 WeakPolarHBondContact O-CB 3.26Å; N36-V40 PolarHBondContact O-N 3.12Å
37	V	96.7	Very high	95.4	Very high	71 Å²	71	99.3 Å²	99.3	43%	0.43	50%	0.496	S	S	.	.	H	α-helix	trans	-65.7	-43	174.5	167.9	0	0	0	0	110.3	M33 R34 K39 V40 L41	M33-V37 VanDerWaalsContact O-CG2 3.31Å; M33-V37 WeakPolarHBondContact O-CG2 3.43Å; M33-V37 PolarHBondContact O-N 3.49Å; R34-V37 PolarHBondContact O-N 2.96Å; R34-V37 VanDerWaalsContact O-N 3.1Å; V37-K39 VanDerWaalsContact C-N 3.31Å; V37-K39 PolarHBondContact O-N 3.43Å; V37-V40 WeakPolarHBondContact O-CG1 3.35Å; V37-V40 PolarHBondContact O-N 2.93Å; V37-L41 HydrophobicContact CG1-CD1 3.96Å; V37-L41 WeakPolarHBondContact O-CB 3.5Å; V37-L41 WeakPolarHBondContact O-CG 3.5Å; V37-L41 PolarHBondContact O-N 2.98Å
38	D	96.4	Very high	95.4	Very high	103 Å²	103	98.5 Å²	98.5	55%	0.551	50%	0.498	S	S	*	.	H	α-helix	trans	-61.1	-43.4	174.5	-64.5	-31.4	0	0	0	111	R34 V35 V40 L41 E42	R34-D38 PolarHBondContact O-N 3Å; V35-D38 PolarHBondContact O-N 3.12Å; D38-V40 PolarHBondContact O-N 2.89Å; D38-L41 PolarHBondContact O-N 3.33Å; D38-E42 PolarHBondContact O-N 3.42Å
39	K	96.2	Very high	95.4	Very high	117 Å²	117	97.3 Å²	97.3	51%	0.509	49%	0.492	S	S	.	.	H	α-helix	trans	-63.5	-37.8	175.1	-74	172.1	-178.9	173	0	113.3	V35 N36 V37 R43	V35-K39 HydrophobicContact CG1-CD 4.18Å; V35-K39 WeakPolarHBondContact O-CB 3.4Å; V35-K39 VanDerWaalsContact O-CG 3.26Å; V35-K39 WeakPolarHBondContact O-CG 3.29Å; V35-K39 PolarHBondContact O-N 3.45Å; N36-K39 PolarHBondContact O-N 3.27Å; V37-K39 VanDerWaalsContact C-N 3.31Å; V37-K39 PolarHBondContact O-N 3.43Å; K39-R43 WeakPolarHBondContact O-CB 3.49Å; K39-R43 PolarHBondContact O-N 2.87Å
40	V	95.9	Very high	95.5	Very high	73 Å²	73	99 Å²	99	44%	0.442	50%	0.498	S	S	.	.	H	α-helix	trans	-73.3	-34.6	179.6	84.4	0	0	0	0	111.2	N36 V37 D38 R43 D44	N36-V40 WeakPolarHBondContact O-CB 3.26Å; N36-V40 PolarHBondContact O-N 3.12Å; V37-V40 WeakPolarHBondContact O-CG1 3.35Å; V37-V40 PolarHBondContact O-N 2.93Å; D38-V40 PolarHBondContact O-N 2.89Å; V40-R43 WeakPolarHBondContact O-CB 3.46Å; V40-R43 PolarHBondContact O-N 3.27Å; V40-D44 WeakPolarHBondContact O-CB 3.48Å; V40-D44 PolarHBondContact O-N 3.33Å
41	L	94.8	Very high	95.5	Very high	93 Å²	93	101 Å²	101	49%	0.487	51%	0.507	S	S	.	.	H	α-helix	trans	-67.1	-40.4	173.3	-73.1	165.9	0	0	0	111.8	V37 D38 R43 D44 K45	V37-L41 HydrophobicContact CG1-CD1 3.96Å; V37-L41 WeakPolarHBondContact O-CB 3.5Å; V37-L41 WeakPolarHBondContact O-CG 3.5Å; V37-L41 PolarHBondContact O-N 2.98Å; D38-L41 PolarHBondContact O-N 3.33Å; L41-R43 VanDerWaalsContact C-N 3.34Å; L41-D44 WeakPolarHBondContact O-CB 3.27Å; L41-D44 PolarHBondContact O-N 2.81Å; L41-K45 WeakPolarHBondContact O-CG 3.48Å; L41-K45 PolarHBondContact O-N 3.44Å; L41-K45 VanDerWaalsContact O-N 3.12Å
42	E	96.1	Very high	95.4	Very high	124 Å²	124	99.2 Å²	99.2	58%	0.579	51%	0.507	S	S	*	.	H	α-helix	trans	-66.7	-38.2	173.1	-175.9	163.9	-158	0	0	111.6	D38 D44 K45 N46	D38-E42 PolarHBondContact O-N 3.42Å; E42-D44 VanDerWaalsContact C-N 3.33Å; E42-D44 PolarHBondContact O-N 3.47Å; E42-K45 PolarHBondContact O-N 3.03Å; E42-N46 WeakPolarHBondContact O-CB 3.44Å; E42-N46 PolarHBondContact O-N 3.13Å; E42-N46 PolarHBondContact O-ND2 3.47Å
43	R	95.6	Very high	95.4	Very high	150 Å²	150	102.8 Å²	102.8	57%	0.566	52%	0.515	S	S	*	.	H	α-helix	trans	-60.8	-42	171.7	-173.4	-174.6	-62.3	142.8	2.2	111.8	K39 V40 L41 N46 L47	K39-R43 WeakPolarHBondContact O-CB 3.49Å; K39-R43 PolarHBondContact O-N 2.87Å; V40-R43 WeakPolarHBondContact O-CB 3.46Å; V40-R43 PolarHBondContact O-N 3.27Å; L41-R43 VanDerWaalsContact C-N 3.34Å; R43-N46 PolarHBondContact O-N 3.48Å; R43-L47 HydrophobicContact CG-CD1 4Å; R43-L47 HydrophobicContact CG-CG 4.28Å; R43-L47 WeakPolarHBondContact O-CB 3.35Å; R43-L47 VanDerWaalsContact O-CG 3.28Å; R43-L47 WeakPolarHBondContact O-CG 3.35Å; R43-L47 PolarHBondContact O-N 3.39Å
44	D	95.7	Very high	95.4	Very high	106 Å²	106	100.2 Å²	100.2	57%	0.567	51%	0.51	S	S	*	.	H	α-helix	trans	-61.1	-45.2	178.3	-171.4	72	0	0	0	111.8	V40 L41 E42 L47 S48	V40-D44 WeakPolarHBondContact O-CB 3.48Å; V40-D44 PolarHBondContact O-N 3.33Å; L41-D44 WeakPolarHBondContact O-CB 3.27Å; L41-D44 PolarHBondContact O-N 2.81Å; E42-D44 VanDerWaalsContact C-N 3.33Å; E42-D44 PolarHBondContact O-N 3.47Å; D44-L47 PolarHBondContact O-N 3.38Å; D44-S48 PolarHBondContact O-N 3Å
45	K	95.6	Very high	95.4	Very high	150 Å²	150	97.5 Å²	97.5	65%	0.652	51%	0.507	S	S	*	.	H	α-helix	trans	-59.7	-48.2	173.3	-69.4	172.6	-176.1	165.3	0	112.4	L41 E42 L47 S48 E49	L41-K45 WeakPolarHBondContact O-CG 3.48Å; L41-K45 PolarHBondContact O-N 3.44Å; L41-K45 VanDerWaalsContact O-N 3.12Å; E42-K45 PolarHBondContact O-N 3.03Å; K45-L47 VanDerWaalsContact C-N 3.3Å; K45-L47 PolarHBondContact O-N 2.97Å; K45-S48 PolarHBondContact O-N 3.17Å; K45-E49 PolarHBondContact O-N 2.92Å
46	N	95	Very high	95.4	Very high	85 Å²	85	97.2 Å²	97.2	46%	0.455	51%	0.512	S	S	.	.	H	α-helix	trans	-63	-37.8	178	-75	-47.1	0	0	0	111.8	E42 R43 E49 L50	E42-N46 WeakPolarHBondContact O-CB 3.44Å; E42-N46 PolarHBondContact O-N 3.13Å; E42-N46 PolarHBondContact O-ND2 3.47Å; R43-N46 PolarHBondContact O-N 3.48Å; N46-E49 PolarHBondContact O-N 3.42Å; N46-L50 WeakPolarHBondContact O-CB 3.28Å; N46-L50 PolarHBondContact O-N 2.81Å
47	L	95.2	Very high	95.4	Very high	98 Å²	98	100 Å²	100	51%	0.513	53%	0.527	S	S	.	.	H	α-helix	trans	-65.9	-43.6	175.5	-79	171.4	0	0	0	111.4	R43 D44 K45 E49 L50 D51	R43-L47 HydrophobicContact CG-CD1 4Å; R43-L47 HydrophobicContact CG-CG 4.28Å; R43-L47 WeakPolarHBondContact O-CB 3.35Å; R43-L47 VanDerWaalsContact O-CG 3.28Å; R43-L47 WeakPolarHBondContact O-CG 3.35Å; R43-L47 PolarHBondContact O-N 3.39Å; D44-L47 PolarHBondContact O-N 3.38Å; K45-L47 VanDerWaalsContact C-N 3.3Å; K45-L47 PolarHBondContact O-N 2.97Å; L47-E49 VanDerWaalsContact C-N 3.3Å; L47-E49 PolarHBondContact O-N 2.77Å; L47-L50 CarbonylContact O-C 3.59Å; L47-L50 PolarHBondContact O-N 3.48Å; L47-L50 VanDerWaalsContact O-N 3.17Å; L47-D51 VanDerWaalsContact O-CB 3.27Å; L47-D51 WeakPolarHBondContact O-CB 3.38Å; L47-D51 PolarHBondContact O-N 3.33Å
48	S	94.6	Very high	95.3	Very high	84 Å²	84	103.3 Å²	103.3	59%	0.587	54%	0.537	S	S	*	.	H	α-helix	trans	-61.5	-39	176.2	-179.2	0	0	0	0	112	D44 K45 G52	D44-S48 PolarHBondContact O-N 3Å; K45-S48 PolarHBondContact O-N 3.17Å; S48-G52 PolarHBondContact O-N 2.63Å; S48-G52 VanDerWaalsContact O-N 3.13Å
49	E	95.2	Very high	95.2	Very high	97 Å²	97	101.5 Å²	101.5	45%	0.453	54%	0.536	S	S	.	.	H	α-helix	trans	-67.1	-43	172.6	-175.6	177.8	-172.5	0	0	112	K45 N46 L47 D51 G52 R53	K45-E49 PolarHBondContact O-N 2.92Å; N46-E49 PolarHBondContact O-N 3.42Å; L47-E49 VanDerWaalsContact C-N 3.3Å; L47-E49 PolarHBondContact O-N 2.77Å; E49-D51 VanDerWaalsContact C-N 3.32Å; E49-D51 PolarHBondContact O-N 2.87Å; E49-G52 PolarHBondContact O-N 3.17Å; E49-R53 WeakPolarHBondContact O-CB 3.43Å; E49-R53 VanDerWaalsContact O-CG 3.3Å; E49-R53 WeakPolarHBondContact O-CG 3.3Å; E49-R53 PolarHBondContact O-N 3.3Å; E49-R53 IonicContact OE1-CZ 3.16Å; E49-R53 IonicContact OE1-NE 3.17Å; E49-R53 PolarHBondContact OE1-NE 3.32Å; E49-R53 IonicContact OE1-NH2 2.63Å; E49-R53 PolarHBondContact OE1-NH2 3.45Å
50	L	94.9	Very high	95.2	Very high	109 Å²	109	97.6 Å²	97.6	57%	0.571	53%	0.529	S	S	*	.	H	α-helix	trans	-63.6	-38.5	177.7	-125.7	71.3	0	0	0	111.9	N46 L47 R53 A54	N46-L50 WeakPolarHBondContact O-CB 3.28Å; N46-L50 PolarHBondContact O-N 2.81Å; L47-L50 CarbonylContact O-C 3.59Å; L47-L50 PolarHBondContact O-N 3.48Å; L47-L50 VanDerWaalsContact O-N 3.17Å; L50-R53 CarbonylContact O-C 3.58Å; L50-R53 PolarHBondContact O-N 2.87Å; L50-A54 WeakPolarHBondContact O-CA 3.49Å; L50-A54 WeakPolarHBondContact O-CB 3.28Å; L50-A54 PolarHBondContact O-N 2.84Å
51	D	94.3	Very high	95.1	Very high	103 Å²	103	96.5 Å²	96.5	55%	0.551	53%	0.528	S	S	*	.	H	α-helix	trans	-63.6	-50	177.8	-167.1	57.4	0	0	0	110.3	L47 E49 R53 A54 D55	L47-D51 VanDerWaalsContact O-CB 3.27Å; L47-D51 WeakPolarHBondContact O-CB 3.38Å; L47-D51 PolarHBondContact O-N 3.33Å; E49-D51 VanDerWaalsContact C-N 3.32Å; E49-D51 PolarHBondContact O-N 2.87Å; D51-R53 VanDerWaalsContact C-N 3.33Å; D51-R53 PolarHBondContact O-N 2.94Å; D51-A54 WeakPolarHBondContact O-CB 3.35Å; D51-A54 PolarHBondContact O-N 3.45Å; D51-A54 VanDerWaalsContact O-N 3.08Å; D51-D55 PolarHBondContact O-N 3.08Å
52	G	93.8	Very high	95	Very high	41 Å²	41	95.3 Å²	95.3	42%	0.423	53%	0.528	S	S	.	.	H	α-helix	trans	-61.3	-38.4	174.1	0	0	0	0	0	113.5	S48 E49 A56	S48-G52 PolarHBondContact O-N 2.63Å; S48-G52 VanDerWaalsContact O-N 3.13Å; E49-G52 PolarHBondContact O-N 3.17Å; G52-A56 PolarHBondContact O-N 3.44Å; G52-A56 VanDerWaalsContact O-N 3.14Å
53	R	94.8	Very high	94.8	Very high	158 Å²	158	96.1 Å²	96.1	60%	0.596	53%	0.532	S	S	*	.	H	α-helix	trans	-68.7	-36.5	173.1	-72.8	177.9	-178.6	-158.7	2.7	112.1	E49 L50 D51 A56 L57	E49-R53 WeakPolarHBondContact O-CB 3.43Å; E49-R53 VanDerWaalsContact O-CG 3.3Å; E49-R53 WeakPolarHBondContact O-CG 3.3Å; E49-R53 PolarHBondContact O-N 3.3Å; E49-R53 IonicContact OE1-CZ 3.16Å; E49-R53 IonicContact OE1-NE 3.17Å; E49-R53 PolarHBondContact OE1-NE 3.32Å; E49-R53 IonicContact OE1-NH2 2.63Å; E49-R53 PolarHBondContact OE1-NH2 3.45Å; L50-R53 CarbonylContact O-C 3.58Å; L50-R53 PolarHBondContact O-N 2.87Å; D51-R53 VanDerWaalsContact C-N 3.33Å; D51-R53 PolarHBondContact O-N 2.94Å; R53-A56 PolarHBondContact O-N 3.14Å; R53-L57 VanDerWaalsContact O-CB 3.28Å; R53-L57 WeakPolarHBondContact O-CB 3.49Å; R53-L57 PolarHBondContact O-N 2.72Å
54	A	96.1	Very high	94.6	Very high	49 Å²	49	96.3 Å²	96.3	41%	0.405	54%	0.537	S	S	.	.	H	α-helix	trans	-68.9	-40.3	178.7	0	0	0	0	0	110.9	L50 D51 L57 Q58	L50-A54 WeakPolarHBondContact O-CA 3.49Å; L50-A54 WeakPolarHBondContact O-CB 3.28Å; L50-A54 PolarHBondContact O-N 2.84Å; D51-A54 WeakPolarHBondContact O-CB 3.35Å; D51-A54 PolarHBondContact O-N 3.45Å; D51-A54 VanDerWaalsContact O-N 3.08Å; A54-L57 CarbonylContact O-C 3.59Å; A54-L57 PolarHBondContact O-N 3.38Å; A54-Q58 WeakPolarHBondContact O-CB 3.22Å; A54-Q58 PolarHBondContact O-N 3.4Å
55	D	95.6	Very high	94.3	Very high	95 Å²	95	98.1 Å²	98.1	51%	0.508	54%	0.542	S	S	.	.	H	α-helix	trans	-60.5	-47.1	171.6	-82.6	-18	0	0	0	111.5	D51 L57 Q58 A59	D51-D55 PolarHBondContact O-N 3.08Å; D55-L57 VanDerWaalsContact C-N 3.32Å; D55-L57 PolarHBondContact O-N 3.35Å; D55-Q58 PolarHBondContact O-N 2.84Å; D55-A59 WeakPolarHBondContact O-CB 3.14Å; D55-A59 PolarHBondContact O-N 3.29Å
56	A	95	Very high	94	Very high	65 Å²	65	93.3 Å²	93.3	54%	0.537	53%	0.53	S	S	.	.	H	α-helix	trans	-61.5	-42.1	175.9	0	0	0	0	0	111.7	G52 R53 G60	G52-A56 PolarHBondContact O-N 3.44Å; G52-A56 VanDerWaalsContact O-N 3.14Å; R53-A56 PolarHBondContact O-N 3.14Å; A56-G60 PolarHBondContact O-N 2.72Å
57	L	95.2	Very high	93.6	Very high	129 Å²	129	91.9 Å²	91.9	68%	0.675	53%	0.526	S	S	*	.	H	α-helix	trans	-67	-41.7	176.9	-177	64.1	0	0	0	111.5	R53 A54 D55 G60 A61	R53-L57 VanDerWaalsContact O-CB 3.28Å; R53-L57 WeakPolarHBondContact O-CB 3.49Å; R53-L57 PolarHBondContact O-N 2.72Å; A54-L57 CarbonylContact O-C 3.59Å; A54-L57 PolarHBondContact O-N 3.38Å; D55-L57 VanDerWaalsContact C-N 3.32Å; D55-L57 PolarHBondContact O-N 3.35Å; L57-G60 PolarHBondContact O-N 2.72Å; L57-A61 WeakPolarHBondContact O-CB 3.31Å; L57-A61 PolarHBondContact O-N 2.83Å
58	Q	95.7	Very high	93.3	Very high	141 Å²	141	88.4 Å²	88.4	66%	0.659	51%	0.512	S	S	*	.	H	α-helix	trans	-64.4	-43.9	177.8	177.9	173.4	-45	0	0	110.7	A54 D55 A61 S62	A54-Q58 WeakPolarHBondContact O-CB 3.22Å; A54-Q58 PolarHBondContact O-N 3.4Å; D55-Q58 PolarHBondContact O-N 2.84Å; Q58-A61 PolarHBondContact O-N 2.91Å; Q58-S62 VanDerWaalsContact O-CB 3.31Å; Q58-S62 WeakPolarHBondContact O-CB 3.45Å; Q58-S62 PolarHBondContact O-N 3.35Å
59	A	94.6	Very high	93	Very high	64 Å²	64	86.4 Å²	86.4	53%	0.529	50%	0.504	S	S	.	.	H	α-helix	trans	-62.4	-45.9	174.3	0	0	0	0	0	111.4	D55 S62 Q63	D55-A59 WeakPolarHBondContact O-CB 3.14Å; D55-A59 PolarHBondContact O-N 3.29Å; A59-S62 PolarHBondContact O-N 3.41Å; A59-Q63 WeakPolarHBondContact O-CB 3.13Å; A59-Q63 PolarHBondContact O-N 2.95Å
60	G	94.7	Very high	92.6	Very high	35 Å²	35	88.7 Å²	88.7	36%	0.361	51%	0.513	S	S	.	.	H	α-helix	trans	-62.6	-41.8	175.4	0	0	0	0	0	112.9	A56 L57 Q63 F64	A56-G60 PolarHBondContact O-N 2.72Å; L57-G60 PolarHBondContact O-N 2.72Å; G60-Q63 PolarHBondContact O-N 2.93Å; G60-F64 VanDerWaalsContact O-CB 3.3Å; G60-F64 WeakPolarHBondContact O-CB 3.26Å; G60-F64 PolarHBondContact O-N 2.89Å
61	A	94.9	Very high	92.1	Very high	50 Å²	50	88.2 Å²	88.2	41%	0.413	51%	0.51	S	S	.	.	H	α-helix	trans	-66.9	-41.2	177.2	0	0	0	0	0	111.5	L57 Q58 F64 E65	L57-A61 WeakPolarHBondContact O-CB 3.31Å; L57-A61 PolarHBondContact O-N 2.83Å; Q58-A61 PolarHBondContact O-N 2.91Å; A61-F64 CarbonylContact O-C 3.58Å; A61-F64 PolarHBondContact O-N 3.41Å; A61-E65 VanDerWaalsContact O-CB 3.3Å; A61-E65 WeakPolarHBondContact O-CB 3.3Å; A61-E65 PolarHBondContact O-N 2.75Å
62	S	92	Very high	91.7	Very high	69 Å²	69	91 Å²	91	48%	0.483	52%	0.518	S	S	.	.	H	α-helix	trans	-64.5	-41.9	174.6	-176.5	0	0	0	0	111.5	Q58 A59 E65 A66	Q58-S62 VanDerWaalsContact O-CB 3.31Å; Q58-S62 WeakPolarHBondContact O-CB 3.45Å; Q58-S62 PolarHBondContact O-N 3.35Å; A59-S62 PolarHBondContact O-N 3.41Å; S62-E65 PolarHBondContact O-N 3.3Å; S62-A66 WeakPolarHBondContact O-CB 3.24Å; S62-A66 PolarHBondContact O-N 2.81Å
63	Q	92.4	Very high	91.5	Very high	141 Å²	141	97.6 Å²	97.6	66%	0.659	53%	0.53	S	S	*	.	H	α-helix	trans	-64.9	-40.9	173.6	-174.9	176.4	70.3	0	0	111.9	A59 G60 S67	A59-Q63 WeakPolarHBondContact O-CB 3.13Å; A59-Q63 PolarHBondContact O-N 2.95Å; G60-Q63 PolarHBondContact O-N 2.93Å; Q63-S67 VanDerWaalsContact O-CB 3.26Å; Q63-S67 WeakPolarHBondContact O-CB 3.3Å; Q63-S67 PolarHBondContact O-N 3.41Å; Q63-S67 PolarHBondContact O-OG 3.21Å
64	F	91.1	Very high	91.1	Very high	154 Å²	154	97.1 Å²	97.1	68%	0.675	53%	0.532	S	S	*	.	H	α-helix	trans	-64.4	-44	175.1	-179.1	-98.3	0	0	0	111.4	G60 A61 S67 A68	G60-F64 VanDerWaalsContact O-CB 3.3Å; G60-F64 WeakPolarHBondContact O-CB 3.26Å; G60-F64 PolarHBondContact O-N 2.89Å; A61-F64 CarbonylContact O-C 3.58Å; A61-F64 PolarHBondContact O-N 3.41Å; F64-S67 PolarHBondContact O-N 2.7Å; F64-A68 HydrophobicContact CD1-CB 4.48Å; F64-A68 HydrophobicContact CE1-CB 4.25Å; F64-A68 WeakPolarHBondContact O-CA 3.32Å; F64-A68 WeakPolarHBondContact O-CB 3.49Å; F64-A68 PolarHBondContact O-N 2.8Å
65	E	90.5	Very high	90.7	Very high	143 Å²	143	100.2 Å²	100.2	67%	0.668	54%	0.537	S	S	*	.	H	α-helix	trans	-60.6	-50.3	175.8	-176.6	-173	-173.1	0	0	110.8	A61 S62 S67 A68 G69	A61-E65 VanDerWaalsContact O-CB 3.3Å; A61-E65 WeakPolarHBondContact O-CB 3.3Å; A61-E65 PolarHBondContact O-N 2.75Å; S62-E65 PolarHBondContact O-N 3.3Å; E65-S67 VanDerWaalsContact C-N 3.26Å; E65-S67 PolarHBondContact O-N 3.32Å; E65-A68 PolarHBondContact O-N 2.8Å; E65-G69 PolarHBondContact O-N 2.74Å
66	A	89.5	Confident	90.5	Very high	49 Å²	49	105.1 Å²	105.1	41%	0.405	55%	0.548	S	S	.	.	H	α-helix	trans	-59.2	-39.4	177.6	0	0	0	0	0	111.7	S62 K70	S62-A66 WeakPolarHBondContact O-CB 3.24Å; S62-A66 PolarHBondContact O-N 2.81Å; A66-K70 WeakPolarHBondContact O-CB 3.11Å; A66-K70 WeakPolarHBondContact O-CD 3.34Å; A66-K70 VanDerWaalsContact O-CG 3.24Å; A66-K70 WeakPolarHBondContact O-CG 3.22Å; A66-K70 PolarHBondContact O-N 3.31Å
67	S	85.9	Confident	90.3	Very high	55 Å²	55	111.1 Å²	111.1	39%	0.385	56%	0.557	S	S	.	*	H	α-helix	trans	-71.7	-47.5	177.5	-59.2	0	0	0	0	111.6	Q63 F64 E65 G69 K70 L71	Q63-S67 VanDerWaalsContact O-CB 3.26Å; Q63-S67 WeakPolarHBondContact O-CB 3.3Å; Q63-S67 PolarHBondContact O-N 3.41Å; Q63-S67 PolarHBondContact O-OG 3.21Å; F64-S67 PolarHBondContact O-N 2.7Å; E65-S67 VanDerWaalsContact C-N 3.26Å; E65-S67 PolarHBondContact O-N 3.32Å; S67-G69 VanDerWaalsContact C-N 3.34Å; S67-G69 PolarHBondContact O-N 3.47Å; S67-K70 PolarHBondContact O-N 3.46Å; S67-L71 WeakPolarHBondContact O-CB 3.48Å; S67-L71 WeakPolarHBondContact O-CD1 3.39Å; S67-L71 PolarHBondContact O-N 3.29Å
68	A	89.5	Confident	90.1	Very high	26 Å²	26	110.5 Å²	110.5	22%	0.215	55%	0.549	C	S	.	.	H	α-helix	trans	-62.1	-40.1	178.9	0	0	0	0	0	111.5	F64 E65 L71 K72	F64-A68 HydrophobicContact CD1-CB 4.48Å; F64-A68 HydrophobicContact CE1-CB 4.25Å; F64-A68 WeakPolarHBondContact O-CA 3.32Å; F64-A68 WeakPolarHBondContact O-CB 3.49Å; F64-A68 PolarHBondContact O-N 2.8Å; E65-A68 PolarHBondContact O-N 2.8Å; A68-L71 PolarHBondContact O-N 2.87Å; A68-K72 WeakPolarHBondContact O-CB 3.29Å; A68-K72 VanDerWaalsContact O-CG 3.29Å; A68-K72 WeakPolarHBondContact O-CG 3.35Å; A68-K72 PolarHBondContact O-N 2.82Å
69	G	88	Confident	89.9	Confident	41 Å²	41	108.6 Å²	108.6	42%	0.423	54%	0.543	S	S	.	.	H	α-helix	trans	-63.4	-46.8	174.5	0	0	0	0	0	112.3	E65 S67 K72 R73	E65-G69 PolarHBondContact O-N 2.74Å; S67-G69 VanDerWaalsContact C-N 3.34Å; S67-G69 PolarHBondContact O-N 3.47Å; G69-K72 PolarHBondContact O-N 2.9Å; G69-R73 PolarHBondContact O-N 3.27Å
70	K	86.2	Confident	89.8	Confident	146 Å²	146	109.5 Å²	109.5	64%	0.635	55%	0.545	S	S	*	.	H	α-helix	trans	-63.7	-41.3	175.1	-72.2	172.2	-173.8	174.8	0	112	A66 S67 R73 K74	A66-K70 WeakPolarHBondContact O-CB 3.11Å; A66-K70 WeakPolarHBondContact O-CD 3.34Å; A66-K70 VanDerWaalsContact O-CG 3.24Å; A66-K70 WeakPolarHBondContact O-CG 3.22Å; A66-K70 PolarHBondContact O-N 3.31Å; S67-K70 PolarHBondContact O-N 3.46Å; K70-R73 PolarHBondContact O-N 3.07Å; K70-K74 WeakPolarHBondContact O-CB 3.5Å; K70-K74 PolarHBondContact O-N 3.44Å
71	L	84.7	Confident	89.8	Confident	98 Å²	98	115.3 Å²	115.3	51%	0.513	56%	0.56	S	S	.	*	H	α-helix	trans	-63.1	-49.7	176.5	-97.8	62.6	0	0	0	110.8	S67 A68 R73 K74 F75	S67-L71 WeakPolarHBondContact O-CB 3.48Å; S67-L71 WeakPolarHBondContact O-CD1 3.39Å; S67-L71 PolarHBondContact O-N 3.29Å; A68-L71 PolarHBondContact O-N 2.87Å; L71-R73 VanDerWaalsContact C-N 3.32Å; L71-R73 PolarHBondContact O-N 3.17Å; L71-K74 PolarHBondContact O-N 3.23Å; L71-F75 WeakPolarHBondContact O-CB 3.34Å; L71-F75 WeakPolarHBondContact O-CD2 3.43Å; L71-F75 PolarHBondContact O-N 3.43Å
72	K	86.4	Confident	89.7	Confident	162 Å²	162	118.9 Å²	118.9	70%	0.704	57%	0.57	S	S	*	*	H	α-helix	trans	-53.1	-50.9	176.2	-80.4	-179.2	179.8	-178.1	0	110.6	A68 G69 F75 W76	A68-K72 WeakPolarHBondContact O-CB 3.29Å; A68-K72 VanDerWaalsContact O-CG 3.29Å; A68-K72 WeakPolarHBondContact O-CG 3.35Å; A68-K72 PolarHBondContact O-N 2.82Å; G69-K72 PolarHBondContact O-N 2.9Å; K72-F75 PolarHBondContact O-N 3.07Å; K72-W76 WeakPolarHBondContact O-CB 3.38Å; K72-W76 PolarHBondContact O-N 3.45Å
73	R	88.5	Confident	89.9	Confident	179 Å²	179	121.6 Å²	121.6	68%	0.675	58%	0.578	S	S	*	*	H	α-helix	trans	-62.4	-48.9	179.1	-164.6	164.7	75.6	-179.4	4.9	111.6	G69 K70 L71 F75 W76 W77	G69-R73 PolarHBondContact O-N 3.27Å; K70-R73 PolarHBondContact O-N 3.07Å; L71-R73 VanDerWaalsContact C-N 3.32Å; L71-R73 PolarHBondContact O-N 3.17Å; R73-F75 VanDerWaalsContact C-N 3.34Å; R73-F75 PolarHBondContact O-N 3.24Å; R73-W76 PolarHBondContact O-N 3.36Å; R73-W77 PolarHBondContact O-N 3.36Å; R73-W77 VanDerWaalsContact O-N 3.17Å
74	K	87.3	Confident	90	Very high	149 Å²	149	117.6 Å²	117.6	65%	0.648	57%	0.569	S	S	*	*	H	α-helix	trans	-60.3	-42.1	-179.4	-169.6	174.5	-175.7	177.6	0	112.2	K70 L71 K78	K70-K74 WeakPolarHBondContact O-CB 3.5Å; K70-K74 PolarHBondContact O-N 3.44Å; L71-K74 PolarHBondContact O-N 3.23Å; K74-K78 HydrophobicContact CG-CD 4.5Å; K74-K78 WeakPolarHBondContact O-CB 3.32Å; K74-K78 VanDerWaalsContact O-CG 3.32Å; K74-K78 WeakPolarHBondContact O-CG 3.39Å; K74-K78 PolarHBondContact O-N 3.45Å; K74-K78 VanDerWaalsContact O-N 3.07Å
75	F	87.8	Confident	90.3	Very high	114 Å²	114	113.8 Å²	113.8	50%	0.5	56%	0.559	S	S	.	*	H	α-helix	trans	-68.3	-39.1	177.4	-91.8	-86.7	0	0	0	112.6	L71 K72 R73 W77 K78 N79	L71-F75 WeakPolarHBondContact O-CB 3.34Å; L71-F75 WeakPolarHBondContact O-CD2 3.43Å; L71-F75 PolarHBondContact O-N 3.43Å; K72-F75 PolarHBondContact O-N 3.07Å; R73-F75 VanDerWaalsContact C-N 3.34Å; R73-F75 PolarHBondContact O-N 3.24Å; F75-W77 PolarHBondContact O-N 2.84Å; F75-K78 PolarHBondContact O-N 2.95Å; F75-N79 WeakPolarHBondContact O-CB 3.48Å; F75-N79 VanDerWaalsContact O-CG 3.25Å; F75-N79 PolarHBondContact O-N 3.27Å
76	W	89.9	Confident	90.5	Very high	198 Å²	198	112 Å²	112	75%	0.75	55%	0.553	S	S	*	*	H	α-helix	trans	-60.9	-45.9	179	-140.8	71	0	0	0	111.9	K72 R73 N79 C80	K72-W76 WeakPolarHBondContact O-CB 3.38Å; K72-W76 PolarHBondContact O-N 3.45Å; R73-W76 PolarHBondContact O-N 3.36Å; W76-N79 PolarHBondContact O-N 2.97Å; W76-C80 WeakPolarHBondContact O-CB 3.38Å; W76-C80 PolarHBondContact O-N 2.98Å
77	W	91.3	Very high	90.9	Very high	190 Å²	190	111.3 Å²	111.3	72%	0.72	55%	0.551	S	S	*	*	H	α-helix	trans	-66.6	-40.4	176.1	-76.2	72.4	0	0	0	112.4	R73 F75 K81	R73-W77 PolarHBondContact O-N 3.36Å; R73-W77 VanDerWaalsContact O-N 3.17Å; F75-W77 PolarHBondContact O-N 2.84Å; W77-K81 WeakPolarHBondContact O-CB 3.26Å; W77-K81 PolarHBondContact O-N 2.89Å
78	K	91.1	Very high	91.4	Very high	116 Å²	116	112.9 Å²	112.9	50%	0.504	56%	0.558	S	S	.	*	H	α-helix	trans	-61.5	-46.5	174.7	-77.7	-177.3	70	179	0	111.7	K74 F75 K81 M82	K74-K78 HydrophobicContact CG-CD 4.5Å; K74-K78 WeakPolarHBondContact O-CB 3.32Å; K74-K78 VanDerWaalsContact O-CG 3.32Å; K74-K78 WeakPolarHBondContact O-CG 3.39Å; K74-K78 PolarHBondContact O-N 3.45Å; K74-K78 VanDerWaalsContact O-N 3.07Å; F75-K78 PolarHBondContact O-N 2.95Å; K78-K81 PolarHBondContact O-N 2.97Å; K78-M82 WeakPolarHBondContact O-CB 3.36Å; K78-M82 VanDerWaalsContact O-CG 3.26Å; K78-M82 WeakPolarHBondContact O-CG 3.29Å; K78-M82 PolarHBondContact O-N 3.49Å
79	N	92	Very high	91.8	Very high	101 Å²	101	116.2 Å²	116.2	54%	0.54	57%	0.571	S	S	.	*	H	α-helix	trans	-65.3	-42.9	-179.7	-71.1	-10.8	0	0	0	111.4	F75 W76 M82 L83	F75-N79 WeakPolarHBondContact O-CB 3.48Å; F75-N79 VanDerWaalsContact O-CG 3.25Å; F75-N79 PolarHBondContact O-N 3.27Å; W76-N79 PolarHBondContact O-N 2.97Å; N79-M82 PolarHBondContact O-N 3.48Å; N79-L83 WeakPolarHBondContact O-CB 3.35Å; N79-L83 PolarHBondContact O-N 3.38Å
80	C	92.1	Very high	92.3	Very high	83 Å²	83	117.7 Å²	117.7	56%	0.561	57%	0.572	S	S	*	*	H	α-helix	trans	-60.8	-46.8	175	-177.2	0	0	0	0	111.7	W76 M82 L83 A84	W76-C80 WeakPolarHBondContact O-CB 3.38Å; W76-C80 PolarHBondContact O-N 2.98Å; C80-M82 PolarHBondContact O-N 3.43Å; C80-L83 PolarHBondContact O-N 3.36Å; C80-A84 PolarHBondContact O-N 2.86Å
81	K	94	Very high	92.8	Very high	157 Å²	157	114.6 Å²	114.6	68%	0.683	57%	0.566	S	S	*	*	H	α-helix	trans	-63.6	-41.2	176.9	-172.3	179.1	170.3	89.3	0	112	W77 K78 A84 V85	W77-K81 WeakPolarHBondContact O-CB 3.26Å; W77-K81 PolarHBondContact O-N 2.89Å; K78-K81 PolarHBondContact O-N 2.97Å; K81-A84 PolarHBondContact O-N 3.32Å; K81-V85 VanDerWaalsContact O-CG2 3.29Å; K81-V85 WeakPolarHBondContact O-CG2 3.42Å; K81-V85 PolarHBondContact O-N 3.38Å
82	M	93.5	Very high	93.5	Very high	126 Å²	126	114.3 Å²	114.3	62%	0.621	56%	0.563	S	S	*	*	H	α-helix	trans	-63.6	-41.7	176	-76.7	-61.1	-61.4	0	0	112	K78 N79 C80 V85 L86	K78-M82 WeakPolarHBondContact O-CB 3.36Å; K78-M82 VanDerWaalsContact O-CG 3.26Å; K78-M82 WeakPolarHBondContact O-CG 3.29Å; K78-M82 PolarHBondContact O-N 3.49Å; N79-M82 PolarHBondContact O-N 3.48Å; C80-M82 PolarHBondContact O-N 3.43Å; M82-V85 PolarHBondContact O-N 3.01Å; M82-L86 WeakPolarHBondContact O-CB 3.37Å; M82-L86 PolarHBondContact O-N 3.4Å
83	L	95.2	Very high	94	Very high	125 Å²	125	111.7 Å²	111.7	65%	0.654	56%	0.556	S	S	*	*	H	α-helix	trans	-64.3	-42.4	176.7	-173.3	67.7	0	0	0	111.4	N79 C80 L86 G87	N79-L83 WeakPolarHBondContact O-CB 3.35Å; N79-L83 PolarHBondContact O-N 3.38Å; C80-L83 PolarHBondContact O-N 3.36Å; L83-L86 PolarHBondContact O-N 2.91Å; L83-G87 PolarHBondContact O-N 3.36Å
84	A	96.2	Very high	94.5	Very high	58 Å²	58	107.3 Å²	107.3	48%	0.479	55%	0.546	S	S	.	.	H	α-helix	trans	-62.3	-44.9	175.7	0	0	0	0	0	112	C80 K81 L86 G87 V88	C80-A84 PolarHBondContact O-N 2.86Å; K81-A84 PolarHBondContact O-N 3.32Å; A84-L86 VanDerWaalsContact C-N 3.34Å; A84-L86 PolarHBondContact O-N 2.97Å; A84-G87 PolarHBondContact O-N 2.94Å; A84-V88 WeakPolarHBondContact O-CG2 3.3Å; A84-V88 PolarHBondContact O-N 3.47Å
85	V	96	Very high	95	Very high	74 Å²	74	104.8 Å²	104.8	45%	0.448	54%	0.538	S	S	.	.	H	α-helix	trans	-61.4	-43	176.3	169.8	0	0	0	0	111.3	K81 M82 V88 L89	K81-V85 VanDerWaalsContact O-CG2 3.29Å; K81-V85 WeakPolarHBondContact O-CG2 3.42Å; K81-V85 PolarHBondContact O-N 3.38Å; M82-V85 PolarHBondContact O-N 3.01Å; V85-V88 PolarHBondContact O-N 2.98Å; V85-L89 HydrophobicContact CG1-CD1 4.3Å; V85-L89 PolarHBondContact O-N 3.39Å
86	L	95.9	Very high	95.4	Very high	104 Å²	104	103.7 Å²	103.7	55%	0.545	54%	0.541	S	S	.	.	H	α-helix	trans	-61.4	-44.4	175.5	-178.3	63.8	0	0	0	111.5	M82 L83 A84 V88 L89 V90	M82-L86 WeakPolarHBondContact O-CB 3.37Å; M82-L86 PolarHBondContact O-N 3.4Å; L83-L86 PolarHBondContact O-N 2.91Å; A84-L86 VanDerWaalsContact C-N 3.34Å; A84-L86 PolarHBondContact O-N 2.97Å; L86-V88 PolarHBondContact O-N 3.26Å; L86-L89 WeakPolarHBondContact O-CB 3.39Å; L86-L89 PolarHBondContact O-N 3.06Å; L86-V90 WeakPolarHBondContact O-CG2 3.37Å; L86-V90 PolarHBondContact O-N 3.26Å
87	G	96.5	Very high	95.7	Very high	35 Å²	35	99.2 Å²	99.2	36%	0.361	53%	0.531	S	S	.	.	H	α-helix	trans	-59.9	-45	176.5	0	0	0	0	0	112.6	L83 A84 L89 V90 V91	L83-G87 PolarHBondContact O-N 3.36Å; A84-G87 PolarHBondContact O-N 2.94Å; G87-L89 VanDerWaalsContact C-N 3.35Å; G87-L89 PolarHBondContact O-N 3.49Å; G87-V90 PolarHBondContact O-N 2.98Å; G87-V91 WeakPolarHBondContact O-CG2 3.34Å; G87-V91 PolarHBondContact O-N 3.27Å
88	V	97.8	Very high	96	Very high	88 Å²	88	94.9 Å²	94.9	53%	0.533	52%	0.521	S	S	.	.	H	α-helix	trans	-61.4	-43.2	176.2	172	0	0	0	0	111.4	A84 V85 L86 V90 V91 I92	A84-V88 WeakPolarHBondContact O-CG2 3.3Å; A84-V88 PolarHBondContact O-N 3.47Å; V85-V88 PolarHBondContact O-N 2.98Å; L86-V88 PolarHBondContact O-N 3.26Å; V88-V90 VanDerWaalsContact C-N 3.35Å; V88-V90 PolarHBondContact O-N 2.95Å; V88-V91 PolarHBondContact O-N 3.45Å; V88-I92 HydrophobicContact CG1-CD1 3.82Å; V88-I92 HydrophobicContact CG1-CG1 4.42Å; V88-I92 VanDerWaalsContact O-CG1 3.3Å; V88-I92 WeakPolarHBondContact O-CG1 3.32Å; V88-I92 PolarHBondContact O-N 3.03Å
89	L	97.4	Very high	96.2	Very high	96 Å²	96	93.3 Å²	93.3	50%	0.503	52%	0.521	S	S	.	.	H	α-helix	trans	-57.6	-46	175.4	-103.4	153.6	0	0	0	112.1	V85 L86 G87 I92 L93	V85-L89 HydrophobicContact CG1-CD1 4.3Å; V85-L89 PolarHBondContact O-N 3.39Å; L86-L89 WeakPolarHBondContact O-CB 3.39Å; L86-L89 PolarHBondContact O-N 3.06Å; G87-L89 VanDerWaalsContact C-N 3.35Å; G87-L89 PolarHBondContact O-N 3.49Å; L89-I92 PolarHBondContact O-N 3.37Å; L89-L93 WeakPolarHBondContact O-CG 3.43Å; L89-L93 PolarHBondContact O-N 3.28Å
90	V	97.9	Very high	96.4	Very high	72 Å²	72	96.9 Å²	96.9	44%	0.436	53%	0.527	S	S	.	.	H	α-helix	trans	-63.4	-42.9	177.2	174.6	0	0	0	0	111.3	L86 G87 V88 I92 L93 I94	L86-V90 WeakPolarHBondContact O-CG2 3.37Å; L86-V90 PolarHBondContact O-N 3.26Å; G87-V90 PolarHBondContact O-N 2.98Å; V88-V90 VanDerWaalsContact C-N 3.35Å; V88-V90 PolarHBondContact O-N 2.95Å; V90-I92 PolarHBondContact O-N 2.97Å; V90-L93 PolarHBondContact O-N 2.94Å; V90-I94 HydrophobicContact CG1-CD1 3.86Å; V90-I94 HydrophobicContact CG1-CG1 4.44Å; V90-I94 WeakPolarHBondContact O-CG1 3.41Å; V90-I94 PolarHBondContact O-N 3.48Å
91	V	98.1	Very high	96.6	Very high	82 Å²	82	97 Å²	97	50%	0.497	53%	0.525	S	S	.	.	H	α-helix	trans	-61.4	-43.3	177.4	171	0	0	0	0	111.4	G87 V88 L93 I94 I95	G87-V91 WeakPolarHBondContact O-CG2 3.34Å; G87-V91 PolarHBondContact O-N 3.27Å; V88-V91 PolarHBondContact O-N 3.45Å; V91-L93 PolarHBondContact O-N 2.95Å; V91-I94 PolarHBondContact O-N 3.26Å; V91-I95 HydrophobicContact CG1-CD1 3.85Å; V91-I95 HydrophobicContact CG1-CG1 4.46Å; V91-I95 WeakPolarHBondContact O-CG1 3.38Å; V91-I95 PolarHBondContact O-N 3.25Å
92	I	98.1	Very high	96.6	Very high	91 Å²	91	94 Å²	94	47%	0.467	52%	0.519	S	S	.	.	H	α-helix	trans	-60.5	-45.8	176.4	-68.3	165.7	0	0	0	110.6	V88 L89 V90 I94 I95 V96	V88-I92 HydrophobicContact CG1-CD1 3.82Å; V88-I92 HydrophobicContact CG1-CG1 4.42Å; V88-I92 VanDerWaalsContact O-CG1 3.3Å; V88-I92 WeakPolarHBondContact O-CG1 3.32Å; V88-I92 PolarHBondContact O-N 3.03Å; L89-I92 PolarHBondContact O-N 3.37Å; V90-I92 PolarHBondContact O-N 2.97Å; I92-I94 VanDerWaalsContact C-N 3.32Å; I92-I94 PolarHBondContact O-N 3.42Å; I92-I95 PolarHBondContact O-N 3.46Å; I92-V96 WeakPolarHBondContact O-CG2 3.32Å; I92-V96 PolarHBondContact O-N 3.26Å
93	L	97.7	Very high	96.6	Very high	107 Å²	107	90.8 Å²	90.8	56%	0.56	51%	0.509	S	S	*	.	H	α-helix	trans	-60.5	-41.6	177.2	-70.1	176	0	0	0	111.9	L89 V90 V91 V96 L97	L89-L93 WeakPolarHBondContact O-CG 3.43Å; L89-L93 PolarHBondContact O-N 3.28Å; V90-L93 PolarHBondContact O-N 2.94Å; V91-L93 PolarHBondContact O-N 2.95Å; L93-V96 PolarHBondContact O-N 2.97Å; L93-L97 WeakPolarHBondContact O-CG 3.36Å; L93-L97 PolarHBondContact O-N 3.4Å
94	I	98	Very high	96.5	Very high	88 Å²	88	88.7 Å²	88.7	45%	0.451	50%	0.496	S	S	.	.	H	α-helix	trans	-62.9	-44.7	176.4	-69.3	168.6	0	0	0	111	V90 V91 I92 V96 L97 I98	V90-I94 HydrophobicContact CG1-CD1 3.86Å; V90-I94 HydrophobicContact CG1-CG1 4.44Å; V90-I94 WeakPolarHBondContact O-CG1 3.41Å; V90-I94 PolarHBondContact O-N 3.48Å; V91-I94 PolarHBondContact O-N 3.26Å; I92-I94 VanDerWaalsContact C-N 3.32Å; I92-I94 PolarHBondContact O-N 3.42Å; I94-V96 PolarHBondContact O-N 2.93Å; I94-L97 PolarHBondContact O-N 3.27Å; I94-I98 HydrophobicContact CG2-CD1 3.75Å; I94-I98 HydrophobicContact CG2-CG1 4.39Å; I94-I98 VanDerWaalsContact O-CG1 3.29Å; I94-I98 WeakPolarHBondContact O-CG1 3.4Å; I94-I98 PolarHBondContact O-N 3.47Å
95	I	97.7	Very high	96.1	Very high	96 Å²	96	91.6 Å²	91.6	49%	0.492	50%	0.5	S	S	.	.	H	α-helix	trans	-61.1	-45.1	178	-68.7	166.8	0	0	0	110.7	V91 I92 L97 I98 V99	V91-I95 HydrophobicContact CG1-CD1 3.85Å; V91-I95 HydrophobicContact CG1-CG1 4.46Å; V91-I95 WeakPolarHBondContact O-CG1 3.38Å; V91-I95 PolarHBondContact O-N 3.25Å; I92-I95 PolarHBondContact O-N 3.46Å; I95-L97 VanDerWaalsContact C-N 3.34Å; I95-L97 PolarHBondContact O-N 2.96Å; I95-I98 PolarHBondContact O-N 3.26Å; I95-V99 HydrophobicContact CG2-CG2 4.47Å; I95-V99 WeakPolarHBondContact O-CG2 3.32Å; I95-V99 PolarHBondContact O-N 3.46Å
96	V	97.3	Very high	95.7	Very high	90 Å²	90	94 Å²	94	55%	0.545	50%	0.504	S	S	.	.	H	α-helix	trans	-61	-43	177.3	171.8	0	0	0	0	111.2	I92 L93 I94 V99 W100	I92-V96 WeakPolarHBondContact O-CG2 3.32Å; I92-V96 PolarHBondContact O-N 3.26Å; L93-V96 PolarHBondContact O-N 2.97Å; I94-V96 PolarHBondContact O-N 2.93Å; V96-V99 PolarHBondContact O-N 3.03Å; V96-W100 WeakPolarHBondContact O-CB 3.37Å; V96-W100 PolarHBondContact O-N 3.42Å
97	L	96.8	Very high	95.2	Very high	105 Å²	105	93.3 Å²	93.3	55%	0.55	50%	0.501	S	S	.	.	H	α-helix	trans	-62.4	-42.8	176	-73.8	178.4	0	0	0	112.2	L93 I94 I95 W100 V101	L93-L97 WeakPolarHBondContact O-CG 3.36Å; L93-L97 PolarHBondContact O-N 3.4Å; I94-L97 PolarHBondContact O-N 3.27Å; I95-L97 VanDerWaalsContact C-N 3.34Å; I95-L97 PolarHBondContact O-N 2.96Å; L97-W100 PolarHBondContact O-N 3.41Å; L97-V101 VanDerWaalsContact O-CG2 3.31Å; L97-V101 WeakPolarHBondContact O-CG2 3.31Å; L97-V101 PolarHBondContact O-N 2.97Å
98	I	96.7	Very high	94.6	Very high	98 Å²	98	96.9 Å²	96.9	50%	0.503	51%	0.506	S	S	.	.	H	α-helix	trans	-62.7	-46.6	177.8	-68.2	166.2	0	0	0	110.6	I94 I95 W100 V101 V102	I94-I98 HydrophobicContact CG2-CD1 3.75Å; I94-I98 HydrophobicContact CG2-CG1 4.39Å; I94-I98 VanDerWaalsContact O-CG1 3.29Å; I94-I98 WeakPolarHBondContact O-CG1 3.4Å; I94-I98 PolarHBondContact O-N 3.47Å; I95-I98 PolarHBondContact O-N 3.26Å; I98-W100 PolarHBondContact O-N 3.48Å; I98-V101 PolarHBondContact O-N 3.1Å; I98-V102 HydrophobicContact CG2-CG2 4.38Å; I98-V102 WeakPolarHBondContact O-CB 3.41Å; I98-V102 VanDerWaalsContact O-CG2 3.32Å; I98-V102 WeakPolarHBondContact O-CG2 3.29Å; I98-V102 PolarHBondContact O-N 3.46Å
99	V	96.4	Very high	93.8	Very high	83 Å²	83	96.9 Å²	96.9	50%	0.503	51%	0.506	S	S	.	.	H	α-helix	trans	-61.2	-45.2	178.6	172.4	0	0	0	0	110.7	I95 V96 V101 V102 S103	I95-V99 HydrophobicContact CG2-CG2 4.47Å; I95-V99 WeakPolarHBondContact O-CG2 3.32Å; I95-V99 PolarHBondContact O-N 3.46Å; V96-V99 PolarHBondContact O-N 3.03Å; V99-V101 PolarHBondContact O-N 2.89Å; V99-V102 PolarHBondContact O-N 3.48Å; V99-S103 WeakPolarHBondContact O-CB 3.5Å; V99-S103 PolarHBondContact O-N 3.39Å; V99-S103 PolarHBondContact O-OG 3.05Å; V99-S103 VanDerWaalsContact O-OG 3.1Å
100	W	96.1	Very high	92.8	Very high	177 Å²	177	96.6 Å²	96.6	67%	0.67	50%	0.503	S	S	*	.	H	α-helix	trans	-61.4	-44	179.4	-173.4	55.8	0	0	0	112.4	V96 L97 I98 S103 E104	V96-W100 WeakPolarHBondContact O-CB 3.37Å; V96-W100 PolarHBondContact O-N 3.42Å; L97-W100 PolarHBondContact O-N 3.41Å; I98-W100 PolarHBondContact O-N 3.48Å; W100-S103 PolarHBondContact O-N 3.12Å; W100-E104 WeakPolarHBondContact O-CB 3.49Å; W100-E104 PolarHBondContact O-N 3.47Å
101	V	95.5	Very high	91.7	Very high	85 Å²	85	100.4 Å²	100.4	52%	0.515	52%	0.516	S	S	.	.	H	α-helix	trans	-64.7	-43	177	170.8	0	0	0	0	111.7	L97 I98 V99 Q105	L97-V101 VanDerWaalsContact O-CG2 3.31Å; L97-V101 WeakPolarHBondContact O-CG2 3.31Å; L97-V101 PolarHBondContact O-N 2.97Å; I98-V101 PolarHBondContact O-N 3.1Å; V99-V101 PolarHBondContact O-N 2.89Å; V101-Q105 WeakPolarHBondContact O-CG 3.12Å; V101-Q105 PolarHBondContact O-N 3.41Å
102	V	94.9	Very high	90.3	Very high	94 Å²	94	100.3 Å²	100.3	57%	0.57	52%	0.518	S	S	*	.	H	α-helix	trans	-67.5	-40.4	179	171.5	0	0	0	0	111.5	I98 V99 Q105 K106	I98-V102 HydrophobicContact CG2-CG2 4.38Å; I98-V102 WeakPolarHBondContact O-CB 3.41Å; I98-V102 VanDerWaalsContact O-CG2 3.32Å; I98-V102 WeakPolarHBondContact O-CG2 3.29Å; I98-V102 PolarHBondContact O-N 3.46Å; V99-V102 PolarHBondContact O-N 3.48Å; V102-Q105 PolarHBondContact O-N 3.33Å; V102-K106 PolarHBondContact O-N 2.97Å; V102-K106 VanDerWaalsContact O-N 3.1Å
103	S	93.6	Very high	89	Confident	59 Å²	59	102.4 Å²	102.4	41%	0.413	53%	0.526	S	S	.	.	H	α-helix	trans	-64.5	-41.1	176.8	-66.8	0	0	0	0	112.4	V99 W100 Q105 K106 N107	V99-S103 WeakPolarHBondContact O-CB 3.5Å; V99-S103 PolarHBondContact O-N 3.39Å; V99-S103 PolarHBondContact O-OG 3.05Å; V99-S103 VanDerWaalsContact O-OG 3.1Å; W100-S103 PolarHBondContact O-N 3.12Å; S103-Q105 VanDerWaalsContact C-N 3.34Å; S103-Q105 PolarHBondContact O-N 3.48Å; S103-K106 PolarHBondContact O-N 3.09Å; S103-N107 PolarHBondContact O-N 3.22Å; S103-N107 VanDerWaalsContact O-N 3.09Å; S103-N107 PolarHBondContact O-ND2 3.08Å; S103-N107 VanDerWaalsContact O-ND2 3.12Å
104	E	91.3	Very high	87.5	Confident	80 Å²	80	104.5 Å²	104.5	37%	0.374	53%	0.533	S	S	.	.	H	α-helix	trans	-63.2	-39.7	177.2	-176.2	60.4	-159.7	0	0	112	W100 N107 K108	W100-E104 WeakPolarHBondContact O-CB 3.49Å; W100-E104 PolarHBondContact O-N 3.47Å; E104-N107 PolarHBondContact O-N 3.37Å; E104-K108 PolarHBondContact O-N 3.1Å; E104-K108 WeakPolarHBondContact OE1-CE 3.38Å; E104-K108 IonicContact OE1-NZ 2.72Å; E104-K108 PolarHBondContact OE1-NZ 3.3Å
105	Q	88.7	Confident	86.1	Confident	120 Å²	120	103.9 Å²	103.9	56%	0.561	54%	0.536	S	S	*	.	H	α-helix	trans	-66.8	-37.5	176.2	-66.6	-70.3	79.9	0	0	112.1	V101 V102 S103 K108 V109	V101-Q105 WeakPolarHBondContact O-CG 3.12Å; V101-Q105 PolarHBondContact O-N 3.41Å; V102-Q105 PolarHBondContact O-N 3.33Å; S103-Q105 VanDerWaalsContact C-N 3.34Å; S103-Q105 PolarHBondContact O-N 3.48Å; Q105-K108 PolarHBondContact O-N 3.2Å; Q105-V109 WeakPolarHBondContact O-CG2 3.48Å; Q105-V109 PolarHBondContact O-N 3.14Å
106	K	87.4	Confident	84.6	Confident	125 Å²	125	102.9 Å²	102.9	54%	0.543	54%	0.538	S	S	.	.	H	α-helix	trans	-64	-45.2	176.6	-170.8	-175.2	171	-163.7	0	111.8	V102 S103 K108 V109 E110	V102-K106 PolarHBondContact O-N 2.97Å; V102-K106 VanDerWaalsContact O-N 3.1Å; S103-K106 PolarHBondContact O-N 3.09Å; K106-K108 VanDerWaalsContact C-N 3.28Å; K106-K108 PolarHBondContact O-N 3.29Å; K106-V109 PolarHBondContact O-N 3.26Å; K106-V109 VanDerWaalsContact O-N 3.14Å; K106-E110 WeakPolarHBondContact CE-OE1 3.33Å; K106-E110 IonicContact NZ-OE1 3.47Å; K106-E110 PolarHBondContact NZ-OE1 3.46Å; K106-E110 PolarHBondContact O-N 3.13Å
107	N	86.7	Confident	82.8	Confident	88 Å²	88	105.1 Å²	105.1	47%	0.471	54%	0.542	S	S	.	.	H	α-helix	trans	-59	-37	179.6	-69.1	-39.4	0	0	0	112.5	S103 E104 Q111	S103-N107 PolarHBondContact O-N 3.22Å; S103-N107 VanDerWaalsContact O-N 3.09Å; S103-N107 PolarHBondContact O-ND2 3.08Å; S103-N107 VanDerWaalsContact O-ND2 3.12Å; E104-N107 PolarHBondContact O-N 3.37Å; N107-Q111 PolarHBondContact O-N 2.72Å
108	K	83.1	Confident	81.2	Confident	110 Å²	110	106.6 Å²	106.6	48%	0.478	55%	0.546	S	S	.	.	H	α-helix	trans	-68.8	-33.1	178	-66.5	-174	-160.9	-53.6	0	113.2	E104 Q105 K106 S112	E104-K108 PolarHBondContact O-N 3.1Å; E104-K108 WeakPolarHBondContact OE1-CE 3.38Å; E104-K108 IonicContact OE1-NZ 2.72Å; E104-K108 PolarHBondContact OE1-NZ 3.3Å; Q105-K108 PolarHBondContact O-N 3.2Å; K106-K108 VanDerWaalsContact C-N 3.28Å; K106-K108 PolarHBondContact O-N 3.29Å; K108-S112 PolarHBondContact O-N 3.46Å
109	V	79.8	Confident	79.6	Confident	88 Å²	88	107.5 Å²	107.5	53%	0.533	55%	0.551	S	S	.	*	H	α-helix	trans	-72.4	-46.2	179.4	176.5	0	0	0	0	110.8	Q105 K106 Q111 S112 E113	Q105-V109 WeakPolarHBondContact O-CG2 3.48Å; Q105-V109 PolarHBondContact O-N 3.14Å; K106-V109 PolarHBondContact O-N 3.26Å; K106-V109 VanDerWaalsContact O-N 3.14Å; V109-Q111 VanDerWaalsContact C-N 3.26Å; V109-Q111 PolarHBondContact O-N 3.43Å; V109-S112 PolarHBondContact O-N 3.36Å; V109-S112 VanDerWaalsContact O-N 3.13Å; V109-E113 PolarHBondContact O-N 3.08Å; V109-E113 VanDerWaalsContact O-N 3.08Å
110	E	77.6	Confident	78.4	Confident	91 Å²	91	108.1 Å²	108.1	43%	0.425	56%	0.555	S	S	.	*	H	α-helix	trans	-61.9	-34.4	179.5	-69.9	175.9	146.2	0	0	111.8	K106 H114	K106-E110 WeakPolarHBondContact CE-OE1 3.33Å; K106-E110 IonicContact NZ-OE1 3.47Å; K106-E110 PolarHBondContact NZ-OE1 3.46Å; K106-E110 PolarHBondContact O-N 3.13Å; E110-H114 WeakPolarHBondContact O-CB 3.49Å; E110-H114 PolarHBondContact O-N 3.31Å; E110-H114 VanDerWaalsContact O-N 3.08Å
111	Q	73.7	Confident	77.1	Confident	152 Å²	152	105.9 Å²	105.9	71%	0.71	55%	0.553	S	S	*	*	H	α-helix	trans	-70.7	-34.4	176.4	-168.6	163.9	-1.7	0	0	113.1	N107 V109 S115	N107-Q111 PolarHBondContact O-N 2.72Å; V109-Q111 VanDerWaalsContact C-N 3.26Å; V109-Q111 PolarHBondContact O-N 3.43Å; Q111-S115 WeakPolarHBondContact O-CB 3.48Å; Q111-S115 PolarHBondContact O-N 3.33Å; Q111-S115 VanDerWaalsContact O-N 3.15Å
112	S	69.9	Low	75.9	Confident	79 Å²	79	106.9 Å²	106.9	55%	0.552	56%	0.556	S	S	*	*	H	α-helix	trans	-67.9	-44.2	173.8	-80.7	0	0	0	0	111.9	K108 V109 S115 S116	K108-S112 PolarHBondContact O-N 3.46Å; V109-S112 PolarHBondContact O-N 3.36Å; V109-S112 VanDerWaalsContact O-N 3.13Å; S112-S115 PolarHBondContact O-N 3.21Å; S112-S116 PolarHBondContact O-N 3.46Å; S112-S116 PolarHBondContact O-OG 3.36Å
113	E	70.9	Confident	75	Confident	136 Å²	136	107.1 Å²	107.1	64%	0.636	55%	0.554	S	S	*	*	H	α-helix	trans	-64.5	-41.5	178.3	-74.1	-172.3	130.2	0	0	112	V109 S115 S116 H117	V109-E113 PolarHBondContact O-N 3.08Å; V109-E113 VanDerWaalsContact O-N 3.08Å; E113-S115 VanDerWaalsContact C-N 3.35Å; E113-S115 PolarHBondContact O-N 3.04Å; E113-S116 PolarHBondContact O-N 3.15Å; E113-H117 PolarHBondContact O-N 3.49Å; E113-H117 VanDerWaalsContact O-N 3.11Å
114	H	66.3	Low	73.9	Confident	151 Å²	151	107.1 Å²	107.1	70%	0.699	55%	0.554	S	S	*	*	H	α-helix	trans	-64.6	-39.1	177.5	-168.5	64.5	0	0	0	112.3	E110 H117 H118	E110-H114 WeakPolarHBondContact O-CB 3.49Å; E110-H114 PolarHBondContact O-N 3.31Å; E110-H114 VanDerWaalsContact O-N 3.08Å; H114-H117 PolarHBondContact O-N 3.32Å; H114-H118 PolarHBondContact O-N 3.11Å
115	S	68.6	Low	72.6	Confident	74 Å²	74	106.5 Å²	106.5	52%	0.517	56%	0.559	S	S	.	*	H	α-helix	trans	-68.5	-35.6	177.1	-165.9	0	0	0	0	112.6	Q111 S112 E113 L119	Q111-S115 WeakPolarHBondContact O-CB 3.48Å; Q111-S115 PolarHBondContact O-N 3.33Å; Q111-S115 VanDerWaalsContact O-N 3.15Å; S112-S115 PolarHBondContact O-N 3.21Å; E113-S115 VanDerWaalsContact C-N 3.35Å; E113-S115 PolarHBondContact O-N 3.04Å; S115-L119 PolarHBondContact O-N 3.29Å
116	S	64.8	Low	71.3	Confident	76 Å²	76	106.5 Å²	106.5	53%	0.531	56%	0.559	S	S	.	*	H	α-helix	trans	-67.7	-39.8	176.5	-65	0	0	0	0	112.3	S112 E113 H118 L119 V120	S112-S116 PolarHBondContact O-N 3.46Å; S112-S116 PolarHBondContact O-OG 3.36Å; E113-S116 PolarHBondContact O-N 3.15Å; S116-H118 VanDerWaalsContact C-N 3.3Å; S116-H118 PolarHBondContact O-N 3.17Å; S116-L119 PolarHBondContact O-N 3.42Å; S116-L119 VanDerWaalsContact O-N 3.17Å; S116-V120 PolarHBondContact O-N 3.22Å
117	H	61	Low	70.2	Confident	137 Å²	137	105.6 Å²	105.6	63%	0.634	56%	0.559	S	S	*	*	H	α-helix	trans	-68.5	-31.1	-178.5	-136.9	-77.9	0	0	0	112.5	E113 H114	E113-H117 PolarHBondContact O-N 3.49Å; E113-H117 VanDerWaalsContact O-N 3.11Å; H114-H117 PolarHBondContact O-N 3.32Å
118	H	62.8	Low	69.4	Low	136 Å²	136	108.2 Å²	108.2	63%	0.63	57%	0.572	S	S	*	*	H	α-helix	trans	-69.7	-36.3	171.8	-176.9	-85.5	0	0	0	112.3	H114 S116 D122	H114-H118 PolarHBondContact O-N 3.11Å; S116-H118 VanDerWaalsContact C-N 3.3Å; S116-H118 PolarHBondContact O-N 3.17Å; H118-D122 PolarHBondContact O-N 3.31Å
119	L	63.5	Low	68.6	Low	117 Å²	117	107.1 Å²	107.1	61%	0.613	58%	0.579	S	S	*	*	H	α-helix	trans	-74.5	-32.1	-175	-140.4	140.8	0	0	0	113.4	S115 S116 N123	S115-L119 PolarHBondContact O-N 3.29Å; S116-L119 PolarHBondContact O-N 3.42Å; S116-L119 VanDerWaalsContact O-N 3.17Å; L119-N123 PolarHBondContact O-N 3.5Å; L119-N123 VanDerWaalsContact O-N 3.15Å
120	V	70.5	Confident	68.1	Low	96 Å²	96	110.2 Å²	110.2	58%	0.582	59%	0.587	S	S	*	*	H	α-helix	trans	-70.9	-35	176.4	177.4	0	0	0	0	112	S116 S124	S116-V120 PolarHBondContact O-N 3.22Å; V120-S124 WeakPolarHBondContact O-CB 3.49Å; V120-S124 PolarHBondContact O-N 2.82Å; V120-S124 PolarHBondContact O-OG 3.23Å
121	M	67.9	Low	67.3	Low	129 Å²	129	117 Å²	117	64%	0.635	62%	0.619	S	S	*	*	H	α-helix	trans	-68.3	-38.5	176.4	-75.5	-67.8	176.6	0	0	111.6	S124 S125	M121-S124 PolarHBondContact O-N 2.88Å; M121-S125 PolarHBondContact O-N 3.4Å; M121-S125 PolarHBondContact O-OG 3.41Å
122	D	71.2	Confident	66.9	Low	107 Å²	107	115.3 Å²	115.3	57%	0.572	61%	0.614	S	S	*	*	H	α-helix	trans	-72.3	-34.3	179.2	-159	45.3	0	0	0	113.1	H118 S125 H126	H118-D122 PolarHBondContact O-N 3.31Å; D122-S125 PolarHBondContact O-OG 3.34Å; D122-H126 PolarHBondContact O-N 3.15Å
123	N	75.5	Confident	66.8	Low	99 Å²	99	117.2 Å²	117.2	53%	0.529	62%	0.617	S	S	.	*	H	α-helix	trans	-73.6	-29.7	175.7	-168.5	72.4	0	0	0	112.9	L119 L127	L119-N123 PolarHBondContact O-N 3.5Å; L119-N123 VanDerWaalsContact O-N 3.15Å; N123-L127 PolarHBondContact O-N 3.5Å
124	S	70	Confident	66.6	Low	59 Å²	59	116.1 Å²	116.1	41%	0.413	62%	0.616	S	S	.	*	H	α-helix	trans	-76.2	-34.1	-179.2	-58	0	0	0	0	112.5	V120 M121 H126 L128	V120-S124 WeakPolarHBondContact O-CB 3.49Å; V120-S124 PolarHBondContact O-N 2.82Å; V120-S124 PolarHBondContact O-OG 3.23Å; M121-S124 PolarHBondContact O-N 2.88Å; S124-H126 VanDerWaalsContact C-N 3.33Å; S124-L128 PolarHBondContact O-N 3.3Å
125	S	64.6	Low	66.6	Low	67 Å²	67	114.1 Å²	114.1	47%	0.469	61%	0.612	S	S	.	*	H	α-helix	trans	-66.2	-37.2	173.7	53.9	0	0	0	0	111.5	M121 D122 L128	M121-S125 PolarHBondContact O-N 3.4Å; M121-S125 PolarHBondContact O-OG 3.41Å; D122-S125 PolarHBondContact O-OG 3.34Å; S125-L128 PolarHBondContact O-N 3.45Å
126	H	62.2	Low	66.5	Low	120 Å²	120	116.6 Å²	116.6	56%	0.556	62%	0.617	S	S	*	*	H	α-helix	trans	-68.4	-35.3	178	-165.2	-79.6	0	0	0	113.3	D122 S124 S129	D122-H126 PolarHBondContact O-N 3.15Å; S124-H126 VanDerWaalsContact C-N 3.33Å; H126-S129 PolarHBondContact O-N 2.86Å; H126-S129 PolarHBondContact O-OG 3.47Å
127	L	64.7	Low	66.6	Low	106 Å²	106	119.3 Å²	119.3	56%	0.555	62%	0.623	S	S	*	*	H	α-helix	trans	-73	-27	177.9	-81.1	-179.3	0	0	0	114	N123 S129	N123-L127 PolarHBondContact O-N 3.5Å; L127-S129 VanDerWaalsContact C-N 3.28Å; L127-S129 PolarHBondContact O-N 3.49Å
128	L	68.5	Low	67	Low	143 Å²	143	118 Å²	118	75%	0.749	62%	0.622	S	S	*	*	H	α-helix	trans	-76.6	-13.1	176.7	-71.4	174.4	0	0	0	113.4	S124 S125	S124-L128 PolarHBondContact O-N 3.3Å; S125-L128 PolarHBondContact O-N 3.45Å
129	S	67.6	Low	67.3	Low	87 Å²	87	116.6 Å²	116.6	61%	0.608	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.8	-8.2	177.7	49.3	0	0	0	0	115.4	H126 L127	H126-S129 PolarHBondContact O-N 2.86Å; H126-S129 PolarHBondContact O-OG 3.47Å; L127-S129 VanDerWaalsContact C-N 3.28Å; L127-S129 PolarHBondContact O-N 3.49Å
130	E	68.1	Low	67.6	Low	152 Å²	152	116.6 Å²	116.6	71%	0.71	62%	0.623	S	S	*	*			trans	-98.1	-4	178.1	-88.4	-150.9	111.8	0	0	114.7
131	Q	60.4	Low	67.3	Low	234 Å²	234	118.5 Å²	118.5	100%	1.093	63%	0.626	S	S	*	*			trans	-97	0	171	-67	-71.8	-71.8	0	0	110.2

Retrieved 131 of 131 residues in 48.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).