SYUA_BOVIN Loading...

Alpha-synuclein

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release (By similarity). Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores (By similarity). Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis (By similarity). Also acts as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5 (By similarity). This chaperone activity is important to sustain normal SNARE-complex assembly during aging (By similarity). Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity (By similarity).

AlphaFold DB , UniProt , Accession Q3T0G8, Species BOVIN (Bos taurus, Bovine), Gene SNCA, Length 140 aa.

						>SYUA_BOVIN|Q3T0G8|SNCA
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGRTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDHMGKGEEGASQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	86.9	Confident	90.2	Very high	188 Å²	188	116.9 Å²	116.9	93%	0.926	62%	0.621	S	S	*	*				0	-4.1	0	-75.2	176.5	-179.5	0	0	112.4	V3 F4 M5	M1-V3 PolarHBondContact O-N 3.15Å; M1-F4 WeakPolarHBondContact O-CB 3.38Å; M1-F4 PolarHBondContact O-N 3.47Å; M1-F4 VanDerWaalsContact O-N 3.11Å; M1-M5 PolarHBondContact O-N 3.28Å
2	D	89.8	Confident	90.1	Very high	134 Å²	134	119.7 Å²	119.7	72%	0.717	62%	0.624	S	S	*	*	H	α-helix	trans	-67.4	-37.5	-168.4	-48.9	-66.7	0	0	0	113.5	F4 M5 K6	D2-F4 VanDerWaalsContact C-N 3.27Å; D2-F4 PolarHBondContact O-N 3.47Å; D2-M5 PolarHBondContact O-N 2.82Å; D2-K6 WeakPolarHBondContact O-CB 3.4Å; D2-K6 PolarHBondContact O-N 3.34Å
3	V	92.2	Very high	90.2	Very high	129 Å²	129	120.8 Å²	120.8	78%	0.782	62%	0.624	S	S	*	*	H	α-helix	trans	-61.2	-39	175.1	-177.9	0	0	0	0	111.1	M1 G7	M1-V3 PolarHBondContact O-N 3.15Å; V3-G7 PolarHBondContact O-N 3.38Å
4	F	90.5	Very high	90.2	Very high	147 Å²	147	115.2 Å²	115.2	65%	0.645	61%	0.611	S	S	*	*	H	α-helix	trans	-68	-46.6	176.9	178	-94.1	0	0	0	111.4	M1 D2 K6 G7 L8	M1-F4 WeakPolarHBondContact O-CB 3.38Å; M1-F4 PolarHBondContact O-N 3.47Å; M1-F4 VanDerWaalsContact O-N 3.11Å; D2-F4 VanDerWaalsContact C-N 3.27Å; D2-F4 PolarHBondContact O-N 3.47Å; F4-K6 VanDerWaalsContact C-N 3.3Å; F4-K6 PolarHBondContact O-N 3.06Å; F4-G7 WeakPolarHBondContact O-CA 2.92Å; F4-G7 PolarHBondContact O-N 3.16Å; F4-G7 VanDerWaalsContact O-N 3.1Å; F4-L8 WeakPolarHBondContact O-CB 3.37Å; F4-L8 PolarHBondContact O-N 3.35Å
5	M	89.9	Confident	90.4	Very high	108 Å²	108	114.3 Å²	114.3	53%	0.532	61%	0.611	S	S	.	*	H	α-helix	trans	-60	-40.8	176.2	-71.8	-65.2	-165	0	0	112.1	M1 D2 L8 S9	M1-M5 PolarHBondContact O-N 3.28Å; D2-M5 PolarHBondContact O-N 2.82Å; M5-L8 PolarHBondContact O-N 3.04Å; M5-S9 WeakPolarHBondContact O-CB 3.34Å; M5-S9 PolarHBondContact O-N 3.01Å; M5-S9 PolarHBondContact O-OG 3Å
6	K	91.4	Very high	90.5	Very high	166 Å²	166	111.3 Å²	111.3	72%	0.722	60%	0.598	S	S	*	*	H	α-helix	trans	-63.9	-41.7	173.7	-171.7	174.5	-177	173.5	0	111.7	D2 F4 S9 K10	D2-K6 WeakPolarHBondContact O-CB 3.4Å; D2-K6 PolarHBondContact O-N 3.34Å; F4-K6 VanDerWaalsContact C-N 3.3Å; F4-K6 PolarHBondContact O-N 3.06Å; K6-S9 PolarHBondContact O-N 3.43Å; K6-K10 WeakPolarHBondContact O-CB 3.28Å; K6-K10 PolarHBondContact O-N 2.96Å
7	G	90.5	Very high	90.4	Very high	39 Å²	39	108.1 Å²	108.1	40%	0.402	59%	0.59	S	S	.	*	H	α-helix	trans	-63.1	-46.8	175.7	0	0	0	0	0	113	V3 F4 S9 K10 A11	V3-G7 PolarHBondContact O-N 3.38Å; F4-G7 WeakPolarHBondContact O-CA 2.92Å; F4-G7 PolarHBondContact O-N 3.16Å; F4-G7 VanDerWaalsContact O-N 3.1Å; G7-S9 PolarHBondContact O-N 3.28Å; G7-K10 PolarHBondContact O-N 3.18Å; G7-A11 WeakPolarHBondContact O-CB 3.4Å; G7-A11 PolarHBondContact O-N 2.89Å
8	L	90.4	Very high	90.3	Very high	98 Å²	98	105.1 Å²	105.1	51%	0.513	58%	0.583	S	S	.	*	H	α-helix	trans	-61.4	-43.2	176.4	180	62.5	0	0	0	111.6	F4 M5 A11 K12	F4-L8 WeakPolarHBondContact O-CB 3.37Å; F4-L8 PolarHBondContact O-N 3.35Å; M5-L8 PolarHBondContact O-N 3.04Å; L8-A11 PolarHBondContact O-N 3.32Å; L8-K12 WeakPolarHBondContact O-CB 3.4Å; L8-K12 PolarHBondContact O-N 3.31Å
9	S	90.8	Very high	90.4	Very high	61 Å²	61	102.7 Å²	102.7	43%	0.427	58%	0.578	S	S	.	*	H	α-helix	trans	-63.6	-45.2	177.6	-57.9	0	0	0	0	111.4	M5 K6 G7 A11 K12 E13	M5-S9 WeakPolarHBondContact O-CB 3.34Å; M5-S9 PolarHBondContact O-N 3.01Å; M5-S9 PolarHBondContact O-OG 3Å; K6-S9 PolarHBondContact O-N 3.43Å; G7-S9 PolarHBondContact O-N 3.28Å; S9-A11 VanDerWaalsContact C-N 3.32Å; S9-A11 PolarHBondContact O-N 3.45Å; S9-K12 WeakPolarHBondContact O-CB 3.5Å; S9-K12 PolarHBondContact O-N 3.16Å; S9-E13 WeakPolarHBondContact O-CG 3.31Å; S9-E13 PolarHBondContact O-N 3.41Å
10	K	90.8	Very high	90.3	Very high	158 Å²	158	103.9 Å²	103.9	69%	0.687	58%	0.578	S	S	*	*	H	α-helix	trans	-61.9	-38.8	175.7	-172.2	175.8	-177.5	179.1	0	112.3	K6 G7 G14	K6-K10 WeakPolarHBondContact O-CB 3.28Å; K6-K10 PolarHBondContact O-N 2.96Å; G7-K10 PolarHBondContact O-N 3.18Å; K10-G14 PolarHBondContact O-N 2.96Å
11	A	88.7	Confident	90.3	Very high	58 Å²	58	106.9 Å²	106.9	48%	0.479	59%	0.585	S	S	.	*	H	α-helix	trans	-65.1	-44.6	175	0	0	0	0	0	111.4	G7 L8 S9 G14 V15	G7-A11 WeakPolarHBondContact O-CB 3.4Å; G7-A11 PolarHBondContact O-N 2.89Å; L8-A11 PolarHBondContact O-N 3.32Å; S9-A11 VanDerWaalsContact C-N 3.32Å; S9-A11 PolarHBondContact O-N 3.45Å; A11-G14 PolarHBondContact O-N 2.9Å; A11-V15 WeakPolarHBondContact O-CG2 3.4Å; A11-V15 PolarHBondContact O-N 3.27Å
12	K	89.7	Confident	90.3	Very high	150 Å²	150	102.1 Å²	102.1	65%	0.652	57%	0.567	S	S	*	*	H	α-helix	trans	-59.2	-47.2	175.3	-177.6	-176.9	176.5	-174.9	0	111.6	L8 S9 G14 V15 V16	L8-K12 WeakPolarHBondContact O-CB 3.4Å; L8-K12 PolarHBondContact O-N 3.31Å; S9-K12 WeakPolarHBondContact O-CB 3.5Å; S9-K12 PolarHBondContact O-N 3.16Å; K12-G14 VanDerWaalsContact C-N 3.32Å; K12-G14 PolarHBondContact O-N 3.28Å; K12-V15 PolarHBondContact O-N 3.16Å; K12-V16 WeakPolarHBondContact O-CG2 3.49Å; K12-V16 PolarHBondContact O-N 3.3Å
13	E	90.5	Very high	90.2	Very high	134 Å²	134	103.6 Å²	103.6	63%	0.626	57%	0.567	S	S	*	*	H	α-helix	trans	-58.3	-43.1	175.4	-74.4	173.1	-178.6	0	0	111.8	S9 V15 V16 A17	S9-E13 WeakPolarHBondContact O-CG 3.31Å; S9-E13 PolarHBondContact O-N 3.41Å; E13-V15 PolarHBondContact O-N 3.3Å; E13-V16 PolarHBondContact O-N 3.11Å; E13-A17 VanDerWaalsContact O-CB 3.3Å; E13-A17 WeakPolarHBondContact O-CB 3.39Å; E13-A17 PolarHBondContact O-N 3.49Å
14	G	90.1	Very high	89.9	Confident	43 Å²	43	103.8 Å²	103.8	44%	0.443	56%	0.56	S	S	.	*	H	α-helix	trans	-61.2	-42.3	176	0	0	0	0	0	113.3	K10 A11 K12 A18	K10-G14 PolarHBondContact O-N 2.96Å; A11-G14 PolarHBondContact O-N 2.9Å; K12-G14 VanDerWaalsContact C-N 3.32Å; K12-G14 PolarHBondContact O-N 3.28Å; G14-A18 WeakPolarHBondContact O-CB 3.43Å; G14-A18 PolarHBondContact O-N 3.23Å
15	V	93.5	Very high	89.7	Confident	101 Å²	101	98.7 Å²	98.7	61%	0.612	55%	0.549	S	S	*	.	H	α-helix	trans	-65.3	-45.1	176.2	173.2	0	0	0	0	111.1	A11 K12 E13 A18 A19	A11-V15 WeakPolarHBondContact O-CG2 3.4Å; A11-V15 PolarHBondContact O-N 3.27Å; K12-V15 PolarHBondContact O-N 3.16Å; E13-V15 PolarHBondContact O-N 3.3Å; V15-A18 PolarHBondContact O-N 2.79Å; V15-A19 VanDerWaalsContact O-CB 3.32Å; V15-A19 WeakPolarHBondContact O-CB 3.46Å; V15-A19 PolarHBondContact O-N 3.06Å
16	V	92.1	Very high	89.6	Confident	66 Å²	66	98.2 Å²	98.2	40%	0.4	55%	0.551	S	S	.	*	H	α-helix	trans	-62.2	-47.2	177.8	173.4	0	0	0	0	110.5	K12 E13 A18 A19 E20	K12-V16 WeakPolarHBondContact O-CG2 3.49Å; K12-V16 PolarHBondContact O-N 3.3Å; E13-V16 PolarHBondContact O-N 3.11Å; V16-A18 VanDerWaalsContact C-N 3.35Å; V16-A18 PolarHBondContact O-N 3.38Å; V16-A19 PolarHBondContact O-N 2.98Å; V16-E20 HydrophobicContact CG1-CG 4.31Å; V16-E20 WeakPolarHBondContact O-CB 3.48Å; V16-E20 WeakPolarHBondContact O-CG 3.35Å; V16-E20 PolarHBondContact O-N 3.39Å
17	A	88.7	Confident	89.2	Confident	57 Å²	57	93.2 Å²	93.2	47%	0.471	54%	0.541	S	S	.	.	H	α-helix	trans	-61.9	-40.2	178.7	0	0	0	0	0	112.6	E13 K21	E13-A17 VanDerWaalsContact O-CB 3.3Å; E13-A17 WeakPolarHBondContact O-CB 3.39Å; E13-A17 PolarHBondContact O-N 3.49Å; A17-K21 VanDerWaalsContact O-CB 3.28Å; A17-K21 WeakPolarHBondContact O-CB 3.26Å; A17-K21 PolarHBondContact O-N 3.32Å
18	A	89.6	Confident	88.8	Confident	55 Å²	55	95.6 Å²	95.6	46%	0.455	54%	0.542	S	S	.	.	H	α-helix	trans	-66.3	-43.3	175.4	0	0	0	0	0	111.8	G14 V15 V16 T22	G14-A18 WeakPolarHBondContact O-CB 3.43Å; G14-A18 PolarHBondContact O-N 3.23Å; V15-A18 PolarHBondContact O-N 2.79Å; V16-A18 VanDerWaalsContact C-N 3.35Å; V16-A18 PolarHBondContact O-N 3.38Å; A18-T22 WeakPolarHBondContact O-CB 3.42Å; A18-T22 PolarHBondContact O-N 2.95Å; A18-T22 PolarHBondContact O-OG1 3.5Å
19	A	90.6	Very high	88.4	Confident	59 Å²	59	93.6 Å²	93.6	49%	0.488	54%	0.54	S	S	.	.	H	α-helix	trans	-63.5	-42.7	176.4	0	0	0	0	0	111.8	V15 V16 T22 K23	V15-A19 VanDerWaalsContact O-CB 3.32Å; V15-A19 WeakPolarHBondContact O-CB 3.46Å; V15-A19 PolarHBondContact O-N 3.06Å; V16-A19 PolarHBondContact O-N 2.98Å; A19-T22 PolarHBondContact O-N 3.1Å; A19-K23 WeakPolarHBondContact O-CB 3.47Å; A19-K23 PolarHBondContact O-N 2.91Å
20	E	88.4	Confident	87.9	Confident	126 Å²	126	93.7 Å²	93.7	59%	0.589	54%	0.544	S	S	*	.	H	α-helix	trans	-65.3	-46.8	176	-76.3	-175.1	173.4	0	0	112.3	V16 T22 K23 Q24	V16-E20 HydrophobicContact CG1-CG 4.31Å; V16-E20 WeakPolarHBondContact O-CB 3.48Å; V16-E20 WeakPolarHBondContact O-CG 3.35Å; V16-E20 PolarHBondContact O-N 3.39Å; E20-T22 PolarHBondContact O-N 2.87Å; E20-K23 PolarHBondContact O-N 2.83Å; E20-K23 VanDerWaalsContact O-N 3.17Å; E20-Q24 WeakPolarHBondContact O-CB 3.31Å; E20-Q24 PolarHBondContact O-N 3.38Å
21	K	90.6	Very high	87.2	Confident	167 Å²	167	88 Å²	88	73%	0.726	53%	0.53	S	S	*	.	H	α-helix	trans	-57.7	-38.5	175.2	-175.3	174.6	-178.3	176.2	0	111.6	A17 G25	A17-K21 VanDerWaalsContact O-CB 3.28Å; A17-K21 WeakPolarHBondContact O-CB 3.26Å; A17-K21 PolarHBondContact O-N 3.32Å; K21-G25 PolarHBondContact O-N 3.44Å
22	T	88.5	Confident	86.6	Confident	89 Å²	89	94.3 Å²	94.3	55%	0.546	54%	0.542	S	S	.	.	H	α-helix	trans	-69.5	-46.5	176.8	-56.1	0	0	0	0	111.1	A18 A19 E20 Q24 G25 V26	A18-T22 WeakPolarHBondContact O-CB 3.42Å; A18-T22 PolarHBondContact O-N 2.95Å; A18-T22 PolarHBondContact O-OG1 3.5Å; A19-T22 PolarHBondContact O-N 3.1Å; E20-T22 PolarHBondContact O-N 2.87Å; T22-Q24 VanDerWaalsContact C-N 3.32Å; T22-Q24 PolarHBondContact O-N 2.87Å; T22-G25 PolarHBondContact O-N 3.02Å; T22-V26 HydrophobicContact CG2-CG2 4.35Å; T22-V26 WeakPolarHBondContact O-CB 3.27Å; T22-V26 VanDerWaalsContact O-CG2 3.25Å; T22-V26 WeakPolarHBondContact O-CG2 3.38Å; T22-V26 PolarHBondContact O-N 3.24Å
23	K	87.7	Confident	85.8	Confident	164 Å²	164	91 Å²	91	71%	0.713	53%	0.534	S	S	*	.	H	α-helix	trans	-58.7	-43.6	176.4	-175	-179	178.5	-176	0	111.5	A19 E20 A27	A19-K23 WeakPolarHBondContact O-CB 3.47Å; A19-K23 PolarHBondContact O-N 2.91Å; E20-K23 PolarHBondContact O-N 2.83Å; E20-K23 VanDerWaalsContact O-N 3.17Å; K23-A27 WeakPolarHBondContact O-CB 3.23Å; K23-A27 PolarHBondContact O-N 2.87Å
24	Q	85.6	Confident	84.4	Confident	134 Å²	134	92.1 Å²	92.1	63%	0.626	54%	0.537	S	S	*	.	H	α-helix	trans	-66.1	-46.6	177.1	-174	179	-2.6	0	0	111.5	E20 T22 V26 A27 E28	E20-Q24 WeakPolarHBondContact O-CB 3.31Å; E20-Q24 PolarHBondContact O-N 3.38Å; T22-Q24 VanDerWaalsContact C-N 3.32Å; T22-Q24 PolarHBondContact O-N 2.87Å; Q24-V26 PolarHBondContact O-N 3.45Å; Q24-A27 PolarHBondContact O-N 3.13Å; Q24-E28 VanDerWaalsContact O-CB 3.29Å; Q24-E28 WeakPolarHBondContact O-CB 3.27Å; Q24-E28 PolarHBondContact O-N 2.8Å
25	G	85.5	Confident	82.9	Confident	40 Å²	40	99 Å²	99	41%	0.412	56%	0.557	S	S	.	*	H	α-helix	trans	-61.7	-42	178.2	0	0	0	0	0	112.8	K21 T22 A29	K21-G25 PolarHBondContact O-N 3.44Å; T22-G25 PolarHBondContact O-N 3.02Å; G25-A29 WeakPolarHBondContact O-CB 3.45Å; G25-A29 PolarHBondContact O-N 2.86Å
26	V	88.1	Confident	81.3	Confident	97 Å²	97	96.5 Å²	96.5	59%	0.588	55%	0.552	S	S	*	*	H	α-helix	trans	-66	-45.1	175.5	173.3	0	0	0	0	110.9	T22 Q24 E28 A29 A30	T22-V26 HydrophobicContact CG2-CG2 4.35Å; T22-V26 WeakPolarHBondContact O-CB 3.27Å; T22-V26 VanDerWaalsContact O-CG2 3.25Å; T22-V26 WeakPolarHBondContact O-CG2 3.38Å; T22-V26 PolarHBondContact O-N 3.24Å; Q24-V26 PolarHBondContact O-N 3.45Å; V26-E28 PolarHBondContact O-N 2.88Å; V26-A29 PolarHBondContact O-N 3.44Å; V26-A30 WeakPolarHBondContact O-CB 3.36Å; V26-A30 PolarHBondContact O-N 2.94Å
27	A	83.4	Confident	79.6	Confident	61 Å²	61	97.7 Å²	97.7	50%	0.504	56%	0.56	S	S	.	*	H	α-helix	trans	-64.2	-39.6	178.1	0	0	0	0	0	112.3	K23 Q24 A30 G31	K23-A27 WeakPolarHBondContact O-CB 3.23Å; K23-A27 PolarHBondContact O-N 2.87Å; Q24-A27 PolarHBondContact O-N 3.13Å; A27-A30 PolarHBondContact O-N 3.35Å; A27-G31 PolarHBondContact O-N 2.89Å
28	E	81.7	Confident	78.2	Confident	89 Å²	89	101.6 Å²	101.6	42%	0.416	57%	0.572	S	S	.	*	H	α-helix	trans	-68.3	-42.3	177.4	-170.3	178.3	173	0	0	111.5	Q24 V26 G31 R32	Q24-E28 VanDerWaalsContact O-CB 3.29Å; Q24-E28 WeakPolarHBondContact O-CB 3.27Å; Q24-E28 PolarHBondContact O-N 2.8Å; V26-E28 PolarHBondContact O-N 2.88Å; E28-G31 PolarHBondContact O-N 3.49Å; E28-R32 HydrophobicContact CG-CG 4.44Å; E28-R32 WeakPolarHBondContact O-CB 3.33Å; E28-R32 VanDerWaalsContact O-CG 3.28Å; E28-R32 WeakPolarHBondContact O-CG 3.3Å; E28-R32 PolarHBondContact O-N 2.91Å; E28-R32 IonicContact OE1-CZ 3.22Å; E28-R32 VanDerWaalsContact OE1-CZ 3.22Å; E28-R32 IonicContact OE1-NE 3.01Å; E28-R32 PolarHBondContact OE1-NE 3.21Å; E28-R32 IonicContact OE1-NH2 2.66Å; E28-R32 PolarHBondContact OE1-NH2 3.28Å
29	A	81.7	Confident	76.8	Confident	57 Å²	57	107.6 Å²	107.6	47%	0.471	58%	0.584	S	S	.	*	H	α-helix	trans	-62.9	-41.2	174.5	0	0	0	0	0	112.4	G25 V26 G31 R32 T33	G25-A29 WeakPolarHBondContact O-CB 3.45Å; G25-A29 PolarHBondContact O-N 2.86Å; V26-A29 PolarHBondContact O-N 3.44Å; A29-G31 VanDerWaalsContact C-N 3.34Å; A29-R32 PolarHBondContact O-N 3.02Å; A29-T33 PolarHBondContact O-N 3.4Å; A29-T33 PolarHBondContact O-OG1 3.32Å
30	A	80.2	Confident	75.4	Confident	63 Å²	63	108.7 Å²	108.7	52%	0.521	58%	0.584	S	S	.	*	H	α-helix	trans	-66.3	-35.2	174.1	0	0	0	0	0	112.2	V26 A27 T33	V26-A30 WeakPolarHBondContact O-CB 3.36Å; V26-A30 PolarHBondContact O-N 2.94Å; A27-A30 PolarHBondContact O-N 3.35Å; A30-T33 WeakPolarHBondContact CA-OG1 3.41Å; A30-T33 PolarHBondContact O-OG1 3.2Å
31	G	77.1	Confident	74.1	Confident	38 Å²	38	104.3 Å²	104.3	39%	0.392	57%	0.573	S	S	.	*	H	α-helix	trans	-76.6	-28	177.5	0	0	0	0	0	114.1	A27 E28 A29 K34	A27-G31 PolarHBondContact O-N 2.89Å; E28-G31 PolarHBondContact O-N 3.49Å; A29-G31 VanDerWaalsContact C-N 3.34Å; G31-K34 WeakPolarHBondContact O-CE 3.37Å; G31-K34 WeakPolarHBondContact O-CG 3.34Å
32	R	75.9	Confident	72.8	Confident	191 Å²	191	101 Å²	101	72%	0.721	57%	0.571	S	S	*	*	H	α-helix	trans	-76.6	-23.8	175.6	-74.6	176.7	179.9	-125.9	5.4	112.3	E28 A29 K34	E28-R32 HydrophobicContact CG-CG 4.44Å; E28-R32 WeakPolarHBondContact O-CB 3.33Å; E28-R32 VanDerWaalsContact O-CG 3.28Å; E28-R32 WeakPolarHBondContact O-CG 3.3Å; E28-R32 PolarHBondContact O-N 2.91Å; E28-R32 IonicContact OE1-CZ 3.22Å; E28-R32 VanDerWaalsContact OE1-CZ 3.22Å; E28-R32 IonicContact OE1-NE 3.01Å; E28-R32 PolarHBondContact OE1-NE 3.21Å; E28-R32 IonicContact OE1-NH2 2.66Å; E28-R32 PolarHBondContact OE1-NH2 3.28Å; A29-R32 PolarHBondContact O-N 3.02Å; R32-K34 PolarHBondContact O-N 2.84Å
33	T	72.1	Confident	71.5	Confident	80 Å²	80	104.9 Å²	104.9	49%	0.491	58%	0.58	S	S	.	*			trans	-81.7	40.3	176.8	41.1	0	0	0	0	113.7	A29 A30 E35 G36	A29-T33 PolarHBondContact O-N 3.4Å; A29-T33 PolarHBondContact O-OG1 3.32Å; A30-T33 WeakPolarHBondContact CA-OG1 3.41Å; A30-T33 PolarHBondContact O-OG1 3.2Å; T33-E35 PolarHBondContact O-N 3.47Å; T33-E35 VanDerWaalsContact O-N 3.08Å; T33-G36 PolarHBondContact O-N 3.03Å
34	K	62	Low	70.6	Confident	157 Å²	157	100.2 Å²	100.2	68%	0.683	57%	0.565	S	S	*	*	H	α-helix	trans	-58	-25.1	-178.8	-61.2	-168	177.2	176.9	0	114	G31 R32	G31-K34 WeakPolarHBondContact O-CE 3.37Å; G31-K34 WeakPolarHBondContact O-CG 3.34Å; R32-K34 PolarHBondContact O-N 2.84Å
35	E	58.4	Low	69.7	Low	187 Å²	187	101.1 Å²	101.1	87%	0.874	57%	0.567	S	S	*	*	H	α-helix	trans	-77.3	-31.8	-178.9	-113.5	171.8	171.2	0	0	113.8	T33	T33-E35 PolarHBondContact O-N 3.47Å; T33-E35 VanDerWaalsContact O-N 3.08Å
36	G	59.1	Low	68.8	Low	50 Å²	50	107.3 Å²	107.3	52%	0.515	59%	0.585	S	S	.	*	H	α-helix	trans	-78.5	-26.3	-178.4	0	0	0	0	0	114.1	T33	T33-G36 PolarHBondContact O-N 3.03Å
37	V	56	Low	68.1	Low	91 Å²	91	105.1 Å²	105.1	55%	0.552	58%	0.583	S	S	*	*	H	α-helix	trans	-95.5	-31.1	-167.1	-172.1	0	0	0	0	113.1	Y39 G41	V37-Y39 VanDerWaalsContact C-N 3.31Å; V37-Y39 PolarHBondContact O-N 2.89Å; V37-G41 WeakPolarHBondContact O-CA 3.47Å; V37-G41 PolarHBondContact O-N 3.35Å
38	L	60	Low	67.8	Low	138 Å²	138	105.8 Å²	105.8	72%	0.723	58%	0.58	S	S	*	*	H	α-helix	trans	-65	-33.5	179.5	-85.9	160.7	0	0	0	112.9
39	Y	59.4	Low	67.5	Low	182 Å²	182	106 Å²	106	71%	0.714	59%	0.587	S	S	*	*	H	α-helix	trans	-80.4	-39.9	-176.2	-173.5	-106.2	0	0	0	113.6	V37	V37-Y39 VanDerWaalsContact C-N 3.31Å; V37-Y39 PolarHBondContact O-N 2.89Å
40	V	61.8	Low	67.2	Low	82 Å²	82	110 Å²	110	50%	0.497	60%	0.596	S	S	.	*	H	α-helix	trans	-88.1	-32.2	-179.3	-179.5	0	0	0	0	111.7	S42 K43 T44	V40-S42 PolarHBondContact O-N 3.49Å; V40-K43 PolarHBondContact O-N 2.84Å; V40-T44 WeakPolarHBondContact O-CB 3.39Å; V40-T44 PolarHBondContact O-N 2.84Å; V40-T44 PolarHBondContact O-OG1 2.92Å; V40-T44 VanDerWaalsContact O-OG1 3.11Å
41	G	61.6	Low	67.1	Low	34 Å²	34	108.4 Å²	108.4	35%	0.351	59%	0.586	S	S	.	*	H	α-helix	trans	-59.8	-39.9	-174.8	0	0	0	0	0	113.7	V37 K45	V37-G41 WeakPolarHBondContact O-CA 3.47Å; V37-G41 PolarHBondContact O-N 3.35Å; G41-K45 VanDerWaalsContact O-CB 3.3Å; G41-K45 WeakPolarHBondContact O-CB 3.27Å; G41-K45 PolarHBondContact O-N 3.37Å
42	S	62.8	Low	67.4	Low	97 Å²	97	110.6 Å²	110.6	68%	0.678	59%	0.592	S	S	*	*	H	α-helix	trans	-70.1	-36.6	-179.2	-56.7	0	0	0	0	113.1	V40	V40-S42 PolarHBondContact O-N 3.49Å
43	K	62.5	Low	67.6	Low	170 Å²	170	105.3 Å²	105.3	74%	0.739	58%	0.581	S	S	*	*	H	α-helix	trans	-75.9	-31.2	177.1	-73.7	-167	176.8	-175.6	0	112.9	V40	V40-K43 PolarHBondContact O-N 2.84Å
44	T	68.8	Low	68	Low	66 Å²	66	104.1 Å²	104.1	41%	0.405	57%	0.574	S	S	.	*	H	α-helix	trans	-94.4	-14	-173.1	-56.9	0	0	0	0	112.5	V40 E46 G47 V48	V40-T44 WeakPolarHBondContact O-CB 3.39Å; V40-T44 PolarHBondContact O-N 2.84Å; V40-T44 PolarHBondContact O-OG1 2.92Å; V40-T44 VanDerWaalsContact O-OG1 3.11Å; T44-E46 PolarHBondContact O-N 3.28Å; T44-G47 PolarHBondContact O-N 2.86Å; T44-V48 HydrophobicContact CG2-CG2 3.46Å; T44-V48 VanDerWaalsContact CG2-CG2 3.46Å; T44-V48 WeakPolarHBondContact O-CB 3.46Å; T44-V48 VanDerWaalsContact O-CG2 3.27Å; T44-V48 WeakPolarHBondContact O-CG2 3.4Å; T44-V48 PolarHBondContact O-N 3.35Å
45	K	66.5	Low	69.2	Low	154 Å²	154	100.7 Å²	100.7	67%	0.67	57%	0.565	S	S	*	*	H	α-helix	trans	-55.9	-45.7	-179	-169.3	176.4	-179.1	-175.8	0	113	G41 V49	G41-K45 VanDerWaalsContact O-CB 3.3Å; G41-K45 WeakPolarHBondContact O-CB 3.27Å; G41-K45 PolarHBondContact O-N 3.37Å; K45-V49 VanDerWaalsContact O-CG2 3.29Å; K45-V49 WeakPolarHBondContact O-CG2 3.14Å; K45-V49 PolarHBondContact O-N 2.94Å; K45-V49 VanDerWaalsContact O-N 3.07Å
46	E	66.4	Low	70.2	Confident	169 Å²	169	94.4 Å²	94.4	79%	0.79	55%	0.546	S	S	*	.	H	α-helix	trans	-69.3	-43.1	-179.9	-67.5	-179.7	175.3	0	0	111.8	T44 V48 V49 H50	T44-E46 PolarHBondContact O-N 3.28Å; E46-V48 VanDerWaalsContact C-N 3.35Å; E46-V48 PolarHBondContact O-N 3.37Å; E46-V49 PolarHBondContact O-N 2.92Å; E46-H50 PolarHBondContact O-N 3.47Å
47	G	72.1	Confident	71.4	Confident	52 Å²	52	98.4 Å²	98.4	54%	0.536	55%	0.551	S	S	.	*	H	α-helix	trans	-65	-36.1	175.9	0	0	0	0	0	113.3	T44 G51	T44-G47 PolarHBondContact O-N 2.86Å; G47-G51 PolarHBondContact O-N 3.43Å
48	V	78.3	Confident	72.9	Confident	74 Å²	74	100.1 Å²	100.1	45%	0.448	55%	0.551	S	S	.	*	H	α-helix	trans	-69.9	-38.8	176.3	168.7	0	0	0	0	111.2	T44 E46 H50 G51 V52	T44-V48 HydrophobicContact CG2-CG2 3.46Å; T44-V48 VanDerWaalsContact CG2-CG2 3.46Å; T44-V48 WeakPolarHBondContact O-CB 3.46Å; T44-V48 VanDerWaalsContact O-CG2 3.27Å; T44-V48 WeakPolarHBondContact O-CG2 3.4Å; T44-V48 PolarHBondContact O-N 3.35Å; E46-V48 VanDerWaalsContact C-N 3.35Å; E46-V48 PolarHBondContact O-N 3.37Å; V48-H50 VanDerWaalsContact C-N 3.32Å; V48-H50 PolarHBondContact O-N 3.24Å; V48-G51 CarbonylContact O-C 3.56Å; V48-G51 PolarHBondContact O-N 3.24Å; V48-V52 HydrophobicContact CG1-CG2 3.71Å; V48-V52 VanDerWaalsContact O-CB 3.25Å; V48-V52 WeakPolarHBondContact O-CB 3.4Å; V48-V52 WeakPolarHBondContact O-CG2 3.43Å; V48-V52 PolarHBondContact O-N 2.99Å
49	V	75.1	Confident	74	Confident	93 Å²	93	96.3 Å²	96.3	56%	0.564	53%	0.534	S	S	*	.	H	α-helix	trans	-61.8	-42.7	177.7	170.4	0	0	0	0	111.2	K45 E46 V52 T53	K45-V49 VanDerWaalsContact O-CG2 3.29Å; K45-V49 WeakPolarHBondContact O-CG2 3.14Å; K45-V49 PolarHBondContact O-N 2.94Å; K45-V49 VanDerWaalsContact O-N 3.07Å; E46-V49 PolarHBondContact O-N 2.92Å; V49-V52 PolarHBondContact O-N 3.48Å; V49-T53 PolarHBondContact O-N 2.91Å; V49-T53 PolarHBondContact O-OG1 3.37Å; V49-T53 VanDerWaalsContact O-OG1 3.05Å
50	H	74.9	Confident	75.1	Confident	141 Å²	141	95.1 Å²	95.1	65%	0.653	53%	0.532	S	S	*	.	H	α-helix	trans	-65.5	-46.1	174.2	-168.9	68.4	0	0	0	111.4	E46 V48 V52 T53 T54	E46-H50 PolarHBondContact O-N 3.47Å; V48-H50 VanDerWaalsContact C-N 3.32Å; V48-H50 PolarHBondContact O-N 3.24Å; H50-V52 VanDerWaalsContact C-N 3.33Å; H50-V52 PolarHBondContact O-N 3.28Å; H50-T53 PolarHBondContact O-N 3.49Å; H50-T54 PolarHBondContact O-N 3.43Å; H50-T54 PolarHBondContact O-OG1 3.01Å
51	G	79.3	Confident	76	Confident	31 Å²	31	97.7 Å²	97.7	32%	0.32	54%	0.539	S	S	.	.	H	α-helix	trans	-60.1	-39.2	176.5	0	0	0	0	0	113.5	G47 V48 T53 T54 V55	G47-G51 PolarHBondContact O-N 3.43Å; V48-G51 CarbonylContact O-C 3.56Å; V48-G51 PolarHBondContact O-N 3.24Å; G51-T53 VanDerWaalsContact C-N 3.3Å; G51-T53 PolarHBondContact O-N 2.88Å; G51-T54 PolarHBondContact O-N 3.36Å; G51-V55 WeakPolarHBondContact O-CB 3.32Å; G51-V55 WeakPolarHBondContact O-CG2 3.4Å; G51-V55 PolarHBondContact O-N 3.37Å
52	V	82.7	Confident	76.8	Confident	84 Å²	84	101.9 Å²	101.9	51%	0.509	55%	0.549	S	S	.	.	H	α-helix	trans	-66	-34.4	178.4	166.5	0	0	0	0	110.8	V48 V49 H50 A56	V48-V52 HydrophobicContact CG1-CG2 3.71Å; V48-V52 VanDerWaalsContact O-CB 3.25Å; V48-V52 WeakPolarHBondContact O-CB 3.4Å; V48-V52 WeakPolarHBondContact O-CG2 3.43Å; V48-V52 PolarHBondContact O-N 2.99Å; V49-V52 PolarHBondContact O-N 3.48Å; H50-V52 VanDerWaalsContact C-N 3.33Å; H50-V52 PolarHBondContact O-N 3.28Å; V52-A56 WeakPolarHBondContact O-CB 3.28Å; V52-A56 PolarHBondContact O-N 2.94Å
53	T	80	Confident	77.6	Confident	79 Å²	79	101.6 Å²	101.6	49%	0.485	54%	0.543	S	S	.	.	H	α-helix	trans	-64.8	-50.1	175.1	-53.2	0	0	0	0	110.4	V49 H50 G51 V55 A56 E57	V49-T53 PolarHBondContact O-N 2.91Å; V49-T53 PolarHBondContact O-OG1 3.37Å; V49-T53 VanDerWaalsContact O-OG1 3.05Å; H50-T53 PolarHBondContact O-N 3.49Å; G51-T53 VanDerWaalsContact C-N 3.3Å; G51-T53 PolarHBondContact O-N 2.88Å; T53-V55 VanDerWaalsContact C-N 3.35Å; T53-V55 PolarHBondContact O-N 2.94Å; T53-A56 WeakPolarHBondContact O-CB 3.39Å; T53-A56 PolarHBondContact O-N 2.81Å; T53-E57 PolarHBondContact O-N 2.85Å; T53-E57 VanDerWaalsContact O-N 3.09Å
54	T	80.9	Confident	78.6	Confident	56 Å²	56	97.1 Å²	97.1	34%	0.344	53%	0.53	S	S	.	.	H	α-helix	trans	-62.5	-40.5	176.5	-53.4	0	0	0	0	112.4	H50 G51 K58	H50-T54 PolarHBondContact O-N 3.43Å; H50-T54 PolarHBondContact O-OG1 3.01Å; G51-T54 PolarHBondContact O-N 3.36Å; T54-K58 WeakPolarHBondContact O-CG 3.38Å; T54-K58 PolarHBondContact O-N 2.92Å; T54-K58 VanDerWaalsContact O-N 3.13Å
55	V	86.6	Confident	79.3	Confident	84 Å²	84	98.8 Å²	98.8	51%	0.509	54%	0.537	S	S	.	.	H	α-helix	trans	-66.4	-41.2	175.6	170.6	0	0	0	0	110	G51 T53 E57 K58 T59	G51-V55 WeakPolarHBondContact O-CB 3.32Å; G51-V55 WeakPolarHBondContact O-CG2 3.4Å; G51-V55 PolarHBondContact O-N 3.37Å; T53-V55 VanDerWaalsContact C-N 3.35Å; T53-V55 PolarHBondContact O-N 2.94Å; V55-E57 VanDerWaalsContact C-N 3.31Å; V55-E57 PolarHBondContact O-N 3.22Å; V55-K58 CarbonylContact O-C 3.58Å; V55-K58 PolarHBondContact O-N 3.4Å; V55-T59 WeakPolarHBondContact O-CA 3.33Å; V55-T59 WeakPolarHBondContact O-CB 3.27Å; V55-T59 PolarHBondContact O-N 2.82Å; V55-T59 PolarHBondContact O-OG1 3.27Å
56	A	80.6	Confident	80.3	Confident	56 Å²	56	95.8 Å²	95.8	46%	0.463	53%	0.531	S	S	.	.	H	α-helix	trans	-60.3	-41	178.5	0	0	0	0	0	111.8	V52 T53 T59 K60	V52-A56 WeakPolarHBondContact O-CB 3.28Å; V52-A56 PolarHBondContact O-N 2.94Å; T53-A56 WeakPolarHBondContact O-CB 3.39Å; T53-A56 PolarHBondContact O-N 2.81Å; A56-T59 PolarHBondContact O-N 2.81Å; A56-K60 PolarHBondContact O-N 3.35Å
57	E	83.9	Confident	81.1	Confident	134 Å²	134	89.3 Å²	89.3	63%	0.626	51%	0.51	S	S	*	.	H	α-helix	trans	-62.2	-50.7	173.5	-69.9	-178.2	163.1	0	0	111.7	T53 V55 T59 K60 E61	T53-E57 PolarHBondContact O-N 2.85Å; T53-E57 VanDerWaalsContact O-N 3.09Å; V55-E57 VanDerWaalsContact C-N 3.31Å; V55-E57 PolarHBondContact O-N 3.22Å; E57-T59 VanDerWaalsContact C-N 3.31Å; E57-T59 PolarHBondContact O-N 3.4Å; E57-K60 WeakPolarHBondContact O-CB 3.25Å; E57-K60 PolarHBondContact O-N 2.92Å; E57-E61 PolarHBondContact O-N 2.99Å
58	K	86.7	Confident	81.7	Confident	127 Å²	127	92.7 Å²	92.7	55%	0.552	51%	0.511	S	S	*	.	H	α-helix	trans	-62	-37.4	176.2	-70.1	-178.6	178.6	-174	0	112.8	T54 V55 K60 E61 Q62	T54-K58 WeakPolarHBondContact O-CG 3.38Å; T54-K58 PolarHBondContact O-N 2.92Å; T54-K58 VanDerWaalsContact O-N 3.13Å; V55-K58 CarbonylContact O-C 3.58Å; V55-K58 PolarHBondContact O-N 3.4Å; K58-K60 VanDerWaalsContact C-N 3.33Å; K58-E61 PolarHBondContact O-N 2.75Å; K58-Q62 WeakPolarHBondContact O-CG 3.3Å; K58-Q62 PolarHBondContact O-N 2.89Å
59	T	82.9	Confident	82.1	Confident	58 Å²	58	92.1 Å²	92.1	36%	0.356	51%	0.514	S	S	.	.	H	α-helix	trans	-67.8	-34.9	178	-66	0	0	0	0	110.3	V55 A56 E57 E61 Q62 V63	V55-T59 WeakPolarHBondContact O-CA 3.33Å; V55-T59 WeakPolarHBondContact O-CB 3.27Å; V55-T59 PolarHBondContact O-N 2.82Å; V55-T59 PolarHBondContact O-OG1 3.27Å; A56-T59 PolarHBondContact O-N 2.81Å; E57-T59 VanDerWaalsContact C-N 3.31Å; E57-T59 PolarHBondContact O-N 3.4Å; T59-E61 VanDerWaalsContact C-N 3.33Å; T59-E61 PolarHBondContact O-N 2.82Å; T59-Q62 PolarHBondContact O-N 3.36Å; T59-V63 HydrophobicContact CG2-CG2 3.78Å; T59-V63 VanDerWaalsContact O-CB 3.26Å; T59-V63 WeakPolarHBondContact O-CB 3.23Å; T59-V63 WeakPolarHBondContact O-CG2 3.29Å; T59-V63 PolarHBondContact O-N 3.17Å
60	K	83.1	Confident	82.9	Confident	156 Å²	156	91.8 Å²	91.8	68%	0.678	51%	0.512	S	S	*	.	H	α-helix	trans	-60.3	-43.9	174.4	-174.3	-178.9	177	-176.5	0	111.7	A56 E57 K58 V63 T64	A56-K60 PolarHBondContact O-N 3.35Å; E57-K60 WeakPolarHBondContact O-CB 3.25Å; E57-K60 PolarHBondContact O-N 2.92Å; K58-K60 VanDerWaalsContact C-N 3.33Å; K60-V63 PolarHBondContact O-N 2.76Å; K60-T64 PolarHBondContact O-N 3.39Å; K60-T64 PolarHBondContact O-OG1 3.26Å
61	E	81	Confident	83.4	Confident	136 Å²	136	89.4 Å²	89.4	64%	0.636	51%	0.508	S	S	*	.	H	α-helix	trans	-63.6	-46	174.6	-65.9	179.3	172.2	0	0	111.2	E57 K58 T59 V63 T64 N65	E57-E61 PolarHBondContact O-N 2.99Å; K58-E61 PolarHBondContact O-N 2.75Å; T59-E61 VanDerWaalsContact C-N 3.33Å; T59-E61 PolarHBondContact O-N 2.82Å; E61-V63 PolarHBondContact O-N 3.47Å; E61-T64 WeakPolarHBondContact O-CB 3.25Å; E61-T64 PolarHBondContact O-N 3.4Å; E61-N65 PolarHBondContact O-N 3.42Å
62	Q	77.8	Confident	83.9	Confident	122 Å²	122	92.4 Å²	92.4	57%	0.57	52%	0.52	S	S	*	.	H	α-helix	trans	-63.6	-41.1	177	-71.4	-176.3	15.2	0	0	113	K58 T59 T64 N65 V66	K58-Q62 WeakPolarHBondContact O-CG 3.3Å; K58-Q62 PolarHBondContact O-N 2.89Å; T59-Q62 PolarHBondContact O-N 3.36Å; Q62-T64 VanDerWaalsContact C-N 3.25Å; Q62-T64 PolarHBondContact O-N 3.48Å; Q62-N65 PolarHBondContact O-N 2.83Å; Q62-V66 WeakPolarHBondContact O-CB 3.49Å; Q62-V66 WeakPolarHBondContact O-CG2 3.47Å; Q62-V66 PolarHBondContact O-N 2.91Å
63	V	80.6	Confident	84.2	Confident	91 Å²	91	90 Å²	90	55%	0.552	51%	0.512	S	S	*	.	H	α-helix	trans	-64.5	-34.8	177.4	167.5	0	0	0	0	110.3	T59 K60 E61 G67	T59-V63 HydrophobicContact CG2-CG2 3.78Å; T59-V63 VanDerWaalsContact O-CB 3.26Å; T59-V63 WeakPolarHBondContact O-CB 3.23Å; T59-V63 WeakPolarHBondContact O-CG2 3.29Å; T59-V63 PolarHBondContact O-N 3.17Å; K60-V63 PolarHBondContact O-N 2.76Å; E61-V63 PolarHBondContact O-N 3.47Å; V63-G67 WeakPolarHBondContact O-CA 3.2Å; V63-G67 PolarHBondContact O-N 2.86Å
64	T	82.6	Confident	84.7	Confident	76 Å²	76	90.8 Å²	90.8	47%	0.466	52%	0.516	S	S	.	.	H	α-helix	trans	-64.9	-50.3	173.4	-53.3	0	0	0	0	110.3	K60 E61 Q62 V66 G67 E68	K60-T64 PolarHBondContact O-N 3.39Å; K60-T64 PolarHBondContact O-OG1 3.26Å; E61-T64 WeakPolarHBondContact O-CB 3.25Å; E61-T64 PolarHBondContact O-N 3.4Å; Q62-T64 VanDerWaalsContact C-N 3.25Å; Q62-T64 PolarHBondContact O-N 3.48Å; T64-V66 PolarHBondContact O-N 2.82Å; T64-G67 WeakPolarHBondContact O-CA 3.26Å; T64-G67 PolarHBondContact O-N 2.87Å; T64-G67 VanDerWaalsContact O-N 3.1Å; T64-E68 PolarHBondContact O-N 3.49Å
65	N	83.6	Confident	85	Confident	102 Å²	102	91.2 Å²	91.2	55%	0.545	52%	0.519	S	S	.	.	H	α-helix	trans	-61.3	-41.3	177.4	-65.9	-13.6	0	0	0	112.7	E61 Q62 G67 E68 A69	E61-N65 PolarHBondContact O-N 3.42Å; Q62-N65 PolarHBondContact O-N 2.83Å; N65-G67 VanDerWaalsContact C-N 3.34Å; N65-E68 PolarHBondContact O-N 3.3Å; N65-A69 WeakPolarHBondContact O-CB 3.43Å; N65-A69 PolarHBondContact O-N 2.9Å
66	V	87	Confident	85.1	Confident	91 Å²	91	89.6 Å²	89.6	55%	0.552	51%	0.514	S	S	*	.	H	α-helix	trans	-66.7	-39.3	175.3	171.3	0	0	0	0	110.1	Q62 T64 A69 V70	Q62-V66 WeakPolarHBondContact O-CB 3.49Å; Q62-V66 WeakPolarHBondContact O-CG2 3.47Å; Q62-V66 PolarHBondContact O-N 2.91Å; T64-V66 PolarHBondContact O-N 2.82Å; V66-A69 PolarHBondContact O-N 3.29Å; V66-V70 HydrophobicContact CG1-CG2 4.25Å; V66-V70 WeakPolarHBondContact O-CB 3.46Å; V66-V70 VanDerWaalsContact O-CG2 3.25Å; V66-V70 WeakPolarHBondContact O-CG2 3.31Å; V66-V70 PolarHBondContact O-N 2.95Å
67	G	84	Confident	85.7	Confident	33 Å²	33	91.3 Å²	91.3	34%	0.34	52%	0.519	S	S	.	.	H	α-helix	trans	-58.4	-48.6	174.3	0	0	0	0	0	111.5	V63 T64 N65 A69 V70 V71	V63-G67 WeakPolarHBondContact O-CA 3.2Å; V63-G67 PolarHBondContact O-N 2.86Å; T64-G67 WeakPolarHBondContact O-CA 3.26Å; T64-G67 PolarHBondContact O-N 2.87Å; T64-G67 VanDerWaalsContact O-N 3.1Å; N65-G67 VanDerWaalsContact C-N 3.34Å; G67-A69 PolarHBondContact O-N 2.92Å; G67-V70 PolarHBondContact O-N 2.82Å; G67-V71 VanDerWaalsContact O-CG2 3.3Å; G67-V71 WeakPolarHBondContact O-CG2 3.36Å; G67-V71 PolarHBondContact O-N 3.41Å
68	E	84.9	Confident	85.8	Confident	123 Å²	123	87.4 Å²	87.4	58%	0.575	51%	0.51	S	S	*	.	H	α-helix	trans	-61.5	-41.6	174.5	-69.7	-176.9	167.4	0	0	112.2	T64 N65 V70 V71 T72	T64-E68 PolarHBondContact O-N 3.49Å; N65-E68 PolarHBondContact O-N 3.3Å; E68-V70 PolarHBondContact O-N 3.45Å; E68-V71 PolarHBondContact O-N 3.01Å; E68-T72 VanDerWaalsContact O-CB 3.31Å; E68-T72 WeakPolarHBondContact O-CB 3.32Å; E68-T72 PolarHBondContact O-N 2.9Å; E68-T72 PolarHBondContact O-OG1 3.29Å
69	A	86.9	Confident	86	Confident	61 Å²	61	87 Å²	87	50%	0.504	51%	0.51	S	S	.	.	H	α-helix	trans	-64.5	-39.6	176.9	0	0	0	0	0	112.2	N65 V66 G67 G73	N65-A69 WeakPolarHBondContact O-CB 3.43Å; N65-A69 PolarHBondContact O-N 2.9Å; V66-A69 PolarHBondContact O-N 3.29Å; G67-A69 PolarHBondContact O-N 2.92Å; A69-G73 PolarHBondContact O-N 3.47Å
70	V	90.5	Very high	86.4	Confident	86 Å²	86	91.8 Å²	91.8	52%	0.521	53%	0.525	S	S	.	.	H	α-helix	trans	-65.5	-46.3	175	170.6	0	0	0	0	110.2	V66 G67 E68 T72 G73 V74	V66-V70 HydrophobicContact CG1-CG2 4.25Å; V66-V70 WeakPolarHBondContact O-CB 3.46Å; V66-V70 VanDerWaalsContact O-CG2 3.25Å; V66-V70 WeakPolarHBondContact O-CG2 3.31Å; V66-V70 PolarHBondContact O-N 2.95Å; G67-V70 PolarHBondContact O-N 2.82Å; E68-V70 PolarHBondContact O-N 3.45Å; V70-T72 VanDerWaalsContact C-N 3.35Å; V70-T72 PolarHBondContact O-N 3.45Å; V70-G73 PolarHBondContact O-N 3.1Å; V70-V74 HydrophobicContact CG1-CG2 4.3Å; V70-V74 WeakPolarHBondContact O-CB 3.48Å; V70-V74 VanDerWaalsContact O-CG2 3.27Å; V70-V74 WeakPolarHBondContact O-CG2 3.28Å; V70-V74 PolarHBondContact O-N 3.4Å
71	V	86.9	Confident	86.7	Confident	92 Å²	92	88.5 Å²	88.5	56%	0.558	52%	0.519	S	S	*	.	H	α-helix	trans	-61.5	-44.5	177.4	171.7	0	0	0	0	111	G67 E68 V74 T75	G67-V71 VanDerWaalsContact O-CG2 3.3Å; G67-V71 WeakPolarHBondContact O-CG2 3.36Å; G67-V71 PolarHBondContact O-N 3.41Å; E68-V71 PolarHBondContact O-N 3.01Å; V71-V74 PolarHBondContact O-N 2.66Å; V71-T75 WeakPolarHBondContact O-CB 3.15Å; V71-T75 PolarHBondContact O-N 2.78Å; V71-T75 PolarHBondContact O-OG1 2.85Å
72	T	89.1	Confident	87.1	Confident	93 Å²	93	87.1 Å²	87.1	57%	0.571	52%	0.519	S	S	*	.	H	α-helix	trans	-62	-44.5	176.2	-57.2	0	0	0	0	110.7	E68 V70 T75 A76	E68-T72 VanDerWaalsContact O-CB 3.31Å; E68-T72 WeakPolarHBondContact O-CB 3.32Å; E68-T72 PolarHBondContact O-N 2.9Å; E68-T72 PolarHBondContact O-OG1 3.29Å; V70-T72 VanDerWaalsContact C-N 3.35Å; V70-T72 PolarHBondContact O-N 3.45Å; T72-T75 PolarHBondContact O-N 2.92Å; T72-A76 VanDerWaalsContact O-CB 3.27Å; T72-A76 WeakPolarHBondContact O-CB 3.06Å; T72-A76 PolarHBondContact O-N 3.23Å
73	G	89	Confident	87.6	Confident	34 Å²	34	87.9 Å²	87.9	35%	0.351	52%	0.523	S	S	.	.	H	α-helix	trans	-62	-47.3	177	0	0	0	0	0	112.6	A69 V70 T75 A76 V77	A69-G73 PolarHBondContact O-N 3.47Å; V70-G73 PolarHBondContact O-N 3.1Å; G73-T75 VanDerWaalsContact C-N 3.34Å; G73-T75 PolarHBondContact O-N 3.24Å; G73-A76 PolarHBondContact O-N 2.87Å; G73-V77 WeakPolarHBondContact O-CB 3.48Å; G73-V77 VanDerWaalsContact O-CG2 3.23Å; G73-V77 WeakPolarHBondContact O-CG2 3.35Å; G73-V77 PolarHBondContact O-N 2.99Å
74	V	89.4	Confident	87.8	Confident	95 Å²	95	85 Å²	85	58%	0.576	51%	0.511	S	S	*	.	H	α-helix	trans	-61.9	-43.9	177	171	0	0	0	0	110.7	V70 V71 V77 A78	V70-V74 HydrophobicContact CG1-CG2 4.3Å; V70-V74 WeakPolarHBondContact O-CB 3.48Å; V70-V74 VanDerWaalsContact O-CG2 3.27Å; V70-V74 WeakPolarHBondContact O-CG2 3.28Å; V70-V74 PolarHBondContact O-N 3.4Å; V71-V74 PolarHBondContact O-N 2.66Å; V74-V77 PolarHBondContact O-N 2.77Å; V74-A78 WeakPolarHBondContact O-CB 3.13Å; V74-A78 PolarHBondContact O-N 3.29Å
75	T	87.9	Confident	87.9	Confident	66 Å²	66	84 Å²	84	41%	0.405	51%	0.511	S	S	.	.	H	α-helix	trans	-63	-47.3	178	-56	0	0	0	0	111.2	V71 T72 G73 V77 A78 Q79	V71-T75 WeakPolarHBondContact O-CB 3.15Å; V71-T75 PolarHBondContact O-N 2.78Å; V71-T75 PolarHBondContact O-OG1 2.85Å; T72-T75 PolarHBondContact O-N 2.92Å; G73-T75 VanDerWaalsContact C-N 3.34Å; G73-T75 PolarHBondContact O-N 3.24Å; T75-V77 PolarHBondContact O-N 3.5Å; T75-A78 PolarHBondContact O-N 2.81Å; T75-Q79 WeakPolarHBondContact O-CB 3.41Å; T75-Q79 WeakPolarHBondContact O-CG 3.33Å; T75-Q79 PolarHBondContact O-N 3.47Å
76	A	89.5	Confident	87.8	Confident	49 Å²	49	81.1 Å²	81.1	41%	0.405	51%	0.505	S	S	.	.	H	α-helix	trans	-63.7	-40.8	178.6	0	0	0	0	0	112.1	T72 G73 K80	T72-A76 VanDerWaalsContact O-CB 3.27Å; T72-A76 WeakPolarHBondContact O-CB 3.06Å; T72-A76 PolarHBondContact O-N 3.23Å; G73-A76 PolarHBondContact O-N 2.87Å; A76-K80 WeakPolarHBondContact O-CB 3.39Å; A76-K80 PolarHBondContact O-N 2.97Å
77	V	91.4	Very high	87.8	Confident	93 Å²	93	80.7 Å²	80.7	56%	0.564	51%	0.506	S	S	*	.	H	α-helix	trans	-63.6	-47.2	174.4	170.6	0	0	0	0	110.3	G73 V74 T75 Q79 K80 T81	G73-V77 WeakPolarHBondContact O-CB 3.48Å; G73-V77 VanDerWaalsContact O-CG2 3.23Å; G73-V77 WeakPolarHBondContact O-CG2 3.35Å; G73-V77 PolarHBondContact O-N 2.99Å; V74-V77 PolarHBondContact O-N 2.77Å; T75-V77 PolarHBondContact O-N 3.5Å; V77-Q79 PolarHBondContact O-N 3.42Å; V77-K80 PolarHBondContact O-N 3.47Å; V77-T81 VanDerWaalsContact O-CB 3.27Å; V77-T81 WeakPolarHBondContact O-CB 3.45Å; V77-T81 PolarHBondContact O-N 2.95Å; V77-T81 PolarHBondContact O-OG1 2.92Å
78	A	87.6	Confident	87.8	Confident	52 Å²	52	84.4 Å²	84.4	43%	0.43	52%	0.517	S	S	.	.	H	α-helix	trans	-60.2	-48.5	179.4	0	0	0	0	0	112.1	V74 T75 T81 V82	V74-A78 WeakPolarHBondContact O-CB 3.13Å; V74-A78 PolarHBondContact O-N 3.29Å; T75-A78 PolarHBondContact O-N 2.81Å; A78-T81 PolarHBondContact O-N 3.44Å; A78-V82 WeakPolarHBondContact O-CG2 3.19Å; A78-V82 PolarHBondContact O-N 3.46Å
79	Q	89.6	Confident	87.7	Confident	118 Å²	118	80 Å²	80	55%	0.551	50%	0.501	S	S	*	.	H	α-helix	trans	-59.6	-50.4	176.8	-73.6	177.3	-27.1	0	0	111.2	T75 V77 T81 V82 E83	T75-Q79 WeakPolarHBondContact O-CB 3.41Å; T75-Q79 WeakPolarHBondContact O-CG 3.33Å; T75-Q79 PolarHBondContact O-N 3.47Å; V77-Q79 PolarHBondContact O-N 3.42Å; Q79-T81 VanDerWaalsContact C-N 3.31Å; Q79-T81 PolarHBondContact O-N 2.92Å; Q79-V82 PolarHBondContact O-N 3.18Å; Q79-E83 WeakPolarHBondContact O-CG 3.21Å; Q79-E83 PolarHBondContact O-N 2.78Å
80	K	91.5	Very high	87.4	Confident	158 Å²	158	80.1 Å²	80.1	69%	0.687	50%	0.503	S	S	*	.	H	α-helix	trans	-66.1	-32	-179.1	-168.3	171.8	-175.6	175.1	0	112.9	A76 V77 G84	A76-K80 WeakPolarHBondContact O-CB 3.39Å; A76-K80 PolarHBondContact O-N 2.97Å; V77-K80 PolarHBondContact O-N 3.47Å; K80-G84 PolarHBondContact O-N 3.02Å
81	T	89.6	Confident	87	Confident	88 Å²	88	80.3 Å²	80.3	54%	0.54	51%	0.513	S	S	.	.	H	α-helix	trans	-68.9	-41.7	174.5	-66.6	0	0	0	0	111.3	V77 A78 Q79 G84 A85	V77-T81 VanDerWaalsContact O-CB 3.27Å; V77-T81 WeakPolarHBondContact O-CB 3.45Å; V77-T81 PolarHBondContact O-N 2.95Å; V77-T81 PolarHBondContact O-OG1 2.92Å; A78-T81 PolarHBondContact O-N 3.44Å; Q79-T81 VanDerWaalsContact C-N 3.31Å; Q79-T81 PolarHBondContact O-N 2.92Å; T81-G84 PolarHBondContact O-N 3.38Å; T81-A85 VanDerWaalsContact O-CB 3.26Å; T81-A85 WeakPolarHBondContact O-CB 3.38Å; T81-A85 PolarHBondContact O-N 3.39Å
82	V	89.3	Confident	86.7	Confident	106 Å²	106	79.5 Å²	79.5	64%	0.642	51%	0.508	S	S	*	.	H	α-helix	trans	-66.1	-46.2	176.1	172.9	0	0	0	0	110.8	A78 Q79 G84 A85 G86	A78-V82 WeakPolarHBondContact O-CG2 3.19Å; A78-V82 PolarHBondContact O-N 3.46Å; Q79-V82 PolarHBondContact O-N 3.18Å; V82-G84 PolarHBondContact O-N 3.42Å; V82-A85 PolarHBondContact O-N 3.27Å; V82-G86 PolarHBondContact O-N 3.49Å
83	E	87.8	Confident	86.3	Confident	139 Å²	139	77.7 Å²	77.7	65%	0.65	51%	0.508	S	S	*	.	H	α-helix	trans	-60.9	-44	175	-72	174.3	-172.8	0	0	111.8	Q79 G86 S87	Q79-E83 WeakPolarHBondContact O-CG 3.21Å; Q79-E83 PolarHBondContact O-N 2.78Å; E83-G86 PolarHBondContact O-N 3.26Å; E83-S87 WeakPolarHBondContact O-CB 3.49Å; E83-S87 PolarHBondContact O-N 3.23Å
84	G	85.5	Confident	85.8	Confident	29 Å²	29	83.9 Å²	83.9	30%	0.299	53%	0.526	S	S	.	.	H	α-helix	trans	-63	-44.3	176.7	0	0	0	0	0	112.4	K80 T81 V82 S87 I88	K80-G84 PolarHBondContact O-N 3.02Å; T81-G84 PolarHBondContact O-N 3.38Å; V82-G84 PolarHBondContact O-N 3.42Å; G84-S87 PolarHBondContact O-N 2.72Å; G84-I88 WeakPolarHBondContact O-CD1 3.25Å; G84-I88 VanDerWaalsContact O-CG1 3.23Å; G84-I88 WeakPolarHBondContact O-CG1 3.29Å; G84-I88 PolarHBondContact O-N 3.02Å
85	A	84.2	Confident	85.1	Confident	57 Å²	57	81.6 Å²	81.6	47%	0.471	52%	0.522	S	S	.	.	H	α-helix	trans	-63	-42.6	175.5	0	0	0	0	0	111.6	T81 V82 I88 A89	T81-A85 VanDerWaalsContact O-CB 3.26Å; T81-A85 WeakPolarHBondContact O-CB 3.38Å; T81-A85 PolarHBondContact O-N 3.39Å; V82-A85 PolarHBondContact O-N 3.27Å; A85-I88 PolarHBondContact O-N 3.48Å; A85-A89 WeakPolarHBondContact O-CB 3.43Å; A85-A89 PolarHBondContact O-N 3.02Å
86	G	83	Confident	84.4	Confident	41 Å²	41	88.8 Å²	88.8	42%	0.423	55%	0.547	S	S	.	.	H	α-helix	trans	-62.1	-41.4	174.2	0	0	0	0	0	112.4	V82 E83 A89 A90	V82-G86 PolarHBondContact O-N 3.49Å; E83-G86 PolarHBondContact O-N 3.26Å; G86-A89 PolarHBondContact O-N 2.89Å; G86-A90 VanDerWaalsContact O-CB 3.31Å; G86-A90 WeakPolarHBondContact O-CB 3.34Å; G86-A90 PolarHBondContact O-N 3.05Å
87	S	86.8	Confident	83.6	Confident	81 Å²	81	94.1 Å²	94.1	57%	0.566	56%	0.561	S	S	*	*	H	α-helix	trans	-64.2	-40.7	175.7	-176.9	0	0	0	0	112.1	E83 G84 A90 A91	E83-S87 WeakPolarHBondContact O-CB 3.49Å; E83-S87 PolarHBondContact O-N 3.23Å; G84-S87 PolarHBondContact O-N 2.72Å; S87-A90 PolarHBondContact O-N 3.19Å; S87-A91 VanDerWaalsContact O-CB 3.27Å; S87-A91 WeakPolarHBondContact O-CB 3.45Å; S87-A91 PolarHBondContact O-N 3.37Å
88	I	84.3	Confident	82.6	Confident	112 Å²	112	97 Å²	97	57%	0.574	57%	0.574	S	S	*	*	H	α-helix	trans	-66.4	-44.6	175.1	-65.9	161.4	0	0	0	110.7	G84 A85 A90 A91 T92	G84-I88 WeakPolarHBondContact O-CD1 3.25Å; G84-I88 VanDerWaalsContact O-CG1 3.23Å; G84-I88 WeakPolarHBondContact O-CG1 3.29Å; G84-I88 PolarHBondContact O-N 3.02Å; A85-I88 PolarHBondContact O-N 3.48Å; I88-A90 VanDerWaalsContact C-N 3.31Å; I88-A90 PolarHBondContact O-N 3.05Å; I88-A91 PolarHBondContact O-N 3.19Å; I88-T92 HydrophobicContact CG2-CG2 4.32Å; I88-T92 WeakPolarHBondContact O-CB 3.3Å; I88-T92 VanDerWaalsContact O-CG2 3.31Å; I88-T92 WeakPolarHBondContact O-CG2 3.12Å; I88-T92 PolarHBondContact O-N 3.43Å; I88-T92 PolarHBondContact O-OG1 3.22Å
89	A	81.3	Confident	81.4	Confident	29 Å²	29	102 Å²	102	24%	0.24	59%	0.588	C	S	.	*	H	α-helix	trans	-61.4	-40.6	176.7	0	0	0	0	0	111.9	A85 G86 T92 G93 F94	A85-A89 WeakPolarHBondContact O-CB 3.43Å; A85-A89 PolarHBondContact O-N 3.02Å; G86-A89 PolarHBondContact O-N 2.89Å; A89-T92 WeakPolarHBondContact CA-OG1 3.2Å; A89-T92 PolarHBondContact O-OG1 2.78Å; A89-G93 PolarHBondContact O-N 3.08Å; A89-F94 HydrophobicContact CB-CE1 3.98Å; A89-F94 HydrophobicContact CB-CZ 4.08Å; A89-F94 PolarHBondContact O-N 3.21Å
90	A	81.2	Confident	79.9	Confident	65 Å²	65	106.3 Å²	106.3	54%	0.537	61%	0.61	S	S	.	*	H	α-helix	trans	-66.7	-43.3	174.8	0	0	0	0	0	112.2	G86 S87 I88 G93	G86-A90 VanDerWaalsContact O-CB 3.31Å; G86-A90 WeakPolarHBondContact O-CB 3.34Å; G86-A90 PolarHBondContact O-N 3.05Å; S87-A90 PolarHBondContact O-N 3.19Å; I88-A90 VanDerWaalsContact C-N 3.31Å; I88-A90 PolarHBondContact O-N 3.05Å; A90-G93 PolarHBondContact O-N 3.09Å; A90-G93 VanDerWaalsContact O-N 3.13Å
91	A	81.1	Confident	78.4	Confident	90 Å²	90	101.5 Å²	101.5	74%	0.744	61%	0.606	S	S	*	*	H	α-helix	trans	-68.5	-33.4	179.2	0	0	0	0	0	113.1	S87 I88 G93	S87-A91 VanDerWaalsContact O-CB 3.27Å; S87-A91 WeakPolarHBondContact O-CB 3.45Å; S87-A91 PolarHBondContact O-N 3.37Å; I88-A91 PolarHBondContact O-N 3.19Å; A91-G93 PolarHBondContact O-N 3.13Å
92	T	81.9	Confident	77	Confident	74 Å²	74	107 Å²	107	45%	0.454	62%	0.623	S	S	.	*	T	Hydrogen-bonded Turn	trans	-77.6	-5.6	173.2	52.8	0	0	0	0	112.9	I88 A89 F94 G95	I88-T92 HydrophobicContact CG2-CG2 4.32Å; I88-T92 WeakPolarHBondContact O-CB 3.3Å; I88-T92 VanDerWaalsContact O-CG2 3.31Å; I88-T92 WeakPolarHBondContact O-CG2 3.12Å; I88-T92 PolarHBondContact O-N 3.43Å; I88-T92 PolarHBondContact O-OG1 3.22Å; A89-T92 WeakPolarHBondContact CA-OG1 3.2Å; A89-T92 PolarHBondContact O-OG1 2.78Å; T92-F94 PolarHBondContact O-N 3.19Å; T92-G95 PolarHBondContact O-N 3.49Å
93	G	80.3	Confident	75.8	Confident	55 Å²	55	105.4 Å²	105.4	57%	0.567	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	64.1	23.1	176.7	0	0	0	0	0	114	A89 A90 A91 G95	A89-G93 PolarHBondContact O-N 3.08Å; A90-G93 PolarHBondContact O-N 3.09Å; A90-G93 VanDerWaalsContact O-N 3.13Å; A91-G93 PolarHBondContact O-N 3.13Å; G93-G95 PolarHBondContact O-N 3.38Å; G93-G95 VanDerWaalsContact O-N 3.16Å
94	F	79.3	Confident	74.2	Confident	164 Å²	164	108 Å²	108	72%	0.719	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	55.1	26.8	-175.3	-61.7	-91.7	0	0	0	114.3	A89 T92 K96	A89-F94 HydrophobicContact CB-CE1 3.98Å; A89-F94 HydrophobicContact CB-CZ 4.08Å; A89-F94 PolarHBondContact O-N 3.21Å; T92-F94 PolarHBondContact O-N 3.19Å; F94-K96 PolarHBondContact O-N 3.45Å
95	G	73.9	Confident	73.1	Confident	47 Å²	47	116 Å²	116	49%	0.485	67%	0.669	S	S	.	*			trans	-66.5	128.1	176.7	0	0	0	0	0	112	T92 G93 K97	T92-G95 PolarHBondContact O-N 3.49Å; G93-G95 PolarHBondContact O-N 3.38Å; G93-G95 VanDerWaalsContact O-N 3.16Å; G95-K97 VanDerWaalsContact C-N 3.29Å
96	K	73.5	Confident	71.9	Confident	218 Å²	218	116.5 Å²	116.5	95%	0.948	68%	0.68	S	S	*	*	S	Bend	trans	-69.8	-26.8	173.3	-76.9	-174.7	179.5	-178.4	0	113	F94	F94-K96 PolarHBondContact O-N 3.45Å
97	K	72.2	Confident	70.8	Confident	160 Å²	160	118.9 Å²	118.9	70%	0.696	70%	0.695	S	S	*	*	S	Bend	trans	-143.9	134.9	177.3	-72.8	-177.1	179.4	172.1	0	109	G95 H99	G95-K97 VanDerWaalsContact C-N 3.29Å; K97-H99 PolarHBondContact O-N 3.39Å
98	D	69.7	Low	69.6	Low	155 Å²	155	121.2 Å²	121.2	83%	0.829	71%	0.712	S	S	*	*			trans	-74.4	70.8	170.9	-62.4	-58.2	0	0	0	110.2
99	H	63.9	Low	69.1	Low	155 Å²	155	124.8 Å²	124.8	72%	0.718	73%	0.726	S	S	*	*			trans	-100.6	106.4	172.2	-91.5	-64	0	0	0	110.3	K97 G101	K97-H99 PolarHBondContact O-N 3.39Å; H99-G101 PolarHBondContact O-N 2.7Å
100	M	56.9	Low	68.8	Low	209 Å²	209	133.1 Å²	133.1	100%	1.03	76%	0.76	S	S	*	*			trans	-82.4	90.1	163	-92.7	-175.6	172.5	0	0	109
101	G	59.8	Low	68.7	Low	58 Å²	58	133.5 Å²	133.5	60%	0.598	77%	0.77	S	S	*	*	S	Bend	trans	165.8	139.1	173.8	0	0	0	0	0	111.2	H99 G103	H99-G101 PolarHBondContact O-N 2.7Å; G101-G103 PolarHBondContact O-N 2.75Å
102	K	61.3	Low	68.6	Low	204 Å²	204	137.4 Å²	137.4	89%	0.887	78%	0.777	S	S	*	*			trans	-65.6	123.9	162.4	-75.7	-174.4	173.4	-176.2	0	106	E104	K102-E104 VanDerWaalsContact C-N 3.35Å; K102-E104 PolarHBondContact O-N 2.8Å
103	G	63.3	Low	68.5	Low	72 Å²	72	141.1 Å²	141.1	74%	0.742	79%	0.793	S	S	*	*			trans	-58.3	103.9	167.7	0	0	0	0	0	107.4	G101 E105	G101-G103 PolarHBondContact O-N 2.75Å; G103-E105 PolarHBondContact O-N 3.34Å
104	E	55.4	Low	68.5	Low	193 Å²	193	148 Å²	148	90%	0.902	81%	0.81	S	S	*	*			trans	-71.9	90.4	169.5	-78.1	-173.9	129.5	0	0	106.8	K102 G106	K102-E104 VanDerWaalsContact C-N 3.35Å; K102-E104 PolarHBondContact O-N 2.8Å; E104-G106 PolarHBondContact O-N 3.28Å
105	E	63	Low	68.8	Low	197 Å²	197	146.7 Å²	146.7	92%	0.921	81%	0.811	S	S	*	*			trans	-74.5	99.4	166.4	-72.5	-176.1	167.5	0	0	107.8	G103	G103-E105 PolarHBondContact O-N 3.34Å
106	G	58.2	Low	69.2	Low	68 Å²	68	152 Å²	152	70%	0.701	83%	0.825	S	S	*	*			trans	-100	137.4	175.6	0	0	0	0	0	112	E104	E104-G106 PolarHBondContact O-N 3.28Å
107	A	60.7	Low	69.8	Low	90 Å²	90	147.4 Å²	147.4	74%	0.744	82%	0.818	S	S	*	*	S	Bend	trans	53.2	109.6	171.5	0	0	0	0	0	117	Q109	A107-Q109 PolarHBondContact O-N 2.69Å; A107-Q109 VanDerWaalsContact O-N 3.16Å
108	S	61.4	Low	70.5	Confident	130 Å²	130	146.3 Å²	146.3	91%	0.909	82%	0.824	S	S	*	*			trans	-53.2	115.8	168.1	46.3	0	0	0	0	111.2
109	Q	72.7	Confident	71.1	Confident	188 Å²	188	143.2 Å²	143.2	88%	0.879	81%	0.807	S	S	*	*			trans	-106.6	121	168.6	-67.3	-174	-31	0	0	108.4	A107	A107-Q109 PolarHBondContact O-N 2.69Å; A107-Q109 VanDerWaalsContact O-N 3.16Å
110	E	75.3	Confident	72.2	Confident	204 Å²	204	141.4 Å²	141.4	95%	0.953	81%	0.809	S	S	*	*			trans	-89.4	129.3	166.7	-73.2	-174.7	156.8	0	0	108.8
111	G	78.4	Confident	73.7	Confident	73 Å²	73	137.1 Å²	137.1	75%	0.753	79%	0.791	S	S	*	*			trans	-154.7	147.7	175.8	0	0	0	0	0	109.7
112	I	80	Confident	74.9	Confident	171 Å²	171	140 Å²	140	88%	0.877	79%	0.792	S	S	*	*			trans	-91.6	126.3	171.2	-60.9	169.8	0	0	0	106.4	E114	I112-E114 PolarHBondContact O-N 3.32Å
113	L	79.3	Confident	75.9	Confident	152 Å²	152	138.9 Å²	138.9	80%	0.796	79%	0.79	S	S	*	*			trans	-72.5	123	168.7	-65.4	172.3	0	0	0	107.7	D115	L113-D115 PolarHBondContact O-N 3.07Å
114	E	81.1	Confident	77	Confident	200 Å²	200	138.4 Å²	138.4	94%	0.935	78%	0.779	S	S	*	*	S	Bend	trans	-67.6	-27.5	175.2	-69.3	-173	160.8	0	0	112	I112	I112-E114 PolarHBondContact O-N 3.32Å
115	D	85.4	Confident	78.3	Confident	136 Å²	136	140.8 Å²	140.8	73%	0.727	78%	0.782	S	S	*	*	S	Bend	trans	-83.5	126.1	177	-153.7	17.7	0	0	0	109.7	L113	L113-D115 PolarHBondContact O-N 3.07Å
116	M	82	Confident	79.3	Confident	160 Å²	160	139.2 Å²	139.2	79%	0.788	77%	0.774	S	S	*	*	P	Polyproline II helix	trans	-64.3	137.5	175.1	-67.9	-172.6	-60.8	0	0	108.8	V118	M116-V118 PolarHBondContact O-N 3.38Å
117	P	85.1	Confident	80.4	Confident	121 Å²	121	140.8 Å²	140.8	79%	0.786	76%	0.764	S	S	*	*	P	Polyproline II helix	trans	-59.4	137.6	176.8	26	-33.2	0	0	0	109.5	D119	P117-D119 PolarHBondContact O-N 2.99Å
118	V	87.2	Confident	81.5	Confident	137 Å²	137	140 Å²	140	83%	0.83	75%	0.752	S	S	*	*			trans	-67.7	104.3	167.1	-179.5	0	0	0	0	106.4	M116 P120	M116-V118 PolarHBondContact O-N 3.38Å; V118-P120 VanDerWaalsContact O-CD 3.28Å; V118-P120 WeakPolarHBondContact O-CD 3.27Å
119	D	83.3	Confident	82.6	Confident	90 Å²	90	139.1 Å²	139.1	48%	0.481	75%	0.745	S	S	.	*			trans	-78.6	111.4	169	-157.3	-34.5	0	0	0	108.1	P117 D121	P117-D119 PolarHBondContact O-N 2.99Å; D119-D121 PolarHBondContact O-N 2.92Å; D119-D121 WeakPolarHBondContact OD1-CB 3.35Å; D119-D121 PolarHBondContact OD1-N 3.33Å
120	P	86.8	Confident	83.2	Confident	116 Å²	116	139 Å²	139	75%	0.753	75%	0.745	S	S	*	*	S	Bend	trans	-69.5	-21.4	177.1	31.4	-35.7	0	0	0	111.6	V118	V118-P120 VanDerWaalsContact O-CD 3.28Å; V118-P120 WeakPolarHBondContact O-CD 3.27Å
121	D	87.4	Confident	83.3	Confident	120 Å²	120	136.1 Å²	136.1	64%	0.642	73%	0.731	S	S	*	*	S	Bend	trans	-82	125.7	177.7	-64.5	-36.7	0	0	0	108.2	D119 E123	D119-D121 PolarHBondContact O-N 2.92Å; D119-D121 WeakPolarHBondContact OD1-CB 3.35Å; D119-D121 PolarHBondContact OD1-N 3.33Å; D121-E123 PolarHBondContact O-N 3.42Å
122	N	84.8	Confident	83.2	Confident	119 Å²	119	134.8 Å²	134.8	64%	0.636	72%	0.718	S	S	*	*			trans	-71.1	1.5	-178.5	-169.4	31.7	0	0	0	113.1	A124	N122-A124 WeakPolarHBondContact O-CB 3.39Å; N122-A124 PolarHBondContact O-N 3.46Å
123	E	83.8	Confident	83.1	Confident	180 Å²	180	135 Å²	135	84%	0.841	71%	0.709	S	S	*	*	S	Bend	trans	42.1	24.4	-172.3	-62.8	-158.1	140.1	0	0	115.2	D121	D121-E123 PolarHBondContact O-N 3.42Å
124	A	85.9	Confident	83.2	Confident	61 Å²	61	135 Å²	135	50%	0.504	71%	0.705	S	S	.	*	S	Bend	trans	-132.9	142.5	-174.6	0	0	0	0	0	109.8	N122 E126	N122-A124 WeakPolarHBondContact O-CB 3.39Å; N122-A124 PolarHBondContact O-N 3.46Å; A124-E126 PolarHBondContact O-N 3.36Å
125	Y	83.4	Confident	83.5	Confident	244 Å²	244	132.9 Å²	132.9	96%	0.957	70%	0.7	S	S	*	*			trans	-67.4	104.7	164.7	-79.6	-82.3	0	0	0	108.3
126	E	82.3	Confident	83.5	Confident	163 Å²	163	134.4 Å²	134.4	76%	0.762	70%	0.697	S	S	*	*	P	Polyproline II helix	trans	-80.8	124.2	170.9	-166.4	172.6	-178	0	0	109	A124	A124-E126 PolarHBondContact O-N 3.36Å
127	M	82.4	Confident	83.3	Confident	101 Å²	101	134.6 Å²	134.6	50%	0.498	70%	0.696	S	S	.	*	P	Polyproline II helix	trans	-62	132.2	174	-72.2	-75.8	-68.5	0	0	108.8	S129 E131	M127-S129 PolarHBondContact O-N 2.92Å; M127-E131 WeakPolarHBondContact CE-OE2 3.34Å
128	P	83.7	Confident	83.2	Confident	74 Å²	74	134.4 Å²	134.4	48%	0.481	69%	0.694	S	S	.	*	P	Polyproline II helix	trans	-59.2	134.4	177.8	25.1	-32.5	0	0	0	109.4	E130 E131	P128-E130 PolarHBondContact O-N 3.24Å; P128-E131 HydrophobicContact CG-CG 4.5Å; P128-E131 PolarHBondContact O-N 3.46Å; P128-E131 VanDerWaalsContact O-N 3.16Å
129	S	85.4	Confident	82.7	Confident	111 Å²	111	136.7 Å²	136.7	78%	0.776	70%	0.696	S	S	*	*	G	3₁₀ helix	trans	-61.7	-12.6	179.6	53.1	0	0	0	0	113.7	M127 E131 G132	M127-S129 PolarHBondContact O-N 2.92Å; S129-E131 VanDerWaalsContact C-N 3.28Å; S129-E131 PolarHBondContact O-N 2.81Å; S129-G132 PolarHBondContact O-N 3.29Å
130	E	84.8	Confident	81.8	Confident	187 Å²	187	139.8 Å²	139.8	87%	0.874	73%	0.734	S	S	*	*	G	3₁₀ helix	trans	-61.8	-29.3	173.4	-66.9	-168.4	158.4	0	0	113.5	P128 G132	P128-E130 PolarHBondContact O-N 3.24Å; E130-G132 PolarHBondContact O-N 3.35Å
131	E	76	Confident	81.5	Confident	142 Å²	142	141 Å²	141	66%	0.664	73%	0.734	S	S	*	*	G	3₁₀ helix	trans	-70.6	-18.8	179.3	-69.8	-158.6	177	0	0	112.8	M127 P128 S129	M127-E131 WeakPolarHBondContact CE-OE2 3.34Å; P128-E131 HydrophobicContact CG-CG 4.5Å; P128-E131 PolarHBondContact O-N 3.46Å; P128-E131 VanDerWaalsContact O-N 3.16Å; S129-E131 VanDerWaalsContact C-N 3.28Å; S129-E131 PolarHBondContact O-N 2.81Å
132	G	76.3	Confident	81.2	Confident	46 Å²	46	142.1 Å²	142.1	47%	0.474	74%	0.738	S	S	.	*			trans	60.1	165.4	-174.5	0	0	0	0	0	112.4	S129 E130	S129-G132 PolarHBondContact O-N 3.29Å; E130-G132 PolarHBondContact O-N 3.35Å
133	Y	79.4	Confident	81	Confident	175 Å²	175	143.4 Å²	143.4	69%	0.686	74%	0.744	S	S	*	*			trans	-115.7	131.3	170	-64.7	-85.5	0	0	0	107.4	D135	Y133-D135 PolarHBondContact O-N 3.29Å
134	Q	82	Confident	80.9	Confident	152 Å²	152	141.2 Å²	141.2	71%	0.71	74%	0.738	S	S	*	*			trans	-77.4	106.1	171.6	-76	-177.8	6	0	0	108.3	Y136	Q134-Y136 PolarHBondContact O-N 3.11Å
135	D	86.3	Confident	80.6	Confident	156 Å²	156	146.3 Å²	146.3	83%	0.834	75%	0.753	S	S	*	*			trans	-81.3	6.1	179	-66.8	-27	0	0	0	113.6	Y133	Y133-D135 PolarHBondContact O-N 3.29Å
136	Y	84.9	Confident	80.4	Confident	168 Å²	168	139.7 Å²	139.7	66%	0.659	74%	0.739	S	S	*	*	S	Bend	trans	-131.5	135.4	-179	51.7	-88.5	0	0	0	111.1	Q134	Q134-Y136 PolarHBondContact O-N 3.11Å
137	E	77.5	Confident	80.2	Confident	164 Å²	164	138.1 Å²	138.1	77%	0.766	74%	0.738	S	S	*	*			trans	-72.5	138.5	168	-87.2	-175.1	144.2	0	0	109.8	E139	E137-E139 PolarHBondContact O-N 3.05Å; E137-E139 VanDerWaalsContact O-N 3.15Å
138	P	83.1	Confident	80.1	Confident	116 Å²	116	140.9 Å²	140.9	75%	0.753	76%	0.756	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.9	-4.4	178.9	27.4	-34.2	0	0	0	114.6
139	E	77.8	Confident	79.8	Confident	185 Å²	185	146.5 Å²	146.5	86%	0.864	78%	0.779	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111	18.6	-168.2	-68.7	-105.5	158.2	0	0	114.8	E137	E137-E139 PolarHBondContact O-N 3.05Å; E137-E139 VanDerWaalsContact O-N 3.15Å
140	A	63.7	Low	79.2	Confident	156 Å²	156	149.7 Å²	149.7	100%	1.289	78%	0.78	S	S	*	*			trans	-102.7	0	170.8	0	0	0	0	0	112.2

Retrieved 140 of 140 residues in 55.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).