SERP2_MOUSE Loading...

Stress-associated endoplasmic reticulum protein 2

Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins.

AlphaFold DB , UniProt , Accession Q6TAW2, Species MOUSE (Mus musculus, Mouse), Gene Serp2, Length 65 aa.

						>SERP2_MOUSE|Q6TAW2|Serp2
MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMGM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.1	Low	80.6	Confident	207 Å²	207	123.9 Å²	123.9	100%	1.02	62%	0.617	S	S	*	*				0	135.7	0	-67.8	-178.5	-156.2	0	0	108.8
2	V	76.3	Confident	81	Confident	97 Å²	97	121.9 Å²	121.9	59%	0.588	61%	0.605	S	S	*	*			trans	-66.8	138.3	-177	179.8	0	0	0	0	109.3	K4 Q5 R6	V2-K4 HydrophobicContact CG1-CB 4.19Å; V2-K4 PolarHBondContact O-N 3.24Å; V2-K4 VanDerWaalsContact O-N 3.07Å; V2-Q5 HydrophobicContact CB-CG 4.22Å; V2-Q5 WeakPolarHBondContact O-CA 3.34Å; V2-Q5 VanDerWaalsContact O-CB 3.32Å; V2-Q5 WeakPolarHBondContact O-CB 3.25Å; V2-Q5 PolarHBondContact O-N 2.83Å; V2-R6 PolarHBondContact O-N 3.38Å
3	A	80.1	Confident	81.2	Confident	73 Å²	73	123.8 Å²	123.8	60%	0.603	61%	0.607	S	S	*	*	H	α-helix	trans	-50.2	-39	-178.2	0	0	0	0	0	113	Q5 R6 I7	A3-Q5 VanDerWaalsContact C-N 3.31Å; A3-Q5 PolarHBondContact O-N 3.42Å; A3-R6 PolarHBondContact O-N 3.32Å; A3-R6 VanDerWaalsContact O-N 3.17Å; A3-I7 WeakPolarHBondContact O-CG1 3.38Å; A3-I7 PolarHBondContact O-N 2.96Å
4	K	81.7	Confident	81.2	Confident	151 Å²	151	123.7 Å²	123.7	66%	0.657	60%	0.604	S	S	*	*	H	α-helix	trans	-57.6	-38.2	174.1	-167.7	175.6	-174.2	178.1	0	113.3	V2 I7 R8	V2-K4 HydrophobicContact CG1-CB 4.19Å; V2-K4 PolarHBondContact O-N 3.24Å; V2-K4 VanDerWaalsContact O-N 3.07Å; K4-I7 PolarHBondContact O-N 3.05Å; K4-R8 WeakPolarHBondContact O-CG 3.2Å; K4-R8 PolarHBondContact O-N 3.48Å
5	Q	81.7	Confident	81.3	Confident	105 Å²	105	120 Å²	120	49%	0.491	60%	0.596	S	S	.	*	H	α-helix	trans	-67.1	-41.4	176.9	-67.2	174	-45.8	0	0	111.3	V2 A3 I7 R8 M9	V2-Q5 HydrophobicContact CB-CG 4.22Å; V2-Q5 WeakPolarHBondContact O-CA 3.34Å; V2-Q5 VanDerWaalsContact O-CB 3.32Å; V2-Q5 WeakPolarHBondContact O-CB 3.25Å; V2-Q5 PolarHBondContact O-N 2.83Å; A3-Q5 VanDerWaalsContact C-N 3.31Å; A3-Q5 PolarHBondContact O-N 3.42Å; Q5-I7 VanDerWaalsContact C-N 3.35Å; Q5-I7 PolarHBondContact O-N 2.93Å; Q5-R8 PolarHBondContact O-N 3.3Å; Q5-M9 WeakPolarHBondContact O-CB 3.48Å; Q5-M9 PolarHBondContact O-N 2.82Å
6	R	84.5	Confident	81.3	Confident	201 Å²	201	120.4 Å²	120.4	76%	0.758	59%	0.593	S	S	*	*	H	α-helix	trans	-62.6	-42.1	176.5	-173.8	178	177.1	177.2	-0.5	111.6	V2 A3 M9 A10	V2-R6 PolarHBondContact O-N 3.38Å; A3-R6 PolarHBondContact O-N 3.32Å; A3-R6 VanDerWaalsContact O-N 3.17Å; R6-M9 PolarHBondContact O-N 2.85Å; R6-A10 WeakPolarHBondContact O-CB 3.25Å; R6-A10 PolarHBondContact O-N 3.01Å
7	I	85.4	Confident	81.1	Confident	100 Å²	100	119.1 Å²	119.1	51%	0.513	59%	0.589	S	S	.	*	H	α-helix	trans	-65.1	-44.6	177.4	-63.6	166.6	0	0	0	110.8	A3 K4 Q5 M9 A10 N11	A3-I7 WeakPolarHBondContact O-CG1 3.38Å; A3-I7 PolarHBondContact O-N 2.96Å; K4-I7 PolarHBondContact O-N 3.05Å; Q5-I7 VanDerWaalsContact C-N 3.35Å; Q5-I7 PolarHBondContact O-N 2.93Å; I7-M9 VanDerWaalsContact C-N 3.35Å; I7-M9 PolarHBondContact O-N 3.31Å; I7-A10 PolarHBondContact O-N 3.06Å; I7-N11 WeakPolarHBondContact O-CB 3.24Å; I7-N11 PolarHBondContact O-N 3.49Å
8	R	83.7	Confident	80.9	Confident	152 Å²	152	117.8 Å²	117.8	57%	0.574	58%	0.584	S	S	*	*	H	α-helix	trans	-59	-46.3	175.6	-73.9	176.6	69.3	156.3	6	111.7	K4 Q5 A10 N11 E12	K4-R8 WeakPolarHBondContact O-CG 3.2Å; K4-R8 PolarHBondContact O-N 3.48Å; Q5-R8 PolarHBondContact O-N 3.3Å; R8-A10 VanDerWaalsContact C-N 3.31Å; R8-A10 PolarHBondContact O-N 3.43Å; R8-N11 PolarHBondContact O-N 3.46Å; R8-E12 WeakPolarHBondContact O-CB 3.26Å; R8-E12 VanDerWaalsContact O-CG 3.26Å; R8-E12 WeakPolarHBondContact O-CG 3.29Å; R8-E12 PolarHBondContact O-N 2.94Å
9	M	84.2	Confident	80.8	Confident	120 Å²	120	117.4 Å²	117.4	59%	0.591	59%	0.589	S	S	*	*	H	α-helix	trans	-62.4	-38.1	177.5	-171.3	178.6	-68.2	0	0	112.3	Q5 R6 I7 K13	Q5-M9 WeakPolarHBondContact O-CB 3.48Å; Q5-M9 PolarHBondContact O-N 2.82Å; R6-M9 PolarHBondContact O-N 2.85Å; I7-M9 VanDerWaalsContact C-N 3.35Å; I7-M9 PolarHBondContact O-N 3.31Å; M9-K13 WeakPolarHBondContact O-CB 3.28Å; M9-K13 PolarHBondContact O-N 3.35Å
10	A	83.4	Confident	80.3	Confident	54 Å²	54	117.1 Å²	117.1	45%	0.446	59%	0.585	S	S	.	*	H	α-helix	trans	-66.5	-44	174.9	0	0	0	0	0	112	R6 I7 R8 K13 H14	R6-A10 WeakPolarHBondContact O-CB 3.25Å; R6-A10 PolarHBondContact O-N 3.01Å; I7-A10 PolarHBondContact O-N 3.06Å; R8-A10 VanDerWaalsContact C-N 3.31Å; R8-A10 PolarHBondContact O-N 3.43Å; A10-K13 PolarHBondContact O-N 3.41Å; A10-H14 PolarHBondContact O-N 3.29Å
11	N	84.8	Confident	80	Confident	103 Å²	103	121.7 Å²	121.7	55%	0.551	60%	0.596	S	S	*	*	H	α-helix	trans	-65.8	-40.5	177.3	-71.7	-4.4	0	0	0	111.7	I7 R8 K13 H14 S15	I7-N11 WeakPolarHBondContact O-CB 3.24Å; I7-N11 PolarHBondContact O-N 3.49Å; R8-N11 PolarHBondContact O-N 3.46Å; N11-K13 VanDerWaalsContact C-N 3.35Å; N11-H14 PolarHBondContact O-N 3.48Å; N11-S15 WeakPolarHBondContact O-CB 3.1Å; N11-S15 PolarHBondContact O-N 2.9Å
12	E	85.2	Confident	80.5	Confident	100 Å²	100	115.2 Å²	115.2	47%	0.467	58%	0.581	S	S	.	*	H	α-helix	trans	-63.2	-41.1	174.6	-75	169.1	-161.3	0	0	111.2	R8 S15 K16	R8-E12 WeakPolarHBondContact O-CB 3.26Å; R8-E12 VanDerWaalsContact O-CG 3.26Å; R8-E12 WeakPolarHBondContact O-CG 3.29Å; R8-E12 PolarHBondContact O-N 2.94Å; E12-S15 PolarHBondContact O-N 3.21Å; E12-K16 WeakPolarHBondContact O-CB 3.45Å; E12-K16 VanDerWaalsContact O-CG 3.28Å; E12-K16 WeakPolarHBondContact O-CG 3.32Å; E12-K16 PolarHBondContact O-N 3.09Å
13	K	83.7	Confident	80.1	Confident	146 Å²	146	116.5 Å²	116.5	64%	0.635	59%	0.585	S	S	*	*	H	α-helix	trans	-64.3	-44.4	174.9	-171.8	176.6	-177.5	178.8	0	111.7	M9 A10 N11 N17	M9-K13 WeakPolarHBondContact O-CB 3.28Å; M9-K13 PolarHBondContact O-N 3.35Å; A10-K13 PolarHBondContact O-N 3.41Å; N11-K13 VanDerWaalsContact C-N 3.35Å; K13-N17 PolarHBondContact O-N 3.46Å
14	H	81.7	Confident	79.5	Confident	123 Å²	123	118.4 Å²	118.4	57%	0.569	59%	0.589	S	S	*	*	H	α-helix	trans	-63.9	-46.7	177	-172	74.9	0	0	0	111.2	A10 N11 K16 N17 I18	A10-H14 PolarHBondContact O-N 3.29Å; N11-H14 PolarHBondContact O-N 3.48Å; H14-K16 VanDerWaalsContact C-N 3.35Å; H14-K16 PolarHBondContact O-N 2.89Å; H14-N17 PolarHBondContact O-N 3.43Å; H14-N17 VanDerWaalsContact O-N 3.09Å; H14-I18 WeakPolarHBondContact O-CG1 3.28Å; H14-I18 PolarHBondContact O-N 3.38Å; H14-I18 VanDerWaalsContact O-N 3.07Å
15	S	82.6	Confident	78.7	Confident	68 Å²	68	115 Å²	115	48%	0.476	59%	0.589	S	S	.	*	H	α-helix	trans	-58.1	-43.4	178.8	-178.8	0	0	0	0	112.3	N11 E12 N17 I18 T19	N11-S15 WeakPolarHBondContact O-CB 3.1Å; N11-S15 PolarHBondContact O-N 2.9Å; E12-S15 PolarHBondContact O-N 3.21Å; S15-N17 VanDerWaalsContact C-N 3.33Å; S15-N17 PolarHBondContact O-N 3.12Å; S15-I18 PolarHBondContact O-N 2.84Å; S15-T19 PolarHBondContact O-N 2.82Å; S15-T19 VanDerWaalsContact O-N 3.07Å; S15-T19 PolarHBondContact O-OG1 2.92Å
16	K	80.7	Confident	77.9	Confident	126 Å²	126	119.3 Å²	119.3	55%	0.548	61%	0.606	S	S	.	*	H	α-helix	trans	-63.7	-35.1	175.5	-74.1	179.3	-173.9	-169.2	0	113.4	E12 H14 I18 T19 Q20	E12-K16 WeakPolarHBondContact O-CB 3.45Å; E12-K16 VanDerWaalsContact O-CG 3.28Å; E12-K16 WeakPolarHBondContact O-CG 3.32Å; E12-K16 PolarHBondContact O-N 3.09Å; H14-K16 VanDerWaalsContact C-N 3.35Å; H14-K16 PolarHBondContact O-N 2.89Å; K16-I18 VanDerWaalsContact C-N 3.33Å; K16-T19 PolarHBondContact O-OG1 3.48Å; K16-Q20 VanDerWaalsContact O-CB 3.26Å; K16-Q20 WeakPolarHBondContact O-CB 3.35Å; K16-Q20 WeakPolarHBondContact O-CG 3.3Å; K16-Q20 PolarHBondContact O-N 3.47Å; K16-Q20 VanDerWaalsContact O-N 3.09Å; K16-Q20 PolarHBondContact O-NE2 2.85Å
17	N	78	Confident	77	Confident	99 Å²	99	112.9 Å²	112.9	53%	0.529	59%	0.589	S	S	.	*	H	α-helix	trans	-73.1	-28.3	177.2	-72.5	-8.1	0	0	0	112	K13 H14 S15 R21	K13-N17 PolarHBondContact O-N 3.46Å; H14-N17 PolarHBondContact O-N 3.43Å; H14-N17 VanDerWaalsContact O-N 3.09Å; S15-N17 VanDerWaalsContact C-N 3.33Å; S15-N17 PolarHBondContact O-N 3.12Å; N17-R21 WeakPolarHBondContact O-CA 3.46Å; N17-R21 VanDerWaalsContact O-CB 3.31Å; N17-R21 WeakPolarHBondContact O-CB 3.02Å; N17-R21 PolarHBondContact O-N 3.49Å; N17-R21 VanDerWaalsContact O-N 3.09Å
18	I	77.9	Confident	76.1	Confident	96 Å²	96	116.9 Å²	116.9	49%	0.492	61%	0.611	S	S	.	*	H	α-helix	trans	-72.8	-47.8	174.6	-62.7	-60.3	0	0	0	111	H14 S15 K16 Q20 R21	H14-I18 WeakPolarHBondContact O-CG1 3.28Å; H14-I18 PolarHBondContact O-N 3.38Å; H14-I18 VanDerWaalsContact O-N 3.07Å; S15-I18 PolarHBondContact O-N 2.84Å; K16-I18 VanDerWaalsContact C-N 3.33Å; I18-Q20 VanDerWaalsContact C-N 3.33Å; I18-Q20 PolarHBondContact O-N 3.32Å; I18-R21 VanDerWaalsContact O-CB 3.25Å; I18-R21 WeakPolarHBondContact O-CB 2.99Å; I18-R21 PolarHBondContact O-N 3.44Å
19	T	78.6	Confident	75	Confident	110 Å²	110	119.6 Å²	119.6	68%	0.675	62%	0.621	S	S	*	*	H	α-helix	trans	-69.9	-30	-179.7	55.4	0	0	0	0	113.1	S15 K16	S15-T19 PolarHBondContact O-N 2.82Å; S15-T19 VanDerWaalsContact O-N 3.07Å; S15-T19 PolarHBondContact O-OG1 2.92Å; K16-T19 PolarHBondContact O-OG1 3.48Å
20	Q	71.3	Confident	73.8	Confident	110 Å²	110	118.9 Å²	118.9	51%	0.514	63%	0.626	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92.8	3.6	175.2	-62.8	175.5	91.1	0	0	113	K16 I18 G22 N23	K16-Q20 VanDerWaalsContact O-CB 3.26Å; K16-Q20 WeakPolarHBondContact O-CB 3.35Å; K16-Q20 WeakPolarHBondContact O-CG 3.3Å; K16-Q20 PolarHBondContact O-N 3.47Å; K16-Q20 VanDerWaalsContact O-N 3.09Å; K16-Q20 PolarHBondContact O-NE2 2.85Å; I18-Q20 VanDerWaalsContact C-N 3.33Å; I18-Q20 PolarHBondContact O-N 3.32Å; Q20-G22 PolarHBondContact O-N 2.8Å; Q20-G22 VanDerWaalsContact O-N 3.07Å; Q20-N23 PolarHBondContact O-N 2.83Å
21	R	72.5	Confident	72.8	Confident	215 Å²	215	123.1 Å²	123.1	81%	0.811	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.6	113.3	177.7	-170.1	174.4	178.8	-136.4	-0.4	109	N17 I18	N17-R21 WeakPolarHBondContact O-CA 3.46Å; N17-R21 VanDerWaalsContact O-CB 3.31Å; N17-R21 WeakPolarHBondContact O-CB 3.02Å; N17-R21 PolarHBondContact O-N 3.49Å; N17-R21 VanDerWaalsContact O-N 3.09Å; I18-R21 VanDerWaalsContact O-CB 3.25Å; I18-R21 WeakPolarHBondContact O-CB 2.99Å; I18-R21 PolarHBondContact O-N 3.44Å
22	G	72.5	Confident	71.7	Confident	70 Å²	70	126.1 Å²	126.1	72%	0.722	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	89.9	-6.2	-176.5	0	0	0	0	0	114.7	Q20 V24	Q20-G22 PolarHBondContact O-N 2.8Å; Q20-G22 VanDerWaalsContact O-N 3.07Å; G22-V24 PolarHBondContact O-N 3.26Å
23	N	67.5	Low	70.7	Confident	124 Å²	124	130.1 Å²	130.1	66%	0.663	67%	0.666	S	S	*	*			trans	-79.8	60.1	167.4	-166.1	48.9	0	0	0	110.1	Q20 A25	Q20-N23 PolarHBondContact O-N 2.83Å; N23-A25 PolarHBondContact O-N 2.9Å
24	V	67.8	Low	69.8	Low	114 Å²	114	131.9 Å²	131.9	69%	0.691	67%	0.673	S	S	*	*			trans	-77.2	121.4	168.9	-177.3	0	0	0	0	106.1	G22 K26	G22-V24 PolarHBondContact O-N 3.26Å; V24-K26 PolarHBondContact O-N 2.87Å
25	A	64.3	Low	69.3	Low	80 Å²	80	134.8 Å²	134.8	66%	0.661	68%	0.681	S	S	*	*			trans	-54.3	108.3	170.9	0	0	0	0	0	107.6	N23 T27	N23-A25 PolarHBondContact O-N 2.9Å; A25-T27 PolarHBondContact O-N 3.28Å
26	K	66.3	Low	69	Low	194 Å²	194	137.9 Å²	137.9	84%	0.843	70%	0.699	S	S	*	*	S	Bend	trans	-61.7	-16.1	-174.9	-64.1	-166.2	177.8	-161.8	0	112.2	V24	V24-K26 PolarHBondContact O-N 2.87Å
27	T	64.5	Low	68.9	Low	66 Å²	66	134.7 Å²	134.7	41%	0.405	69%	0.69	S	S	.	*	S	Bend	trans	-145.7	146.3	-177.8	52.2	0	0	0	0	109.3	A25 R29	A25-T27 PolarHBondContact O-N 3.28Å; T27-R29 PolarHBondContact O-N 2.82Å; T27-R29 PolarHBondContact OG1-O 3.5Å
28	L	66.6	Low	69.3	Low	185 Å²	185	131.2 Å²	131.2	97%	0.969	68%	0.677	S	S	*	*	S	Bend	trans	-67	-10.7	173.2	-71.9	165.1	0	0	0	113
29	R	60.6	Low	69.8	Low	208 Å²	208	131.7 Å²	131.7	79%	0.785	69%	0.687	S	S	*	*	S	Bend	trans	-86.5	126.2	177.2	-62.5	-171.3	-179	-175.1	0.6	107.3	T27 Q31	T27-R29 PolarHBondContact O-N 2.82Å; T27-R29 PolarHBondContact OG1-O 3.5Å; R29-Q31 PolarHBondContact O-N 3.41Å; R29-Q31 VanDerWaalsContact O-N 3.14Å
30	P	60.4	Low	70.4	Confident	106 Å²	106	136.5 Å²	136.5	69%	0.688	69%	0.692	S	S	*	*			trans	-49.5	129.4	169.7	22.2	-30.7	0	0	0	106.7	E32	P30-E32 PolarHBondContact O-N 2.91Å
31	Q	61.1	Low	71.4	Confident	143 Å²	143	136.6 Å²	136.6	67%	0.668	70%	0.696	S	S	*	*			trans	-68.7	78.5	173.2	-64.5	-81.3	47.8	0	0	105.3	R29 E33	R29-Q31 PolarHBondContact O-N 3.41Å; R29-Q31 VanDerWaalsContact O-N 3.14Å; Q31-E33 PolarHBondContact O-N 2.9Å
32	E	61.5	Low	72.3	Confident	165 Å²	165	130.2 Å²	130.2	77%	0.771	68%	0.677	S	S	*	*			trans	-45.1	117.5	160.1	-70.9	178.8	173.2	0	0	104.1	P30 K34	P30-E32 PolarHBondContact O-N 2.91Å; E32-K34 WeakPolarHBondContact O-CA 3.35Å; E32-K34 PolarHBondContact O-N 3.03Å
33	E	63.7	Low	73.3	Confident	184 Å²	184	129.6 Å²	129.6	86%	0.86	67%	0.666	S	S	*	*			trans	-48.4	93.9	-176	-74.5	180	147.3	0	0	107.7	Q31 Y35	Q31-E33 PolarHBondContact O-N 2.9Å; E33-Y35 PolarHBondContact O-N 3.44Å
34	K	66.8	Low	74.6	Confident	183 Å²	183	128.1 Å²	128.1	80%	0.796	66%	0.657	S	S	*	*			trans	-67	109.9	-174.7	-177.6	177	-179.2	179.9	0	102.4	E32 P36	E32-K34 WeakPolarHBondContact O-CA 3.35Å; E32-K34 PolarHBondContact O-N 3.03Å; K34-P36 VanDerWaalsContact O-N 3.13Å
35	Y	70.3	Confident	75.9	Confident	185 Å²	185	129.1 Å²	129.1	73%	0.725	65%	0.652	S	S	*	*			trans	-41.2	128.1	178.2	-81.4	-88.5	0	0	0	107.6	E33 V37	E33-Y35 PolarHBondContact O-N 3.44Å; Y35-V37 CarbonylContact O-C 3.52Å; Y35-V37 PolarHBondContact O-N 3Å
36	P	75.2	Confident	77.3	Confident	132 Å²	132	129.2 Å²	129.2	86%	0.857	65%	0.645	S	S	*	*	S	Bend	trans	-59.8	-17.5	-172.2	24.5	-34.7	0	0	0	111.6	K34	K34-P36 VanDerWaalsContact O-N 3.13Å
37	V	80.1	Confident	78.7	Confident	60 Å²	60	126.5 Å²	126.5	36%	0.364	63%	0.633	S	S	.	*	S	Bend	trans	-91.3	116.8	173.4	-67.5	0	0	0	0	110.6	Y35 L42	Y35-V37 CarbonylContact O-C 3.52Å; Y35-V37 PolarHBondContact O-N 3Å; V37-L42 HydrophobicContact CB-CD2 4.18Å; V37-L42 HydrophobicContact CB-CG 4.22Å; V37-L42 HydrophobicContact CG2-CD1 4.2Å; V37-L42 HydrophobicContact CG2-CD2 3.64Å; V37-L42 HydrophobicContact CG2-CG 3.9Å
38	G	85.7	Confident	80.2	Confident	25 Å²	25	127.2 Å²	127.2	26%	0.258	64%	0.637	S	S	.	*			trans	-67.3	156.9	175	0	0	0	0	0	112.1	W40 L41 L42	G38-W40 PolarHBondContact O-N 3.11Å; G38-W40 VanDerWaalsContact O-N 3.11Å; G38-L41 PolarHBondContact O-N 3.37Å; G38-L42 PolarHBondContact O-N 2.92Å
39	P	88.8	Confident	81.5	Confident	107 Å²	107	122 Å²	122	70%	0.695	61%	0.613	S	S	*	*	H	α-helix	trans	-53.2	-34.9	177.2	-27.1	34.7	0	0	0	113.6	L42 A43	P39-L42 PolarHBondContact O-N 2.88Å; P39-A43 WeakPolarHBondContact O-CB 3.33Å; P39-A43 PolarHBondContact O-N 2.6Å
40	W	91.7	Very high	83.1	Confident	210 Å²	210	115.5 Å²	115.5	80%	0.795	60%	0.599	S	S	*	*	H	α-helix	trans	-65.1	-44.1	176.3	-172.9	-99.4	0	0	0	113	G38 L42 A43 L44	G38-W40 PolarHBondContact O-N 3.11Å; G38-W40 VanDerWaalsContact O-N 3.11Å; W40-L42 VanDerWaalsContact C-N 3.35Å; W40-A43 PolarHBondContact O-N 3Å; W40-L44 WeakPolarHBondContact O-CB 3.38Å; W40-L44 PolarHBondContact O-N 2.71Å
41	L	91.5	Very high	84.7	Confident	112 Å²	112	110.8 Å²	110.8	59%	0.586	57%	0.57	S	S	*	*	H	α-helix	trans	-65.1	-41.1	176.2	-103.2	119.7	0	0	0	111.1	G38 L44 F45	G38-L41 PolarHBondContact O-N 3.37Å; L41-L44 PolarHBondContact O-N 2.82Å; L41-F45 VanDerWaalsContact O-CB 3.24Å; L41-F45 WeakPolarHBondContact O-CB 3.27Å; L41-F45 PolarHBondContact O-N 3.49Å
42	L	91.4	Very high	86.2	Confident	81 Å²	81	106.5 Å²	106.5	42%	0.424	56%	0.555	S	S	.	*	H	α-helix	trans	-61.2	-46.3	174.7	-72.2	176	0	0	0	111.6	V37 G38 P39 W40 L44 F45 V46	V37-L42 HydrophobicContact CB-CD2 4.18Å; V37-L42 HydrophobicContact CB-CG 4.22Å; V37-L42 HydrophobicContact CG2-CD1 4.2Å; V37-L42 HydrophobicContact CG2-CD2 3.64Å; V37-L42 HydrophobicContact CG2-CG 3.9Å; G38-L42 PolarHBondContact O-N 2.92Å; P39-L42 PolarHBondContact O-N 2.88Å; W40-L42 VanDerWaalsContact C-N 3.35Å; L42-L44 PolarHBondContact O-N 3.01Å; L42-F45 PolarHBondContact O-N 3.14Å; L42-V46 WeakPolarHBondContact O-CG2 3.41Å; L42-V46 PolarHBondContact O-N 3.35Å
43	A	93.2	Very high	87.6	Confident	57 Å²	57	100.8 Å²	100.8	47%	0.471	54%	0.537	S	S	.	.	H	α-helix	trans	-61.5	-44.6	177	0	0	0	0	0	111.9	P39 W40 V46 F47	P39-A43 WeakPolarHBondContact O-CB 3.33Å; P39-A43 PolarHBondContact O-N 2.6Å; W40-A43 PolarHBondContact O-N 3Å; A43-V46 PolarHBondContact O-N 3.34Å; A43-F47 VanDerWaalsContact O-CB 3.27Å; A43-F47 WeakPolarHBondContact O-CB 3.24Å; A43-F47 PolarHBondContact O-N 3.07Å
44	L	95	Very high	89.1	Confident	93 Å²	93	96.7 Å²	96.7	49%	0.487	52%	0.52	S	S	.	.	H	α-helix	trans	-60.8	-46.4	175.3	-166.9	165.2	0	0	0	110.6	W40 L41 L42 V46 F47 V48	W40-L44 WeakPolarHBondContact O-CB 3.38Å; W40-L44 PolarHBondContact O-N 2.71Å; L41-L44 PolarHBondContact O-N 2.82Å; L42-L44 PolarHBondContact O-N 3.01Å; L44-V46 PolarHBondContact O-N 3.31Å; L44-F47 PolarHBondContact O-N 3.42Å; L44-V48 HydrophobicContact CD2-CG2 3.7Å; L44-V48 WeakPolarHBondContact O-CG2 3.43Å; L44-V48 PolarHBondContact O-N 3.09Å
45	F	95.2	Very high	90.2	Very high	135 Å²	135	93.2 Å²	93.2	59%	0.592	50%	0.504	S	S	*	.	H	α-helix	trans	-59.5	-48.8	178.7	-177.3	-100.8	0	0	0	111.7	L41 L42 F47 V48 V49	L41-F45 VanDerWaalsContact O-CB 3.24Å; L41-F45 WeakPolarHBondContact O-CB 3.27Å; L41-F45 PolarHBondContact O-N 3.49Å; L42-F45 PolarHBondContact O-N 3.14Å; F45-F47 VanDerWaalsContact C-N 3.35Å; F45-F47 PolarHBondContact O-N 3.35Å; F45-V48 PolarHBondContact O-N 2.8Å; F45-V49 HydrophobicContact CD1-CG2 4.4Å; F45-V49 HydrophobicContact CD2-CG2 4.39Å; F45-V49 HydrophobicContact CE1-CG2 4.08Å; F45-V49 HydrophobicContact CE2-CG2 4.07Å; F45-V49 HydrophobicContact CZ-CG2 3.9Å; F45-V49 WeakPolarHBondContact O-CB 3.33Å; F45-V49 VanDerWaalsContact O-CG2 3.3Å; F45-V49 WeakPolarHBondContact O-CG2 3.26Å; F45-V49 PolarHBondContact O-N 3.21Å
46	V	94.7	Very high	91.1	Very high	83 Å²	83	90.5 Å²	90.5	50%	0.503	50%	0.498	S	S	.	.	H	α-helix	trans	-63	-41.8	176.7	173.9	0	0	0	0	111.2	L42 A43 L44 V49 C50	L42-V46 WeakPolarHBondContact O-CG2 3.41Å; L42-V46 PolarHBondContact O-N 3.35Å; A43-V46 PolarHBondContact O-N 3.34Å; L44-V46 PolarHBondContact O-N 3.31Å; V46-V49 PolarHBondContact O-N 3.37Å; V46-C50 VanDerWaalsContact O-CB 3.32Å; V46-C50 WeakPolarHBondContact O-CB 3.37Å; V46-C50 PolarHBondContact O-N 3.21Å
47	F	94.8	Very high	91.9	Very high	136 Å²	136	89 Å²	89	60%	0.596	48%	0.482	S	S	*	.	H	α-helix	trans	-62.6	-42.6	176.7	175.9	-100	0	0	0	112.1	A43 L44 F45 G51 F55	A43-F47 VanDerWaalsContact O-CB 3.27Å; A43-F47 WeakPolarHBondContact O-CB 3.24Å; A43-F47 PolarHBondContact O-N 3.07Å; L44-F47 PolarHBondContact O-N 3.42Å; F45-F47 VanDerWaalsContact C-N 3.35Å; F45-F47 PolarHBondContact O-N 3.35Å; F47-G51 WeakPolarHBondContact O-CA 3.28Å; F47-G51 PolarHBondContact O-N 3.07Å; F47-F55 HydrophobicContact CZ-CE2 4.36Å
48	V	95.2	Very high	92.4	Very high	81 Å²	81	90.6 Å²	90.6	49%	0.491	49%	0.488	S	S	.	.	H	α-helix	trans	-68.2	-46.1	178.2	170.4	0	0	0	0	110.7	L44 F45 S52	L44-V48 HydrophobicContact CD2-CG2 3.7Å; L44-V48 WeakPolarHBondContact O-CG2 3.43Å; L44-V48 PolarHBondContact O-N 3.09Å; F45-V48 PolarHBondContact O-N 2.8Å; V48-S52 WeakPolarHBondContact O-CB 3.2Å; V48-S52 PolarHBondContact O-N 3.06Å; V48-S52 VanDerWaalsContact O-N 3.12Å; V48-S52 PolarHBondContact O-OG 3.01Å
49	V	95.2	Very high	92.5	Very high	76 Å²	76	94.2 Å²	94.2	46%	0.461	50%	0.498	S	S	.	.	H	α-helix	trans	-69.1	-58.3	-178.1	175.7	0	0	0	0	111.3	F45 V46 S52	F45-V49 HydrophobicContact CD1-CG2 4.4Å; F45-V49 HydrophobicContact CD2-CG2 4.39Å; F45-V49 HydrophobicContact CE1-CG2 4.08Å; F45-V49 HydrophobicContact CE2-CG2 4.07Å; F45-V49 HydrophobicContact CZ-CG2 3.9Å; F45-V49 WeakPolarHBondContact O-CB 3.33Å; F45-V49 VanDerWaalsContact O-CG2 3.3Å; F45-V49 WeakPolarHBondContact O-CG2 3.26Å; F45-V49 PolarHBondContact O-N 3.21Å; V46-V49 PolarHBondContact O-N 3.37Å; V49-S52 PolarHBondContact O-OG 3.22Å
50	C	94.8	Very high	92.6	Very high	71 Å²	71	91.1 Å²	91.1	48%	0.48	48%	0.479	S	S	.	.	H	α-helix	trans	-73.5	-40.3	-178.8	-72.4	0	0	0	0	112.3	V46 S52 A53 I54	V46-C50 VanDerWaalsContact O-CB 3.32Å; V46-C50 WeakPolarHBondContact O-CB 3.37Å; V46-C50 PolarHBondContact O-N 3.21Å; C50-S52 VanDerWaalsContact C-N 3.32Å; C50-S52 PolarHBondContact O-N 3.09Å; C50-A53 PolarHBondContact O-N 3.09Å; C50-I54 WeakPolarHBondContact O-CG1 3.33Å; C50-I54 PolarHBondContact O-N 2.91Å; C50-I54 VanDerWaalsContact O-N 3.09Å
51	G	92.2	Very high	92.5	Very high	8 Å²	8	87.3 Å²	87.3	8%	0.082	47%	0.473	C	S	.	.	H	α-helix	trans	-61.9	-40.6	179.3	0	0	0	0	0	111.6	F47 A53 I54 F55	F47-G51 WeakPolarHBondContact O-CA 3.28Å; F47-G51 PolarHBondContact O-N 3.07Å; G51-A53 VanDerWaalsContact C-N 3.33Å; G51-A53 PolarHBondContact O-N 2.95Å; G51-I54 PolarHBondContact O-N 2.89Å; G51-F55 WeakPolarHBondContact O-CB 3.26Å; G51-F55 WeakPolarHBondContact O-CD2 3.47Å; G51-F55 PolarHBondContact O-N 3.01Å
52	S	92.7	Very high	92.2	Very high	52 Å²	52	92.6 Å²	92.6	36%	0.364	49%	0.485	S	S	.	.	H	α-helix	trans	-60.4	-41	177.4	64.2	0	0	0	0	112.8	V48 V49 C50 F55 Q56	V48-S52 WeakPolarHBondContact O-CB 3.2Å; V48-S52 PolarHBondContact O-N 3.06Å; V48-S52 VanDerWaalsContact O-N 3.12Å; V48-S52 PolarHBondContact O-OG 3.01Å; V49-S52 PolarHBondContact O-OG 3.22Å; C50-S52 VanDerWaalsContact C-N 3.32Å; C50-S52 PolarHBondContact O-N 3.09Å; S52-F55 PolarHBondContact O-N 3.46Å; S52-Q56 WeakPolarHBondContact O-CB 3.25Å; S52-Q56 VanDerWaalsContact O-CG 3.24Å; S52-Q56 WeakPolarHBondContact O-CG 3.31Å; S52-Q56 PolarHBondContact O-N 3.49Å
53	A	92	Very high	91.6	Very high	46 Å²	46	94.6 Å²	94.6	38%	0.38	49%	0.494	S	S	.	.	H	α-helix	trans	-64	-44.9	175.5	0	0	0	0	0	111.7	C50 G51 Q56 I57	C50-A53 PolarHBondContact O-N 3.09Å; G51-A53 VanDerWaalsContact C-N 3.33Å; G51-A53 PolarHBondContact O-N 2.95Å; A53-Q56 PolarHBondContact O-N 3.07Å; A53-I57 VanDerWaalsContact O-CG1 3.29Å; A53-I57 WeakPolarHBondContact O-CG1 3.48Å; A53-I57 PolarHBondContact O-N 2.96Å
54	I	93.7	Very high	90.6	Very high	98 Å²	98	95.2 Å²	95.2	50%	0.503	51%	0.506	S	S	.	.	H	α-helix	trans	-62.8	-45.9	177.6	-63	168.3	0	0	0	110.5	C50 G51 Q56 I57 I58	C50-I54 WeakPolarHBondContact O-CG1 3.33Å; C50-I54 PolarHBondContact O-N 2.91Å; C50-I54 VanDerWaalsContact O-N 3.09Å; G51-I54 PolarHBondContact O-N 2.89Å; I54-Q56 PolarHBondContact O-N 2.81Å; I54-I57 PolarHBondContact O-N 3.36Å; I54-I58 HydrophobicContact CG2-CD1 3.73Å; I54-I58 HydrophobicContact CG2-CG1 4.41Å; I54-I58 VanDerWaalsContact O-CG1 3.28Å; I54-I58 WeakPolarHBondContact O-CG1 3.42Å; I54-I58 PolarHBondContact O-N 3.35Å
55	F	90.7	Very high	88.9	Confident	109 Å²	109	100.2 Å²	100.2	48%	0.478	53%	0.529	S	S	.	.	H	α-helix	trans	-64.1	-39	177.8	-76.8	-64.4	0	0	0	112.2	F47 G51 S52 I58 Q59	F47-F55 HydrophobicContact CZ-CE2 4.36Å; G51-F55 WeakPolarHBondContact O-CB 3.26Å; G51-F55 WeakPolarHBondContact O-CD2 3.47Å; G51-F55 PolarHBondContact O-N 3.01Å; S52-F55 PolarHBondContact O-N 3.46Å; F55-I58 PolarHBondContact O-N 3.45Å; F55-Q59 VanDerWaalsContact O-CB 3.28Å; F55-Q59 WeakPolarHBondContact O-CB 3.32Å; F55-Q59 WeakPolarHBondContact O-CG 3.46Å; F55-Q59 PolarHBondContact O-N 3.43Å
56	Q	90.2	Very high	88.6	Confident	128 Å²	128	98.5 Å²	98.5	60%	0.598	53%	0.525	S	S	*	.	H	α-helix	trans	-61.7	-44.9	174.4	-77.9	173.7	41.7	0	0	111.8	S52 A53 I54 Q59 S60	S52-Q56 WeakPolarHBondContact O-CB 3.25Å; S52-Q56 VanDerWaalsContact O-CG 3.24Å; S52-Q56 WeakPolarHBondContact O-CG 3.31Å; S52-Q56 PolarHBondContact O-N 3.49Å; A53-Q56 PolarHBondContact O-N 3.07Å; I54-Q56 PolarHBondContact O-N 2.81Å; Q56-Q59 PolarHBondContact O-N 3.49Å; Q56-S60 WeakPolarHBondContact O-CB 3.41Å; Q56-S60 PolarHBondContact O-N 3.07Å; Q56-S60 PolarHBondContact O-OG 2.89Å
57	I	91.2	Very high	88.3	Confident	100 Å²	100	99.3 Å²	99.3	51%	0.513	53%	0.527	S	S	.	.	H	α-helix	trans	-63.6	-44	177.2	-66.4	163.1	0	0	0	111	A53 I54 Q59 S60 I61	A53-I57 VanDerWaalsContact O-CG1 3.29Å; A53-I57 WeakPolarHBondContact O-CG1 3.48Å; A53-I57 PolarHBondContact O-N 2.96Å; I54-I57 PolarHBondContact O-N 3.36Å; I57-Q59 VanDerWaalsContact C-N 3.31Å; I57-Q59 PolarHBondContact O-N 3.48Å; I57-S60 PolarHBondContact O-N 3.24Å; I57-S60 PolarHBondContact O-OG 3.22Å; I57-I61 HydrophobicContact CG2-CD1 3.78Å; I57-I61 VanDerWaalsContact O-CG1 3.25Å; I57-I61 WeakPolarHBondContact O-CG1 3.5Å; I57-I61 PolarHBondContact O-N 3.06Å
58	I	90.1	Very high	87.9	Confident	94 Å²	94	97.2 Å²	97.2	48%	0.482	52%	0.523	S	S	.	.	H	α-helix	trans	-64.1	-40.8	177.6	-67.3	169.1	0	0	0	110.4	I54 F55 R62	I54-I58 HydrophobicContact CG2-CD1 3.73Å; I54-I58 HydrophobicContact CG2-CG1 4.41Å; I54-I58 VanDerWaalsContact O-CG1 3.28Å; I54-I58 WeakPolarHBondContact O-CG1 3.42Å; I54-I58 PolarHBondContact O-N 3.35Å; F55-I58 PolarHBondContact O-N 3.45Å; I58-R62 VanDerWaalsContact O-CB 3.26Å; I58-R62 WeakPolarHBondContact O-CB 3.42Å; I58-R62 PolarHBondContact O-N 3.3Å
59	Q	88.1	Confident	87.5	Confident	101 Å²	101	98.2 Å²	98.2	47%	0.472	53%	0.525	S	S	.	.	H	α-helix	trans	-67.1	-42.7	177.5	-75.9	177.1	13.5	0	0	112.1	F55 Q56 I57 I61 R62 M63	F55-Q59 VanDerWaalsContact O-CB 3.28Å; F55-Q59 WeakPolarHBondContact O-CB 3.32Å; F55-Q59 WeakPolarHBondContact O-CG 3.46Å; F55-Q59 PolarHBondContact O-N 3.43Å; Q56-Q59 PolarHBondContact O-N 3.49Å; I57-Q59 VanDerWaalsContact C-N 3.31Å; I57-Q59 PolarHBondContact O-N 3.48Å; Q59-I61 PolarHBondContact O-N 2.97Å; Q59-R62 PolarHBondContact O-N 2.95Å; Q59-M63 HydrophobicContact CB-SD 4.45Å; Q59-M63 HydrophobicContact CG-CE 4.46Å; Q59-M63 VanDerWaalsContact O-CB 3.25Å; Q59-M63 WeakPolarHBondContact O-CB 3.38Å; Q59-M63 WeakPolarHBondContact O-CG 3.44Å; Q59-M63 PolarHBondContact O-N 2.9Å
60	S	90.8	Very high	87	Confident	42 Å²	42	99.6 Å²	99.6	29%	0.294	53%	0.529	S	S	.	.	H	α-helix	trans	-61.8	-45.5	177.6	68.1	0	0	0	0	111.2	Q56 I57 R62 G64 M65	Q56-S60 WeakPolarHBondContact O-CB 3.41Å; Q56-S60 PolarHBondContact O-N 3.07Å; Q56-S60 PolarHBondContact O-OG 2.89Å; I57-S60 PolarHBondContact O-N 3.24Å; I57-S60 PolarHBondContact O-OG 3.22Å; S60-R62 PolarHBondContact O-N 3.4Å; S60-G64 PolarHBondContact O-N 3.22Å; S60-M65 PolarHBondContact O-N 3.36Å
61	I	90.7	Very high	86.5	Confident	131 Å²	131	101.5 Å²	101.5	67%	0.672	53%	0.532	S	S	*	.	H	α-helix	trans	-64.2	-42.4	177.2	-64.6	168	0	0	0	111.4	I57 Q59	I57-I61 HydrophobicContact CG2-CD1 3.78Å; I57-I61 VanDerWaalsContact O-CG1 3.25Å; I57-I61 WeakPolarHBondContact O-CG1 3.5Å; I57-I61 PolarHBondContact O-N 3.06Å; Q59-I61 PolarHBondContact O-N 2.97Å
62	R	85.5	Confident	86.1	Confident	223 Å²	223	108.1 Å²	108.1	84%	0.842	56%	0.564	S	S	*	*	H	α-helix	trans	-72.7	-36.9	-178.6	-178.4	175.2	175	144.6	0.5	113.1	I58 Q59 S60 G64	I58-R62 VanDerWaalsContact O-CB 3.26Å; I58-R62 WeakPolarHBondContact O-CB 3.42Å; I58-R62 PolarHBondContact O-N 3.3Å; Q59-R62 PolarHBondContact O-N 2.95Å; S60-R62 PolarHBondContact O-N 3.4Å; R62-G64 VanDerWaalsContact C-N 3.29Å
63	M	78.8	Confident	85.6	Confident	123 Å²	123	112.5 Å²	112.5	61%	0.606	58%	0.579	S	S	*	*	H	α-helix	trans	-85.7	-4.3	-178.8	-65.4	172.7	-178.9	0	0	112.4	Q59 M65	Q59-M63 HydrophobicContact CB-SD 4.45Å; Q59-M63 HydrophobicContact CG-CE 4.46Å; Q59-M63 VanDerWaalsContact O-CB 3.25Å; Q59-M63 WeakPolarHBondContact O-CB 3.38Å; Q59-M63 WeakPolarHBondContact O-CG 3.44Å; Q59-M63 PolarHBondContact O-N 2.9Å; M63-M65 VanDerWaalsContact C-N 3.25Å; M63-M65 HydrophobicContact CB-CG 4.19Å; M63-M65 PolarHBondContact O-N 3.17Å
64	G	70.9	Confident	85	Confident	70 Å²	70	118 Å²	118	72%	0.722	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	65.6	27.7	176.5	0	0	0	0	0	113.5	S60 R62	S60-G64 PolarHBondContact O-N 3.22Å; R62-G64 VanDerWaalsContact C-N 3.29Å
65	M	59.8	Low	84.2	Confident	197 Å²	197	119.8 Å²	119.8	97%	0.97	60%	0.604	S	S	*	*			trans	-90.3	0	175.2	-55.4	-170.4	-53	0	0	111	S60 M63	S60-M65 PolarHBondContact O-N 3.36Å; M63-M65 VanDerWaalsContact C-N 3.25Å; M63-M65 HydrophobicContact CB-CG 4.19Å; M63-M65 PolarHBondContact O-N 3.17Å

Retrieved 65 of 65 residues in 204.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).