Q7Z157_SCHMA Loading...

Neuropeptide F

AlphaFold DB , UniProt , Accession Q7Z157, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene NPF, Length 147 aa.

						>Q7Z157_SCHMA|Q7Z157|NPF
MYSYMYGQYSFNWNVKSMNSMSILLILLLKFILFQSNSIFINADELNLNTNNNLSNIPNDQQRAQALAKLMSLFYTSDAFNKYMENLDAYYMLRGRPRFGKRNYNPIKDNNDLMKNDLINNYLRQKLLQKYLIDNYNNDGDENFLRN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	34.1	Very low	39.8	Very low	236 Å²	236	167.2 Å²	167.2	100%	1.163	80%	0.803	S	S	*	*				0	91.3	0	-85.4	161.4	86.2	0	0	108.2
2	Y	36.5	Very low	40.5	Very low	225 Å²	225	166.8 Å²	166.8	88%	0.882	81%	0.808	S	S	*	*			trans	-99.2	93.6	174.4	-75.8	-80.7	0	0	0	107.8	Y4	Y2-Y4 PolarHBondContact O-N 2.9Å
3	S	37.8	Very low	41.3	Very low	113 Å²	113	164.9 Å²	164.9	79%	0.79	79%	0.788	S	S	*	*			trans	-73.8	111.9	169	-82.3	0	0	0	0	108.5	M5	S3-M5 PolarHBondContact O-N 3.49Å
4	Y	42.8	Very low	42.1	Very low	206 Å²	206	161.6 Å²	161.6	81%	0.808	78%	0.776	S	S	*	*			trans	-63.2	101.2	169.3	-76.1	-91	0	0	0	108.8	Y2 Y6	Y2-Y4 PolarHBondContact O-N 2.9Å; Y4-Y6 VanDerWaalsContact C-N 3.26Å; Y4-Y6 PolarHBondContact O-N 3.08Å
5	M	34.9	Very low	43.1	Very low	184 Å²	184	157.5 Å²	157.5	91%	0.906	77%	0.765	S	S	*	*			trans	-65	89.9	166.5	-73	-174.6	79.4	0	0	108	S3 G7	S3-M5 PolarHBondContact O-N 3.49Å; M5-G7 PolarHBondContact O-N 2.84Å
6	Y	41.3	Very low	43.8	Very low	192 Å²	192	160.2 Å²	160.2	75%	0.753	77%	0.772	S	S	*	*			trans	-64	93.7	161.2	-90.9	-85.3	0	0	0	107.3	Y4 Q8	Y4-Y6 VanDerWaalsContact C-N 3.26Å; Y4-Y6 PolarHBondContact O-N 3.08Å; Y6-Q8 PolarHBondContact O-N 3.45Å
7	G	36.1	Very low	44.4	Very low	50 Å²	50	156.6 Å²	156.6	52%	0.515	77%	0.768	S	S	.	*			trans	-56.9	109.9	173.5	0	0	0	0	0	109.1	M5 Y9	M5-G7 PolarHBondContact O-N 2.84Å; G7-Y9 VanDerWaalsContact O-CD2 3.27Å; G7-Y9 WeakPolarHBondContact O-CD2 3.32Å; G7-Y9 PolarHBondContact O-N 3.28Å
8	Q	41	Very low	44.9	Very low	189 Å²	189	150.7 Å²	150.7	88%	0.883	74%	0.739	S	S	*	*			trans	-66.4	87	168.6	-72.7	-178.4	-11	0	0	108.2	Y6 S10	Y6-Q8 PolarHBondContact O-N 3.45Å; Q8-S10 PolarHBondContact O-N 3.43Å
9	Y	42.5	Very low	45.6	Very low	198 Å²	198	149.5 Å²	149.5	78%	0.776	74%	0.736	S	S	*	*			trans	-69	84	167.9	-72.7	-83.1	0	0	0	108.7	G7 F11	G7-Y9 VanDerWaalsContact O-CD2 3.27Å; G7-Y9 WeakPolarHBondContact O-CD2 3.32Å; G7-Y9 PolarHBondContact O-N 3.28Å; Y9-F11 HydrophobicContact CD1-CE2 4.48Å; Y9-F11 PolarHBondContact O-N 3.43Å; Y9-F11 VanDerWaalsContact O-N 3.15Å
10	S	41	Very low	46.5	Very low	105 Å²	105	147 Å²	147	73%	0.734	73%	0.733	S	S	*	*			trans	-78.1	93.3	167.2	71.3	0	0	0	0	108.7	Q8 N12	Q8-S10 PolarHBondContact O-N 3.43Å; S10-N12 PolarHBondContact O-N 2.97Å
11	F	49.8	Very low	47.3	Very low	141 Å²	141	146.9 Å²	146.9	62%	0.618	73%	0.732	S	S	*	*			trans	-74.5	105.1	167.9	-79.9	-88.3	0	0	0	108.6	Y9 W13	Y9-F11 HydrophobicContact CD1-CE2 4.48Å; Y9-F11 PolarHBondContact O-N 3.43Å; Y9-F11 VanDerWaalsContact O-N 3.15Å; F11-W13 VanDerWaalsContact CB-CD1 3.49Å; F11-W13 HydrophobicContact CB-CG 4.45Å; F11-W13 HydrophobicContact CD1-CZ2 4.28Å; F11-W13 AromaticContact CG-NE1 3.86Å; F11-W13 VanDerWaalsContact O-CD1 3.24Å; F11-W13 PolarHBondContact O-N 3.25Å
12	N	48.7	Very low	49	Very low	163 Å²	163	137.9 Å²	137.9	87%	0.872	69%	0.693	S	S	*	*			trans	-69.1	81.6	169	-99.3	-15.1	0	0	0	109.7	S10 N14	S10-N12 PolarHBondContact O-N 2.97Å; N12-N14 PolarHBondContact O-N 3.05Å
13	W	50.5	Low	50.8	Low	142 Å²	142	130.4 Å²	130.4	54%	0.538	67%	0.667	S	S	.	*			trans	-76	112.2	172.9	-68.1	96.8	0	0	0	109.4	F11 V15 M18 I26	F11-W13 VanDerWaalsContact CB-CD1 3.49Å; F11-W13 HydrophobicContact CB-CG 4.45Å; F11-W13 HydrophobicContact CD1-CZ2 4.28Å; F11-W13 AromaticContact CG-NE1 3.86Å; F11-W13 VanDerWaalsContact O-CD1 3.24Å; F11-W13 PolarHBondContact O-N 3.25Å; W13-V15 PolarHBondContact O-N 3.39Å; W13-M18 HydrophobicContact CE3-CE 4.48Å; W13-M18 HydrophobicContact CE3-SD 4.45Å; W13-I26 HydrophobicContact CD2-CD1 4.45Å; W13-I26 HydrophobicContact CE3-CD1 4.35Å
14	N	53.1	Low	52.5	Low	118 Å²	118	130.1 Å²	130.1	63%	0.631	66%	0.657	S	S	*	*			trans	-72.1	96	175.8	-168.4	0.9	0	0	0	109.8	N12 K16	N12-N14 PolarHBondContact O-N 3.05Å; N14-K16 PolarHBondContact O-N 3Å; N14-K16 VanDerWaalsContact O-N 3.12Å
15	V	56.8	Low	54.2	Low	100 Å²	100	125.6 Å²	125.6	61%	0.606	65%	0.646	S	S	*	*	G	3₁₀ helix	trans	-62	-20.3	-175	-177.9	0	0	0	0	112.7	W13 S17 M18	W13-V15 PolarHBondContact O-N 3.39Å; V15-S17 VanDerWaalsContact C-N 3.29Å; V15-S17 PolarHBondContact O-N 3.41Å; V15-M18 PolarHBondContact O-N 2.91Å
16	K	54.7	Low	56.2	Low	201 Å²	201	118.2 Å²	118.2	87%	0.874	61%	0.61	S	S	*	*	G	3₁₀ helix	trans	-69.5	-18	-168.4	-143.8	172.9	-173.2	178.9	0	115	N14	N14-K16 PolarHBondContact O-N 3Å; N14-K16 VanDerWaalsContact O-N 3.12Å
17	S	53.5	Low	58	Low	100 Å²	100	114 Å²	114	70%	0.699	60%	0.6	S	S	*	*	G	3₁₀ helix	trans	-112.4	7.8	-178.5	62.8	0	0	0	0	114.5	V15	V15-S17 VanDerWaalsContact C-N 3.29Å; V15-S17 PolarHBondContact O-N 3.41Å
18	M	53.7	Low	60.1	Low	50 Å²	50	116.3 Å²	116.3	25%	0.246	60%	0.6	C	S	.	*			trans	-98.1	119.3	-169.5	-59.9	-165	78.4	0	0	111.7	W13 V15 I23 I26	W13-M18 HydrophobicContact CE3-CE 4.48Å; W13-M18 HydrophobicContact CE3-SD 4.45Å; V15-M18 PolarHBondContact O-N 2.91Å; M18-I23 HydrophobicContact CB-CG1 4.08Å; M18-I26 HydrophobicContact CE-CD1 3.18Å; M18-I26 HydrophobicContact CE-CG1 4.25Å; M18-I26 HydrophobicContact SD-CD1 3.4Å; M18-I26 WeakPolarHBondContact SD-CD1 3.12Å
19	N	58.7	Low	61.9	Low	127 Å²	127	111.8 Å²	111.8	68%	0.679	58%	0.581	S	S	*	*			trans	-54.9	150.5	169.8	-79.2	-12.7	0	0	0	110.9	M21 S22 I23	N19-M21 PolarHBondContact O-N 3.21Å; N19-M21 VanDerWaalsContact O-N 3.1Å; N19-S22 WeakPolarHBondContact O-CA 3.44Å; N19-S22 VanDerWaalsContact O-CB 3.3Å; N19-S22 WeakPolarHBondContact O-CB 3.36Å; N19-S22 PolarHBondContact O-N 3.17Å; N19-I23 PolarHBondContact O-N 3.4Å
20	S	63	Low	63.4	Low	99 Å²	99	108.6 Å²	108.6	69%	0.692	57%	0.571	S	S	*	*	H	α-helix	trans	-51.1	-37.4	-176.8	55.2	0	0	0	0	114	I23 L24	S20-I23 PolarHBondContact O-N 2.9Å; S20-L24 PolarHBondContact O-N 3.32Å; S20-L24 VanDerWaalsContact O-N 3.08Å
21	M	63.6	Low	65.1	Low	145 Å²	145	109.7 Å²	109.7	71%	0.714	56%	0.563	S	S	*	*	H	α-helix	trans	-64.6	-37.1	174.2	-73.4	-60.5	-145.4	0	0	113.3	N19 I23 L24 L25	N19-M21 PolarHBondContact O-N 3.21Å; N19-M21 VanDerWaalsContact O-N 3.1Å; M21-I23 VanDerWaalsContact C-N 3.33Å; M21-L24 PolarHBondContact O-N 2.92Å; M21-L25 PolarHBondContact O-N 3.04Å
22	S	69.8	Low	66.3	Low	47 Å²	47	107.4 Å²	107.4	33%	0.329	56%	0.556	S	S	.	*	H	α-helix	trans	-68.7	-35.5	178.2	-49.1	0	0	0	0	111.2	N19 L25 I26	N19-S22 WeakPolarHBondContact O-CA 3.44Å; N19-S22 VanDerWaalsContact O-CB 3.3Å; N19-S22 WeakPolarHBondContact O-CB 3.36Å; N19-S22 PolarHBondContact O-N 3.17Å; S22-L25 PolarHBondContact O-N 3.32Å; S22-I26 WeakPolarHBondContact O-CG1 3.32Å; S22-I26 PolarHBondContact O-N 3.12Å
23	I	73.7	Confident	67.4	Low	68 Å²	68	104.7 Å²	104.7	35%	0.349	54%	0.541	S	S	.	.	H	α-helix	trans	-65	-45.2	173.5	-64.4	166.5	0	0	0	110.3	M18 N19 S20 M21 L25 I26 L27	M18-I23 HydrophobicContact CB-CG1 4.08Å; N19-I23 PolarHBondContact O-N 3.4Å; S20-I23 PolarHBondContact O-N 2.9Å; M21-I23 VanDerWaalsContact C-N 3.33Å; I23-L25 VanDerWaalsContact C-N 3.33Å; I23-L25 PolarHBondContact O-N 3.46Å; I23-I26 PolarHBondContact O-N 3.29Å; I23-L27 HydrophobicContact CG2-CD1 4.14Å; I23-L27 WeakPolarHBondContact O-CG 3.3Å; I23-L27 PolarHBondContact O-N 3.28Å
24	L	74.6	Confident	68.5	Low	108 Å²	108	104.7 Å²	104.7	57%	0.565	55%	0.545	S	S	*	.	H	α-helix	trans	-58.9	-45.2	176.5	-166.5	89	0	0	0	111.3	S20 M21 I26 L27 L28	S20-L24 PolarHBondContact O-N 3.32Å; S20-L24 VanDerWaalsContact O-N 3.08Å; M21-L24 PolarHBondContact O-N 2.92Å; L24-I26 PolarHBondContact O-N 2.88Å; L24-L27 PolarHBondContact O-N 3.44Å; L24-L28 WeakPolarHBondContact O-CB 3.42Å; L24-L28 PolarHBondContact O-N 2.87Å
25	L	77.7	Confident	69.3	Low	110 Å²	110	103 Å²	103	58%	0.576	53%	0.534	S	S	*	.	H	α-helix	trans	-61.6	-42.3	178.3	-174.2	69.4	0	0	0	111.9	M21 S22 I23 L28 L29	M21-L25 PolarHBondContact O-N 3.04Å; S22-L25 PolarHBondContact O-N 3.32Å; I23-L25 VanDerWaalsContact C-N 3.33Å; I23-L25 PolarHBondContact O-N 3.46Å; L25-L28 PolarHBondContact O-N 3.39Å; L25-L29 HydrophobicContact CG-CD1 4.28Å; L25-L29 PolarHBondContact O-N 3.19Å
26	I	77.1	Confident	69.6	Low	30 Å²	30	99.9 Å²	99.9	15%	0.154	52%	0.516	C	S	.	.	H	α-helix	trans	-63.7	-43	175.9	-70.3	163.8	0	0	0	111.2	W13 M18 S22 I23 L24 L28 L29 K30	W13-I26 HydrophobicContact CD2-CD1 4.45Å; W13-I26 HydrophobicContact CE3-CD1 4.35Å; M18-I26 HydrophobicContact CE-CD1 3.18Å; M18-I26 HydrophobicContact CE-CG1 4.25Å; M18-I26 HydrophobicContact SD-CD1 3.4Å; M18-I26 WeakPolarHBondContact SD-CD1 3.12Å; S22-I26 WeakPolarHBondContact O-CG1 3.32Å; S22-I26 PolarHBondContact O-N 3.12Å; I23-I26 PolarHBondContact O-N 3.29Å; L24-I26 PolarHBondContact O-N 2.88Å; I26-L28 VanDerWaalsContact C-N 3.28Å; I26-L28 PolarHBondContact O-N 3.48Å; I26-L29 PolarHBondContact O-N 2.93Å; I26-K30 HydrophobicContact CG2-CD 4.42Å; I26-K30 HydrophobicContact CG2-CG 4.43Å; I26-K30 WeakPolarHBondContact O-CB 3.26Å; I26-K30 WeakPolarHBondContact O-CG 3.4Å; I26-K30 PolarHBondContact O-N 3.29Å
27	L	78.6	Confident	70	Confident	104 Å²	104	94.8 Å²	94.8	55%	0.545	50%	0.498	S	S	.	.	H	α-helix	trans	-61.9	-40	177.7	-74.3	171.4	0	0	0	111.2	I23 L24 K30 F31	I23-L27 HydrophobicContact CG2-CD1 4.14Å; I23-L27 WeakPolarHBondContact O-CG 3.3Å; I23-L27 PolarHBondContact O-N 3.28Å; L24-L27 PolarHBondContact O-N 3.44Å; L27-K30 PolarHBondContact O-N 3.09Å; L27-F31 WeakPolarHBondContact O-CB 3.42Å; L27-F31 PolarHBondContact O-N 2.95Å
28	L	79.8	Confident	70.2	Confident	98 Å²	98	92.2 Å²	92.2	51%	0.513	48%	0.48	S	S	.	.	H	α-helix	trans	-67.4	-42.2	178.4	-151.7	148.3	0	0	0	111.3	L24 L25 I26 F31 I32	L24-L28 WeakPolarHBondContact O-CB 3.42Å; L24-L28 PolarHBondContact O-N 2.87Å; L25-L28 PolarHBondContact O-N 3.39Å; I26-L28 VanDerWaalsContact C-N 3.28Å; I26-L28 PolarHBondContact O-N 3.48Å; L28-F31 PolarHBondContact O-N 2.91Å; L28-I32 HydrophobicContact CD2-CD1 3.65Å; L28-I32 HydrophobicContact CD2-CG1 4.33Å; L28-I32 WeakPolarHBondContact O-CG1 3.4Å; L28-I32 PolarHBondContact O-N 2.89Å
29	L	79.2	Confident	70.4	Confident	94 Å²	94	95 Å²	95	49%	0.492	50%	0.495	S	S	.	.	H	α-helix	trans	-61.4	-44	172	-83.1	159.9	0	0	0	112.2	L25 I26 F31 I32 L33	L25-L29 HydrophobicContact CG-CD1 4.28Å; L25-L29 PolarHBondContact O-N 3.19Å; I26-L29 PolarHBondContact O-N 2.93Å; L29-F31 VanDerWaalsContact C-N 3.31Å; L29-F31 PolarHBondContact O-N 3.33Å; L29-I32 PolarHBondContact O-N 3Å; L29-L33 WeakPolarHBondContact O-CB 3.25Å; L29-L33 WeakPolarHBondContact O-CG 3.31Å; L29-L33 PolarHBondContact O-N 3.46Å
30	K	75	Confident	70	Confident	130 Å²	130	95.1 Å²	95.1	57%	0.565	49%	0.49	S	S	*	.	H	α-helix	trans	-61.3	-40.4	174.8	-80.2	-171.8	173.8	-173.3	0	111.9	I26 L27 L33 F34	I26-K30 HydrophobicContact CG2-CD 4.42Å; I26-K30 HydrophobicContact CG2-CG 4.43Å; I26-K30 WeakPolarHBondContact O-CB 3.26Å; I26-K30 WeakPolarHBondContact O-CG 3.4Å; I26-K30 PolarHBondContact O-N 3.29Å; L27-K30 PolarHBondContact O-N 3.09Å; K30-L33 PolarHBondContact O-N 2.97Å; K30-F34 WeakPolarHBondContact O-CB 3.37Å; K30-F34 PolarHBondContact O-N 2.9Å
31	F	75.3	Confident	69.6	Low	128 Å²	128	95.1 Å²	95.1	56%	0.561	48%	0.481	S	S	*	.	H	α-helix	trans	-64.7	-44.1	177.7	-174.1	-98.5	0	0	0	111.6	L27 L28 L29 F34 Q35	L27-F31 WeakPolarHBondContact O-CB 3.42Å; L27-F31 PolarHBondContact O-N 2.95Å; L28-F31 PolarHBondContact O-N 2.91Å; L29-F31 VanDerWaalsContact C-N 3.31Å; L29-F31 PolarHBondContact O-N 3.33Å; F31-F34 PolarHBondContact O-N 2.87Å; F31-Q35 HydrophobicContact CD1-CG 4.17Å; F31-Q35 HydrophobicContact CE1-CG 3.83Å; F31-Q35 HydrophobicContact CZ-CG 4.06Å; F31-Q35 VanDerWaalsContact O-CG 3.32Å; F31-Q35 WeakPolarHBondContact O-CG 3.34Å; F31-Q35 PolarHBondContact O-N 3.47Å
32	I	74.8	Confident	69.3	Low	94 Å²	94	92 Å²	92	48%	0.482	47%	0.467	S	S	.	.	H	α-helix	trans	-61	-46.1	175.3	-67.3	166.3	0	0	0	110.7	L28 L29 F34 Q35 S36	L28-I32 HydrophobicContact CD2-CD1 3.65Å; L28-I32 HydrophobicContact CD2-CG1 4.33Å; L28-I32 WeakPolarHBondContact O-CG1 3.4Å; L28-I32 PolarHBondContact O-N 2.89Å; L29-I32 PolarHBondContact O-N 3Å; I32-F34 VanDerWaalsContact C-N 3.32Å; I32-F34 PolarHBondContact O-N 2.93Å; I32-Q35 PolarHBondContact O-N 3.32Å; I32-S36 PolarHBondContact O-N 3.38Å; I32-S36 PolarHBondContact O-OG 3.11Å
33	L	72.5	Confident	68.6	Low	105 Å²	105	91.5 Å²	91.5	55%	0.55	47%	0.466	S	S	.	.	H	α-helix	trans	-64.2	-35.9	178.6	-72.6	170.5	0	0	0	112.5	L29 K30 S36 N37	L29-L33 WeakPolarHBondContact O-CB 3.25Å; L29-L33 WeakPolarHBondContact O-CG 3.31Å; L29-L33 PolarHBondContact O-N 3.46Å; K30-L33 PolarHBondContact O-N 2.97Å; L33-S36 WeakPolarHBondContact CA-OG 3.31Å; L33-S36 PolarHBondContact O-OG 3.35Å; L33-N37 WeakPolarHBondContact O-CB 3.32Å; L33-N37 VanDerWaalsContact O-CG 3.24Å; L33-N37 PolarHBondContact O-N 3.17Å; L33-N37 PolarHBondContact O-OD1 3.35Å
34	F	72.6	Confident	67.7	Low	143 Å²	143	92.2 Å²	92.2	63%	0.627	47%	0.47	S	S	*	.	H	α-helix	trans	-68.4	-43.9	175.4	-175	-97.4	0	0	0	111.6	K30 F31 I32 N37 S38	K30-F34 WeakPolarHBondContact O-CB 3.37Å; K30-F34 PolarHBondContact O-N 2.9Å; F31-F34 PolarHBondContact O-N 2.87Å; I32-F34 VanDerWaalsContact C-N 3.32Å; I32-F34 PolarHBondContact O-N 2.93Å; F34-N37 PolarHBondContact O-N 3.5Å; F34-S38 PolarHBondContact O-N 2.85Å
35	Q	70.7	Confident	66.7	Low	83 Å²	83	93 Å²	93	39%	0.388	47%	0.471	S	S	.	.	H	α-helix	trans	-62.4	-42.5	175.1	-71.5	-69.1	-13.5	0	0	111.6	F31 I32 N37 S38 I39	F31-Q35 HydrophobicContact CD1-CG 4.17Å; F31-Q35 HydrophobicContact CE1-CG 3.83Å; F31-Q35 HydrophobicContact CZ-CG 4.06Å; F31-Q35 VanDerWaalsContact O-CG 3.32Å; F31-Q35 WeakPolarHBondContact O-CG 3.34Å; F31-Q35 PolarHBondContact O-N 3.47Å; I32-Q35 PolarHBondContact O-N 3.32Å; Q35-N37 VanDerWaalsContact C-N 3.34Å; Q35-N37 PolarHBondContact O-N 2.88Å; Q35-S38 PolarHBondContact O-N 2.84Å; Q35-I39 VanDerWaalsContact O-CG1 3.25Å; Q35-I39 WeakPolarHBondContact O-CG1 3.09Å; Q35-I39 PolarHBondContact O-N 3.47Å
36	S	64.1	Low	65.6	Low	34 Å²	34	93.7 Å²	93.7	24%	0.238	48%	0.475	C	S	.	.	H	α-helix	trans	-62.4	-42.5	176.1	58.6	0	0	0	0	111.5	I32 L33 S38 I39 F40	I32-S36 PolarHBondContact O-N 3.38Å; I32-S36 PolarHBondContact O-OG 3.11Å; L33-S36 WeakPolarHBondContact CA-OG 3.31Å; L33-S36 PolarHBondContact O-OG 3.35Å; S36-S38 VanDerWaalsContact C-N 3.34Å; S36-S38 PolarHBondContact O-N 3.46Å; S36-I39 PolarHBondContact O-N 2.93Å; S36-F40 WeakPolarHBondContact O-CD2 3.27Å; S36-F40 PolarHBondContact O-N 3.31Å
37	N	62.2	Low	64.2	Low	94 Å²	94	97.5 Å²	97.5	50%	0.503	50%	0.496	S	S	.	.	H	α-helix	trans	-64.3	-39.3	177.5	-72.3	-6.2	0	0	0	111.9	L33 F34 Q35 I39 F40 I41	L33-N37 WeakPolarHBondContact O-CB 3.32Å; L33-N37 VanDerWaalsContact O-CG 3.24Å; L33-N37 PolarHBondContact O-N 3.17Å; L33-N37 PolarHBondContact O-OD1 3.35Å; F34-N37 PolarHBondContact O-N 3.5Å; Q35-N37 VanDerWaalsContact C-N 3.34Å; Q35-N37 PolarHBondContact O-N 2.88Å; N37-I39 VanDerWaalsContact C-N 3.34Å; N37-F40 PolarHBondContact O-N 2.91Å; N37-I41 VanDerWaalsContact O-CG1 3.26Å; N37-I41 WeakPolarHBondContact O-CG1 3.35Å; N37-I41 PolarHBondContact O-N 3.38Å
38	S	58.2	Low	63	Low	46 Å²	46	98.9 Å²	98.9	32%	0.322	50%	0.503	S	S	.	.	H	α-helix	trans	-63.7	-39.7	173.7	-178.5	0	0	0	0	112	F34 Q35 S36 N42	F34-S38 PolarHBondContact O-N 2.85Å; Q35-S38 PolarHBondContact O-N 2.84Å; S36-S38 VanDerWaalsContact C-N 3.34Å; S36-S38 PolarHBondContact O-N 3.46Å; S38-N42 WeakPolarHBondContact O-CB 3.35Å; S38-N42 PolarHBondContact O-N 3.45Å; S38-N42 PolarHBondContact O-ND2 3.05Å
39	I	56.6	Low	61.6	Low	107 Å²	107	101.4 Å²	101.4	55%	0.549	52%	0.517	S	S	.	.	H	α-helix	trans	-64.9	-42	175.7	-67.1	163.3	0	0	0	110.6	Q35 S36 N37 N42 A43	Q35-I39 VanDerWaalsContact O-CG1 3.25Å; Q35-I39 WeakPolarHBondContact O-CG1 3.09Å; Q35-I39 PolarHBondContact O-N 3.47Å; S36-I39 PolarHBondContact O-N 2.93Å; N37-I39 VanDerWaalsContact C-N 3.34Å; I39-N42 PolarHBondContact O-N 3.3Å; I39-A43 VanDerWaalsContact O-CB 3.31Å; I39-A43 WeakPolarHBondContact O-CB 3.49Å; I39-A43 PolarHBondContact O-N 3.3Å
40	F	51.9	Low	60.1	Low	131 Å²	131	100 Å²	100	58%	0.575	51%	0.512	S	S	*	.	H	α-helix	trans	-66.2	-43.7	177.6	-81.7	-67.6	0	0	0	112.3	S36 N37 N42 A43 D44	S36-F40 WeakPolarHBondContact O-CD2 3.27Å; S36-F40 PolarHBondContact O-N 3.31Å; N37-F40 PolarHBondContact O-N 2.91Å; F40-N42 VanDerWaalsContact C-N 3.34Å; F40-N42 PolarHBondContact O-N 3.3Å; F40-A43 PolarHBondContact O-N 2.86Å; F40-A43 VanDerWaalsContact O-N 3.17Å; F40-D44 PolarHBondContact O-N 2.88Å
41	I	54.1	Low	58.6	Low	98 Å²	98	100.4 Å²	100.4	50%	0.503	52%	0.521	S	S	.	.	H	α-helix	trans	-60.5	-45.4	176.2	-67.6	163.7	0	0	0	110.5	N37 A43 D44 E45	N37-I41 VanDerWaalsContact O-CG1 3.26Å; N37-I41 WeakPolarHBondContact O-CG1 3.35Å; N37-I41 PolarHBondContact O-N 3.38Å; I41-A43 VanDerWaalsContact C-N 3.3Å; I41-A43 PolarHBondContact O-N 2.88Å; I41-D44 PolarHBondContact O-N 3.49Å; I41-E45 PolarHBondContact O-N 2.87Å
42	N	56.6	Low	57	Low	81 Å²	81	101.1 Å²	101.1	43%	0.433	53%	0.53	S	S	.	.	H	α-helix	trans	-65.5	-34	177.5	-68.6	-11.8	0	0	0	112.3	S38 I39 F40 L46	S38-N42 WeakPolarHBondContact O-CB 3.35Å; S38-N42 PolarHBondContact O-N 3.45Å; S38-N42 PolarHBondContact O-ND2 3.05Å; I39-N42 PolarHBondContact O-N 3.3Å; F40-N42 VanDerWaalsContact C-N 3.34Å; F40-N42 PolarHBondContact O-N 3.3Å; N42-L46 WeakPolarHBondContact O-CB 3.49Å; N42-L46 PolarHBondContact O-N 3.02Å
43	A	55.2	Low	55.4	Low	36 Å²	36	103.7 Å²	103.7	30%	0.298	55%	0.545	S	S	.	.	H	α-helix	trans	-70.1	-39.8	176.5	0	0	0	0	0	111.9	I39 F40 I41 L46 N47	I39-A43 VanDerWaalsContact O-CB 3.31Å; I39-A43 WeakPolarHBondContact O-CB 3.49Å; I39-A43 PolarHBondContact O-N 3.3Å; F40-A43 PolarHBondContact O-N 2.86Å; F40-A43 VanDerWaalsContact O-N 3.17Å; I41-A43 VanDerWaalsContact C-N 3.3Å; I41-A43 PolarHBondContact O-N 2.88Å; A43-L46 PolarHBondContact O-N 2.85Å; A43-N47 VanDerWaalsContact O-CB 3.32Å; A43-N47 WeakPolarHBondContact O-CB 3.47Å; A43-N47 PolarHBondContact O-N 3.02Å
44	D	56	Low	54.2	Low	82 Å²	82	105.1 Å²	105.1	44%	0.439	55%	0.553	S	S	.	*	H	α-helix	trans	-68.2	-40.8	175.9	-75.4	-17.2	0	0	0	111.4	F40 I41 N47 L48	F40-D44 PolarHBondContact O-N 2.88Å; I41-D44 PolarHBondContact O-N 3.49Å; D44-N47 PolarHBondContact O-N 3.44Å; D44-L48 PolarHBondContact O-N 3.23Å
45	E	53.4	Low	53	Low	125 Å²	125	103.6 Å²	103.6	58%	0.584	56%	0.559	S	S	*	*	H	α-helix	trans	-62.8	-40.1	173	-79	-174	176.3	0	0	112.1	I41 N47 N49	I41-E45 PolarHBondContact O-N 2.87Å; E45-N47 VanDerWaalsContact C-N 3.35Å; E45-N49 PolarHBondContact O-N 2.87Å
46	L	53.3	Low	51.7	Low	125 Å²	125	105.2 Å²	105.2	65%	0.654	57%	0.571	S	S	*	*	H	α-helix	trans	-64	-40	172.9	-98.9	154.9	0	0	0	111.9	N42 A43 N49 T50	N42-L46 WeakPolarHBondContact O-CB 3.49Å; N42-L46 PolarHBondContact O-N 3.02Å; A43-L46 PolarHBondContact O-N 2.85Å; L46-N49 PolarHBondContact O-N 2.91Å; L46-T50 PolarHBondContact O-OG1 3.36Å; L46-T50 VanDerWaalsContact O-OG1 3.08Å
47	N	48.9	Very low	50.9	Low	110 Å²	110	110.3 Å²	110.3	59%	0.588	59%	0.594	S	S	*	*	H	α-helix	trans	-71.1	-34.7	-177	-162.3	23.1	0	0	0	112.4	A43 D44 E45 N49 T50	A43-N47 VanDerWaalsContact O-CB 3.32Å; A43-N47 WeakPolarHBondContact O-CB 3.47Å; A43-N47 PolarHBondContact O-N 3.02Å; D44-N47 PolarHBondContact O-N 3.44Å; E45-N47 VanDerWaalsContact C-N 3.35Å; N47-N49 VanDerWaalsContact C-N 3.32Å; N47-N49 PolarHBondContact O-N 3.46Å; N47-T50 VanDerWaalsContact CA-OG1 3.32Å; N47-T50 WeakPolarHBondContact CA-OG1 3.45Å; N47-T50 PolarHBondContact O-N 3.42Å; N47-T50 PolarHBondContact O-OG1 2.86Å
48	L	53.2	Low	50.4	Low	132 Å²	132	108 Å²	108	69%	0.691	58%	0.584	S	S	*	*	H	α-helix	trans	-67.4	-29.3	176.6	-90.7	154.6	0	0	0	113.1	D44 T50	D44-L48 PolarHBondContact O-N 3.23Å; L48-T50 VanDerWaalsContact C-N 3.34Å
49	N	49	Very low	50.6	Low	151 Å²	151	110 Å²	110	81%	0.807	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.8	-7.6	176.4	-92.4	-12.5	0	0	0	114.2	E45 L46 N47	E45-N49 PolarHBondContact O-N 2.87Å; L46-N49 PolarHBondContact O-N 2.91Å; N47-N49 VanDerWaalsContact C-N 3.32Å; N47-N49 PolarHBondContact O-N 3.46Å
50	T	48.4	Very low	51	Low	66 Å²	66	110.6 Å²	110.6	41%	0.405	60%	0.595	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92.7	11.3	-177.5	25.3	0	0	0	0	115.5	L46 N47 L48 N52	L46-T50 PolarHBondContact O-OG1 3.36Å; L46-T50 VanDerWaalsContact O-OG1 3.08Å; N47-T50 VanDerWaalsContact CA-OG1 3.32Å; N47-T50 WeakPolarHBondContact CA-OG1 3.45Å; N47-T50 PolarHBondContact O-N 3.42Å; N47-T50 PolarHBondContact O-OG1 2.86Å; L48-T50 VanDerWaalsContact C-N 3.34Å; T50-N52 PolarHBondContact O-N 3.48Å
51	N	43.4	Very low	52	Low	138 Å²	138	111.7 Å²	111.7	74%	0.738	60%	0.602	S	S	*	*			trans	-63.4	-1	176.2	-84.5	-15.1	0	0	0	114.9
52	N	42.9	Very low	52.8	Low	143 Å²	143	112.6 Å²	112.6	77%	0.765	60%	0.604	S	S	*	*	S	Bend	trans	-122.6	97.8	172.4	-67.3	-28	0	0	0	111	T50	T50-N52 PolarHBondContact O-N 3.48Å
53	N	41.2	Very low	53.5	Low	148 Å²	148	115.2 Å²	115.2	79%	0.791	61%	0.608	S	S	*	*	S	Bend	trans	60.9	56.3	150.8	-64.8	-14.8	0	0	0	118.9
54	L	45.8	Very low	54.4	Low	135 Å²	135	116.3 Å²	116.3	71%	0.707	62%	0.617	S	S	*	*			trans	-123.7	55.9	157.9	-145.1	76.6	0	0	0	111.5	N56	L54-N56 PolarHBondContact O-N 3.45Å
55	S	48.9	Very low	55.3	Low	110 Å²	110	119.2 Å²	119.2	77%	0.769	63%	0.628	S	S	*	*			trans	-70.8	14.7	171.5	50.9	0	0	0	0	113.6
56	N	43.4	Very low	56.5	Low	117 Å²	117	116.3 Å²	116.3	63%	0.626	63%	0.625	S	S	*	*			trans	-145.7	117.5	-175.8	-92.4	-23.4	0	0	0	111.6	L54	L54-N56 PolarHBondContact O-N 3.45Å
57	I	46	Very low	57.7	Low	142 Å²	142	115.2 Å²	115.2	73%	0.728	62%	0.62	S	S	*	*	S	Bend	trans	90.1	148.9	148.6	-47.6	148.5	0	0	0	114.6
58	P	52.2	Low	59	Low	45 Å²	45	112.8 Å²	112.8	29%	0.292	62%	0.615	S	S	.	*				-124.3	59.4	-59.9	36.8	-14.7	0	0	0	108.4	D60 Q61 Q62	P58-D60 VanDerWaalsContact C-N 3.32Å; P58-D60 PolarHBondContact O-N 3.03Å; P58-Q61 HydrophobicContact CB-CB 4.49Å; P58-Q61 PolarHBondContact O-N 3.38Å; P58-Q62 HydrophobicContact CG-CG 4.15Å; P58-Q62 PolarHBondContact O-N 3.01Å; P58-Q62 VanDerWaalsContact O-N 3.12Å
59	N	61.6	Low	60.2	Low	88 Å²	88	113.5 Å²	113.5	47%	0.471	61%	0.613	S	S	.	*	H	α-helix	trans	-60.6	-39.6	-165.3	-161.7	-1.1	0	0	0	112.4	Q62 R63	N59-Q62 PolarHBondContact O-N 3.14Å; N59-R63 PolarHBondContact ND2-NH2 3.1Å; N59-R63 VanDerWaalsContact O-CB 3.3Å; N59-R63 WeakPolarHBondContact O-CB 3.3Å; N59-R63 WeakPolarHBondContact O-CD 3.45Å; N59-R63 WeakPolarHBondContact O-CG 3.24Å; N59-R63 PolarHBondContact O-N 2.88Å; N59-R63 PolarHBondContact OD1-NE 3.33Å
60	D	66.6	Low	61.6	Low	119 Å²	119	110.6 Å²	110.6	64%	0.636	60%	0.596	S	S	*	*	H	α-helix	trans	-72.3	-35.5	-178.2	-67.1	-24.6	0	0	0	113.3	P58 R63 A64	P58-D60 VanDerWaalsContact C-N 3.32Å; P58-D60 PolarHBondContact O-N 3.03Å; D60-R63 PolarHBondContact O-N 2.92Å; D60-R63 IonicContact OD1-NH1 3.91Å; D60-A64 VanDerWaalsContact O-CB 3.27Å; D60-A64 WeakPolarHBondContact O-CB 3.49Å; D60-A64 PolarHBondContact O-N 3.41Å
61	Q	71.5	Confident	62.9	Low	154 Å²	154	111.6 Å²	111.6	72%	0.72	60%	0.598	S	S	*	*	H	α-helix	trans	-67.7	-42.2	175.1	-73.2	-177.3	-20.7	0	0	111.2	P58 A64 Q65	P58-Q61 HydrophobicContact CB-CB 4.49Å; P58-Q61 PolarHBondContact O-N 3.38Å; Q61-A64 PolarHBondContact O-N 3.33Å; Q61-Q65 WeakPolarHBondContact O-CB 3.39Å; Q61-Q65 PolarHBondContact O-N 2.8Å
62	Q	71.9	Confident	64.3	Low	118 Å²	118	107.8 Å²	107.8	55%	0.551	58%	0.582	S	S	*	*	H	α-helix	trans	-65.6	-40.8	175.1	-73.6	-179.8	-6.7	0	0	111.8	P58 N59 Q65 A66	P58-Q62 HydrophobicContact CG-CG 4.15Å; P58-Q62 PolarHBondContact O-N 3.01Å; P58-Q62 VanDerWaalsContact O-N 3.12Å; N59-Q62 PolarHBondContact O-N 3.14Å; Q62-Q65 PolarHBondContact O-N 3.26Å; Q62-A66 WeakPolarHBondContact O-CB 3.28Å; Q62-A66 PolarHBondContact O-N 3.35Å
63	R	70	Confident	65.9	Low	135 Å²	135	106.3 Å²	106.3	51%	0.509	57%	0.573	S	S	.	*	H	α-helix	trans	-60.5	-46.4	173.6	-76	167.7	176.6	-166.2	-7.5	111.6	N59 D60 Q65 A66 L67	N59-R63 PolarHBondContact ND2-NH2 3.1Å; N59-R63 VanDerWaalsContact O-CB 3.3Å; N59-R63 WeakPolarHBondContact O-CB 3.3Å; N59-R63 WeakPolarHBondContact O-CD 3.45Å; N59-R63 WeakPolarHBondContact O-CG 3.24Å; N59-R63 PolarHBondContact O-N 2.88Å; N59-R63 PolarHBondContact OD1-NE 3.33Å; D60-R63 PolarHBondContact O-N 2.92Å; D60-R63 IonicContact OD1-NH1 3.91Å; R63-Q65 VanDerWaalsContact C-N 3.34Å; R63-Q65 PolarHBondContact O-N 2.86Å; R63-A66 PolarHBondContact O-N 2.96Å; R63-L67 VanDerWaalsContact O-CB 3.31Å; R63-L67 WeakPolarHBondContact O-CB 3.47Å; R63-L67 PolarHBondContact O-N 2.87Å
64	A	74.7	Confident	67.4	Low	59 Å²	59	105.2 Å²	105.2	49%	0.488	56%	0.562	S	S	.	*	H	α-helix	trans	-62.7	-40.4	177.2	0	0	0	0	0	111.7	D60 Q61 L67 A68	D60-A64 VanDerWaalsContact O-CB 3.27Å; D60-A64 WeakPolarHBondContact O-CB 3.49Å; D60-A64 PolarHBondContact O-N 3.41Å; Q61-A64 PolarHBondContact O-N 3.33Å; A64-L67 PolarHBondContact O-N 3.34Å; A64-A68 VanDerWaalsContact O-CB 3.3Å; A64-A68 WeakPolarHBondContact O-CB 3.46Å; A64-A68 PolarHBondContact O-N 3.45Å
65	Q	74.9	Confident	68.7	Low	144 Å²	144	105.4 Å²	105.4	67%	0.673	55%	0.554	S	S	*	*	H	α-helix	trans	-68.7	-41.7	177.2	-168.3	178.4	13.3	0	0	112.3	Q61 Q62 R63 A68 K69	Q61-Q65 WeakPolarHBondContact O-CB 3.39Å; Q61-Q65 PolarHBondContact O-N 2.8Å; Q62-Q65 PolarHBondContact O-N 3.26Å; R63-Q65 VanDerWaalsContact C-N 3.34Å; R63-Q65 PolarHBondContact O-N 2.86Å; Q65-A68 PolarHBondContact O-N 3.24Å; Q65-K69 WeakPolarHBondContact O-CB 3.34Å; Q65-K69 PolarHBondContact O-N 3.01Å
66	A	77.7	Confident	70	Confident	63 Å²	63	104.9 Å²	104.9	52%	0.521	55%	0.546	S	S	.	.	H	α-helix	trans	-63.1	-43.7	175.1	0	0	0	0	0	111.3	Q62 R63 K69 L70	Q62-A66 WeakPolarHBondContact O-CB 3.28Å; Q62-A66 PolarHBondContact O-N 3.35Å; R63-A66 PolarHBondContact O-N 2.96Å; A66-K69 PolarHBondContact O-N 2.86Å; A66-L70 WeakPolarHBondContact O-CB 3.31Å; A66-L70 PolarHBondContact O-N 3.43Å
67	L	79.3	Confident	71.7	Confident	103 Å²	103	101.6 Å²	101.6	54%	0.539	53%	0.532	S	S	.	.	H	α-helix	trans	-61.3	-46	174	-173.8	81.5	0	0	0	111.2	R63 A64 K69 L70 M71	R63-L67 VanDerWaalsContact O-CB 3.31Å; R63-L67 WeakPolarHBondContact O-CB 3.47Å; R63-L67 PolarHBondContact O-N 2.87Å; A64-L67 PolarHBondContact O-N 3.34Å; L67-K69 VanDerWaalsContact C-N 3.31Å; L67-K69 PolarHBondContact O-N 2.94Å; L67-L70 PolarHBondContact O-N 2.89Å; L67-M71 HydrophobicContact CG-CG 4.48Å; L67-M71 WeakPolarHBondContact O-CB 3.41Å; L67-M71 VanDerWaalsContact O-CG 3.31Å; L67-M71 WeakPolarHBondContact O-CG 3.42Å; L67-M71 PolarHBondContact O-N 3.15Å
68	A	76.9	Confident	73.4	Confident	59 Å²	59	101.3 Å²	101.3	49%	0.488	53%	0.532	S	S	.	.	H	α-helix	trans	-62	-39.7	178.6	0	0	0	0	0	111.9	A64 Q65 M71 S72	A64-A68 VanDerWaalsContact O-CB 3.3Å; A64-A68 WeakPolarHBondContact O-CB 3.46Å; A64-A68 PolarHBondContact O-N 3.45Å; Q65-A68 PolarHBondContact O-N 3.24Å; A68-M71 PolarHBondContact O-N 3.27Å; A68-S72 WeakPolarHBondContact O-CB 3.47Å; A68-S72 PolarHBondContact O-N 3.41Å; A68-S72 PolarHBondContact O-OG 3.23Å
69	K	77.7	Confident	74.5	Confident	147 Å²	147	102.6 Å²	102.6	64%	0.639	55%	0.547	S	S	*	.	H	α-helix	trans	-68.7	-38.5	176.3	-164.6	175.1	-174.6	-179.2	0	112.2	Q65 A66 L67 S72 L73	Q65-K69 WeakPolarHBondContact O-CB 3.34Å; Q65-K69 PolarHBondContact O-N 3.01Å; A66-K69 PolarHBondContact O-N 2.86Å; L67-K69 VanDerWaalsContact C-N 3.31Å; L67-K69 PolarHBondContact O-N 2.94Å; K69-S72 PolarHBondContact O-OG 2.84Å; K69-L73 HydrophobicContact CG-CD1 4.48Å; K69-L73 WeakPolarHBondContact O-CB 3.42Å; K69-L73 WeakPolarHBondContact O-CD1 3.27Å; K69-L73 WeakPolarHBondContact O-CG 3.47Å; K69-L73 PolarHBondContact O-N 3.49Å
70	L	78.1	Confident	75.3	Confident	89 Å²	89	101 Å²	101	47%	0.466	54%	0.536	S	S	.	.	H	α-helix	trans	-65.8	-47.4	174.2	-176.3	148	0	0	0	110.3	A66 L67 S72 L73 F74	A66-L70 WeakPolarHBondContact O-CB 3.31Å; A66-L70 PolarHBondContact O-N 3.43Å; L67-L70 PolarHBondContact O-N 2.89Å; L70-S72 VanDerWaalsContact C-N 3.34Å; L70-S72 PolarHBondContact O-N 3.19Å; L70-L73 WeakPolarHBondContact O-CB 3.42Å; L70-L73 PolarHBondContact O-N 3.19Å; L70-F74 HydrophobicContact CD2-CD2 3.47Å; L70-F74 VanDerWaalsContact CD2-CD2 3.47Å; L70-F74 HydrophobicContact CD2-CE2 3.46Å; L70-F74 VanDerWaalsContact CD2-CE2 3.46Å; L70-F74 HydrophobicContact CG-CD2 3.98Å; L70-F74 HydrophobicContact CG-CE2 3.88Å; L70-F74 VanDerWaalsContact O-CD2 3.28Å; L70-F74 WeakPolarHBondContact O-CD2 3.33Å; L70-F74 PolarHBondContact O-N 3.4Å
71	M	76.4	Confident	75.9	Confident	88 Å²	88	99.1 Å²	99.1	43%	0.433	53%	0.526	S	S	.	.	H	α-helix	trans	-57.4	-46.2	174.8	-74.4	-63.8	-160.3	0	0	111.4	L67 A68 L73 F74 Y75	L67-M71 HydrophobicContact CG-CG 4.48Å; L67-M71 WeakPolarHBondContact O-CB 3.41Å; L67-M71 VanDerWaalsContact O-CG 3.31Å; L67-M71 WeakPolarHBondContact O-CG 3.42Å; L67-M71 PolarHBondContact O-N 3.15Å; A68-M71 PolarHBondContact O-N 3.27Å; M71-L73 VanDerWaalsContact C-N 3.35Å; M71-L73 PolarHBondContact O-N 3.4Å; M71-F74 WeakPolarHBondContact O-CB 2.98Å; M71-F74 PolarHBondContact O-N 3.44Å; M71-F74 VanDerWaalsContact O-N 3.14Å; M71-Y75 HydrophobicContact CB-CD2 4.3Å; M71-Y75 HydrophobicContact CB-CE2 4.25Å; M71-Y75 WeakPolarHBondContact O-CD2 3.35Å; M71-Y75 PolarHBondContact O-N 3.3Å; M71-Y75 HydrophobicContact SD-CE2 4.42Å
72	S	72.3	Confident	76.3	Confident	58 Å²	58	98.4 Å²	98.4	41%	0.406	52%	0.52	S	S	.	.	H	α-helix	trans	-61.5	-43.3	178.3	70.6	0	0	0	0	111.8	A68 K69 L70 F74 Y75 T76	A68-S72 WeakPolarHBondContact O-CB 3.47Å; A68-S72 PolarHBondContact O-N 3.41Å; A68-S72 PolarHBondContact O-OG 3.23Å; K69-S72 PolarHBondContact O-OG 2.84Å; L70-S72 VanDerWaalsContact C-N 3.34Å; L70-S72 PolarHBondContact O-N 3.19Å; S72-F74 VanDerWaalsContact C-N 3.32Å; S72-F74 PolarHBondContact O-N 3.46Å; S72-Y75 PolarHBondContact O-N 2.96Å; S72-T76 WeakPolarHBondContact O-CG2 3.46Å; S72-T76 PolarHBondContact O-N 2.97Å; S72-T76 PolarHBondContact O-OG1 2.95Å
73	L	75.8	Confident	76.7	Confident	111 Å²	111	99.2 Å²	99.2	58%	0.581	52%	0.519	S	S	*	.	H	α-helix	trans	-56.8	-43	172.6	-86.7	154.5	0	0	0	112.3	K69 L70 M71 T76 S77	K69-L73 HydrophobicContact CG-CD1 4.48Å; K69-L73 WeakPolarHBondContact O-CB 3.42Å; K69-L73 WeakPolarHBondContact O-CD1 3.27Å; K69-L73 WeakPolarHBondContact O-CG 3.47Å; K69-L73 PolarHBondContact O-N 3.49Å; L70-L73 WeakPolarHBondContact O-CB 3.42Å; L70-L73 PolarHBondContact O-N 3.19Å; M71-L73 VanDerWaalsContact C-N 3.35Å; M71-L73 PolarHBondContact O-N 3.4Å; L73-T76 PolarHBondContact O-OG1 3.24Å; L73-S77 WeakPolarHBondContact O-CB 3.47Å; L73-S77 PolarHBondContact O-N 2.92Å; L73-S77 VanDerWaalsContact O-N 3.1Å
74	F	74.6	Confident	77.1	Confident	126 Å²	126	96.1 Å²	96.1	55%	0.553	51%	0.511	S	S	*	.	H	α-helix	trans	-64.8	-44.6	175.3	-90	-80.8	0	0	0	111.9	L70 M71 S72 T76 S77 F80	L70-F74 HydrophobicContact CD2-CD2 3.47Å; L70-F74 VanDerWaalsContact CD2-CD2 3.47Å; L70-F74 HydrophobicContact CD2-CE2 3.46Å; L70-F74 VanDerWaalsContact CD2-CE2 3.46Å; L70-F74 HydrophobicContact CG-CD2 3.98Å; L70-F74 HydrophobicContact CG-CE2 3.88Å; L70-F74 VanDerWaalsContact O-CD2 3.28Å; L70-F74 WeakPolarHBondContact O-CD2 3.33Å; L70-F74 PolarHBondContact O-N 3.4Å; M71-F74 WeakPolarHBondContact O-CB 2.98Å; M71-F74 PolarHBondContact O-N 3.44Å; M71-F74 VanDerWaalsContact O-N 3.14Å; S72-F74 VanDerWaalsContact C-N 3.32Å; S72-F74 PolarHBondContact O-N 3.46Å; F74-T76 PolarHBondContact O-N 3.13Å; F74-S77 VanDerWaalsContact O-CB 3.3Å; F74-S77 WeakPolarHBondContact O-CB 3.3Å; F74-S77 PolarHBondContact O-N 2.84Å; F74-F80 WeakPolarHBondContact O-CB 3.39Å
75	Y	71.5	Confident	77.2	Confident	139 Å²	139	99.7 Å²	99.7	55%	0.545	52%	0.518	S	S	.	.	H	α-helix	trans	-68.3	-31.9	179	-78.2	-66.5	0	0	0	113.1	M71 S72 S77 F80 N81	M71-Y75 HydrophobicContact CB-CD2 4.3Å; M71-Y75 HydrophobicContact CB-CE2 4.25Å; M71-Y75 WeakPolarHBondContact O-CD2 3.35Å; M71-Y75 PolarHBondContact O-N 3.3Å; M71-Y75 HydrophobicContact SD-CE2 4.42Å; S72-Y75 PolarHBondContact O-N 2.96Å; Y75-S77 VanDerWaalsContact C-N 3.32Å; Y75-F80 HydrophobicContact CD1-CD1 4.07Å; Y75-F80 AromaticContact CD1-CE1 3.38Å; Y75-F80 HydrophobicContact CD1-CE1 3.38Å; Y75-F80 AromaticContact CD1-CZ 3.77Å; Y75-F80 HydrophobicContact CD1-CZ 3.77Å; Y75-F80 AromaticContact CE1-CE1 3.74Å; Y75-F80 HydrophobicContact CE1-CE1 3.74Å; Y75-F80 AromaticContact CE1-CZ 3.64Å; Y75-F80 HydrophobicContact CE1-CZ 3.64Å; Y75-F80 HydrophobicContact CG-CE1 4.47Å; Y75-N81 PolarHBondContact O-OD1 3.44Å
76	T	76.6	Confident	77.4	Confident	98 Å²	98	97.5 Å²	97.5	60%	0.601	51%	0.511	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.7	-5.3	175.6	56.8	0	0	0	0	113.3	S72 L73 F74 D78	S72-T76 WeakPolarHBondContact O-CG2 3.46Å; S72-T76 PolarHBondContact O-N 2.97Å; S72-T76 PolarHBondContact O-OG1 2.95Å; L73-T76 PolarHBondContact O-OG1 3.24Å; F74-T76 PolarHBondContact O-N 3.13Å; T76-D78 PolarHBondContact O-N 3.01Å
77	S	80	Confident	77.3	Confident	48 Å²	48	96.5 Å²	96.5	34%	0.336	50%	0.496	S	S	.	.			trans	-70.5	128.5	179.9	-179.7	0	0	0	0	110.8	L73 F74 Y75 A79 F80 N81	L73-S77 WeakPolarHBondContact O-CB 3.47Å; L73-S77 PolarHBondContact O-N 2.92Å; L73-S77 VanDerWaalsContact O-N 3.1Å; F74-S77 VanDerWaalsContact O-CB 3.3Å; F74-S77 WeakPolarHBondContact O-CB 3.3Å; F74-S77 PolarHBondContact O-N 2.84Å; Y75-S77 VanDerWaalsContact C-N 3.32Å; S77-A79 PolarHBondContact O-N 2.96Å; S77-A79 VanDerWaalsContact O-N 3.13Å; S77-F80 WeakPolarHBondContact O-CB 3.11Å; S77-F80 PolarHBondContact O-N 2.85Å; S77-N81 PolarHBondContact O-N 3.23Å
78	D	80.5	Confident	77	Confident	136 Å²	136	94.4 Å²	94.4	73%	0.727	49%	0.486	S	S	*	.	H	α-helix	trans	-54.2	-34	176.3	-66.8	-28.8	0	0	0	112.4	T76 N81 K82	T76-D78 PolarHBondContact O-N 3.01Å; D78-N81 PolarHBondContact O-N 3.33Å; D78-K82 WeakPolarHBondContact O-CB 3.21Å; D78-K82 PolarHBondContact O-N 3.25Å
79	A	76.7	Confident	76.9	Confident	72 Å²	72	93.8 Å²	93.8	60%	0.595	48%	0.48	S	S	*	.	H	α-helix	trans	-64.7	-40.7	176.9	0	0	0	0	0	112	S77 Y83	S77-A79 PolarHBondContact O-N 2.96Å; S77-A79 VanDerWaalsContact O-N 3.13Å; A79-Y83 WeakPolarHBondContact O-CB 3.45Å; A79-Y83 PolarHBondContact O-N 2.94Å
80	F	78.4	Confident	76.7	Confident	56 Å²	56	92.1 Å²	92.1	25%	0.246	47%	0.471	C	S	.	.	H	α-helix	trans	-69.6	-42.9	176.3	-179.1	-96	0	0	0	111.1	F74 Y75 S77 K82 Y83 M84	F74-F80 WeakPolarHBondContact O-CB 3.39Å; Y75-F80 HydrophobicContact CD1-CD1 4.07Å; Y75-F80 AromaticContact CD1-CE1 3.38Å; Y75-F80 HydrophobicContact CD1-CE1 3.38Å; Y75-F80 AromaticContact CD1-CZ 3.77Å; Y75-F80 HydrophobicContact CD1-CZ 3.77Å; Y75-F80 AromaticContact CE1-CE1 3.74Å; Y75-F80 HydrophobicContact CE1-CE1 3.74Å; Y75-F80 AromaticContact CE1-CZ 3.64Å; Y75-F80 HydrophobicContact CE1-CZ 3.64Å; Y75-F80 HydrophobicContact CG-CE1 4.47Å; S77-F80 WeakPolarHBondContact O-CB 3.11Å; S77-F80 PolarHBondContact O-N 2.85Å; F80-K82 PolarHBondContact O-N 3.46Å; F80-Y83 WeakPolarHBondContact O-CB 3.47Å; F80-Y83 PolarHBondContact O-N 2.95Å; F80-M84 HydrophobicContact CD1-CG 3.88Å; F80-M84 HydrophobicContact CD2-CG 4.49Å; F80-M84 HydrophobicContact CE1-CE 4.23Å; F80-M84 HydrophobicContact CE1-CG 3.36Å; F80-M84 HydrophobicContact CE1-SD 4.2Å; F80-M84 HydrophobicContact CE2-CG 4.06Å; F80-M84 HydrophobicContact CE2-SD 4.25Å; F80-M84 HydrophobicContact CG-CG 4.42Å; F80-M84 HydrophobicContact CZ-CE 3.9Å; F80-M84 HydrophobicContact CZ-CG 3.47Å; F80-M84 VanDerWaalsContact CZ-CG 3.47Å; F80-M84 HydrophobicContact CZ-SD 3.72Å; F80-M84 WeakPolarHBondContact O-CB 3.05Å; F80-M84 WeakPolarHBondContact O-CG 3.42Å; F80-M84 PolarHBondContact O-N 3.44Å
81	N	78.9	Confident	76.1	Confident	79 Å²	79	92.6 Å²	92.6	42%	0.422	47%	0.467	S	S	.	.	H	α-helix	trans	-58.7	-47.3	176	-72.8	-29.1	0	0	0	111.5	Y75 S77 D78 Y83 M84 E85	Y75-N81 PolarHBondContact O-OD1 3.44Å; S77-N81 PolarHBondContact O-N 3.23Å; D78-N81 PolarHBondContact O-N 3.33Å; N81-Y83 VanDerWaalsContact C-N 3.33Å; N81-Y83 PolarHBondContact O-N 2.98Å; N81-M84 PolarHBondContact O-N 3.45Å; N81-M84 VanDerWaalsContact O-N 3.16Å; N81-E85 WeakPolarHBondContact O-CB 3.33Å; N81-E85 PolarHBondContact O-N 3.27Å
82	K	80.5	Confident	75.5	Confident	138 Å²	138	95.1 Å²	95.1	60%	0.6	48%	0.48	S	S	*	.	H	α-helix	trans	-64.2	-36.9	176.8	-164.2	173.6	-170.8	175	0	112.5	D78 F80 N86	D78-K82 WeakPolarHBondContact O-CB 3.21Å; D78-K82 PolarHBondContact O-N 3.25Å; F80-K82 PolarHBondContact O-N 3.46Å; K82-N86 WeakPolarHBondContact O-CB 3.42Å; K82-N86 VanDerWaalsContact O-CG 3.23Å; K82-N86 PolarHBondContact O-N 3.01Å; K82-N86 PolarHBondContact O-ND2 3.37Å
83	Y	78.8	Confident	75.1	Confident	136 Å²	136	99.8 Å²	99.8	53%	0.533	50%	0.499	S	S	.	.	H	α-helix	trans	-62.8	-46.4	171.9	173.5	-98.1	0	0	0	111.5	A79 F80 N81 E85 N86 L87	A79-Y83 WeakPolarHBondContact O-CB 3.45Å; A79-Y83 PolarHBondContact O-N 2.94Å; F80-Y83 WeakPolarHBondContact O-CB 3.47Å; F80-Y83 PolarHBondContact O-N 2.95Å; N81-Y83 VanDerWaalsContact C-N 3.33Å; N81-Y83 PolarHBondContact O-N 2.98Å; Y83-E85 VanDerWaalsContact C-N 3.34Å; Y83-E85 PolarHBondContact O-N 3.04Å; Y83-N86 PolarHBondContact O-N 3.35Å; Y83-L87 HydrophobicContact CE1-CD1 3.65Å; Y83-L87 HydrophobicContact CE2-CD1 4.33Å; Y83-L87 WeakPolarHBondContact O-CB 3.4Å; Y83-L87 PolarHBondContact O-N 3.37Å; Y83-L87 VanDerWaalsContact OH-CD1 3.3Å; Y83-L87 WeakPolarHBondContact OH-CD1 3.36Å
84	M	77.9	Confident	74.4	Confident	69 Å²	69	102.4 Å²	102.4	34%	0.34	50%	0.502	S	S	.	.	H	α-helix	trans	-65.8	-36	179.9	-72.4	-63	-96.2	0	0	112.6	F80 N81 D88 R98	F80-M84 HydrophobicContact CD1-CG 3.88Å; F80-M84 HydrophobicContact CD2-CG 4.49Å; F80-M84 HydrophobicContact CE1-CE 4.23Å; F80-M84 HydrophobicContact CE1-CG 3.36Å; F80-M84 HydrophobicContact CE1-SD 4.2Å; F80-M84 HydrophobicContact CE2-CG 4.06Å; F80-M84 HydrophobicContact CE2-SD 4.25Å; F80-M84 HydrophobicContact CG-CG 4.42Å; F80-M84 HydrophobicContact CZ-CE 3.9Å; F80-M84 HydrophobicContact CZ-CG 3.47Å; F80-M84 VanDerWaalsContact CZ-CG 3.47Å; F80-M84 HydrophobicContact CZ-SD 3.72Å; F80-M84 WeakPolarHBondContact O-CB 3.05Å; F80-M84 WeakPolarHBondContact O-CG 3.42Å; F80-M84 PolarHBondContact O-N 3.44Å; N81-M84 PolarHBondContact O-N 3.45Å; N81-M84 VanDerWaalsContact O-N 3.16Å; M84-D88 WeakPolarHBondContact O-CB 3.49Å; M84-D88 PolarHBondContact O-N 3.35Å; M84-R98 PolarHBondContact O-NH2 2.95Å
85	E	77.9	Confident	73.4	Confident	134 Å²	134	99.4 Å²	99.4	63%	0.626	51%	0.506	S	S	*	.	H	α-helix	trans	-66.4	-49.9	173.2	-174.1	-177.3	-178.1	0	0	111.3	N81 Y83 L87 D88 A89	N81-E85 WeakPolarHBondContact O-CB 3.33Å; N81-E85 PolarHBondContact O-N 3.27Å; Y83-E85 VanDerWaalsContact C-N 3.34Å; Y83-E85 PolarHBondContact O-N 3.04Å; E85-L87 VanDerWaalsContact C-N 3.26Å; E85-L87 PolarHBondContact O-N 2.9Å; E85-D88 WeakPolarHBondContact O-CA 3.49Å; E85-D88 WeakPolarHBondContact O-CB 3.45Å; E85-D88 PolarHBondContact O-N 3.08Å; E85-A89 PolarHBondContact O-N 3Å
86	N	78	Confident	72.6	Confident	99 Å²	99	101.7 Å²	101.7	53%	0.529	51%	0.513	S	S	.	.	H	α-helix	trans	-60.4	-38.7	176.1	-76.6	-20.5	0	0	0	112	K82 Y83 D88 A89 Y90	K82-N86 WeakPolarHBondContact O-CB 3.42Å; K82-N86 VanDerWaalsContact O-CG 3.23Å; K82-N86 PolarHBondContact O-N 3.01Å; K82-N86 PolarHBondContact O-ND2 3.37Å; Y83-N86 PolarHBondContact O-N 3.35Å; N86-D88 VanDerWaalsContact C-N 3.29Å; N86-A89 PolarHBondContact O-N 2.9Å; N86-Y90 VanDerWaalsContact O-CB 3.31Å; N86-Y90 WeakPolarHBondContact O-CB 3.32Å; N86-Y90 PolarHBondContact O-N 3.42Å
87	L	76.7	Confident	71.3	Confident	42 Å²	42	101.3 Å²	101.3	22%	0.22	51%	0.512	C	S	.	.	H	α-helix	trans	-66.8	-34.5	175.5	-169.6	138.6	0	0	0	110.4	Y83 E85 Y90 Y91 R98	Y83-L87 HydrophobicContact CE1-CD1 3.65Å; Y83-L87 HydrophobicContact CE2-CD1 4.33Å; Y83-L87 WeakPolarHBondContact O-CB 3.4Å; Y83-L87 PolarHBondContact O-N 3.37Å; Y83-L87 VanDerWaalsContact OH-CD1 3.3Å; Y83-L87 WeakPolarHBondContact OH-CD1 3.36Å; E85-L87 VanDerWaalsContact C-N 3.26Å; E85-L87 PolarHBondContact O-N 2.9Å; L87-Y90 PolarHBondContact O-N 2.82Å; L87-Y91 HydrophobicContact CD1-CE2 4.47Å; L87-Y91 HydrophobicContact CD2-CD2 3.66Å; L87-Y91 HydrophobicContact CD2-CE2 3.44Å; L87-Y91 VanDerWaalsContact CD2-CE2 3.44Å; L87-Y91 HydrophobicContact CG-CD2 4.04Å; L87-Y91 HydrophobicContact CG-CE2 3.73Å; L87-Y91 WeakPolarHBondContact O-CD2 3.38Å; L87-Y91 PolarHBondContact O-N 3.5Å; L87-Y91 VanDerWaalsContact O-N 3.07Å; L87-R98 VanDerWaalsContact CD2-NH2 3.3Å
88	D	73	Confident	70	Confident	58 Å²	58	102.6 Å²	102.6	31%	0.31	51%	0.51	S	S	.	.	H	α-helix	trans	-67.6	-49.6	174.9	-149.2	11.3	0	0	0	111.4	M84 E85 N86 Y90 Y91 M92 R98	M84-D88 WeakPolarHBondContact O-CB 3.49Å; M84-D88 PolarHBondContact O-N 3.35Å; E85-D88 WeakPolarHBondContact O-CA 3.49Å; E85-D88 WeakPolarHBondContact O-CB 3.45Å; E85-D88 PolarHBondContact O-N 3.08Å; N86-D88 VanDerWaalsContact C-N 3.29Å; D88-Y90 PolarHBondContact O-N 3.2Å; D88-Y91 PolarHBondContact O-N 3.35Å; D88-Y91 VanDerWaalsContact O-N 3.1Å; D88-M92 WeakPolarHBondContact O-CB 3.3Å; D88-M92 WeakPolarHBondContact O-CG 3.42Å; D88-M92 PolarHBondContact O-N 2.82Å; D88-R98 WeakPolarHBondContact OD1-CD 3.36Å; D88-R98 IonicContact OD1-CZ 3.31Å; D88-R98 VanDerWaalsContact OD1-CZ 3.31Å; D88-R98 IonicContact OD1-NE 2.72Å; D88-R98 PolarHBondContact OD1-NE 3.37Å; D88-R98 IonicContact OD1-NH2 3.62Å
89	A	75.1	Confident	68.6	Low	46 Å²	46	104.7 Å²	104.7	38%	0.38	51%	0.513	S	S	.	.	H	α-helix	trans	-54.7	-42.3	173.7	0	0	0	0	0	111.2	E85 N86 M92 L93	E85-A89 PolarHBondContact O-N 3Å; N86-A89 PolarHBondContact O-N 2.9Å; A89-M92 PolarHBondContact O-N 3.45Å; A89-L93 WeakPolarHBondContact O-CB 3.45Å; A89-L93 VanDerWaalsContact O-CG 3.23Å; A89-L93 WeakPolarHBondContact O-CG 3.43Å; A89-L93 PolarHBondContact O-N 3.12Å
90	Y	74	Confident	67	Low	113 Å²	113	104.4 Å²	104.4	44%	0.443	52%	0.517	S	S	.	.	H	α-helix	trans	-61.6	-44.9	176.5	179.2	-95.4	0	0	0	113.1	N86 L87 D88 R94	N86-Y90 VanDerWaalsContact O-CB 3.31Å; N86-Y90 WeakPolarHBondContact O-CB 3.32Å; N86-Y90 PolarHBondContact O-N 3.42Å; L87-Y90 PolarHBondContact O-N 2.82Å; D88-Y90 PolarHBondContact O-N 3.2Å; Y90-R94 PolarHBondContact O-N 3.48Å; Y90-R94 VanDerWaalsContact O-N 3.13Å; Y90-R94 PolarHBondContact OH-NE 2.97Å; Y90-R94 PolarHBondContact OH-NH1 3Å; Y90-R94 PolarHBondContact OH-NH2 2.98Å
91	Y	64.6	Low	65.3	Low	99 Å²	99	110.1 Å²	110.1	39%	0.388	54%	0.542	S	S	.	.	H	α-helix	trans	-72.3	-35.1	178.5	-79.1	-67.3	0	0	0	112.7	L87 D88 R94 G95 R96	L87-Y91 HydrophobicContact CD1-CE2 4.47Å; L87-Y91 HydrophobicContact CD2-CD2 3.66Å; L87-Y91 HydrophobicContact CD2-CE2 3.44Å; L87-Y91 VanDerWaalsContact CD2-CE2 3.44Å; L87-Y91 HydrophobicContact CG-CD2 4.04Å; L87-Y91 HydrophobicContact CG-CE2 3.73Å; L87-Y91 WeakPolarHBondContact O-CD2 3.38Å; L87-Y91 PolarHBondContact O-N 3.5Å; L87-Y91 VanDerWaalsContact O-N 3.07Å; D88-Y91 PolarHBondContact O-N 3.35Å; D88-Y91 VanDerWaalsContact O-N 3.1Å; Y91-R94 CarbonylContact O-C 3.56Å; Y91-R94 PolarHBondContact O-N 3.1Å; Y91-G95 PolarHBondContact O-N 3.36Å; Y91-R96 PolarHBondContact O-N 3.2Å
92	M	63.1	Low	63.9	Low	141 Å²	141	117.2 Å²	117.2	70%	0.695	56%	0.563	S	S	*	*	H	α-helix	trans	-61.3	-47.7	171.6	-75.7	-175	145.2	0	0	111.5	D88 A89 R94 G95	D88-M92 WeakPolarHBondContact O-CB 3.3Å; D88-M92 WeakPolarHBondContact O-CG 3.42Å; D88-M92 PolarHBondContact O-N 2.82Å; A89-M92 PolarHBondContact O-N 3.45Å; M92-R94 PolarHBondContact O-N 3.4Å; M92-G95 PolarHBondContact O-N 3.21Å
93	L	63.8	Low	62.1	Low	155 Å²	155	117.8 Å²	117.8	81%	0.812	57%	0.572	S	S	*	*	H	α-helix	trans	-61.8	-31.9	176.7	-74.4	171.2	0	0	0	112.5	A89 G95	A89-L93 WeakPolarHBondContact O-CB 3.45Å; A89-L93 VanDerWaalsContact O-CG 3.23Å; A89-L93 WeakPolarHBondContact O-CG 3.43Å; A89-L93 PolarHBondContact O-N 3.12Å; L93-G95 VanDerWaalsContact C-N 3.28Å; L93-G95 PolarHBondContact O-N 3.39Å
94	R	62.3	Low	60.1	Low	167 Å²	167	120.3 Å²	120.3	63%	0.63	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.5	3.5	173.9	-80.6	-168.5	167.8	-163.3	-1.3	114.3	Y90 Y91 M92 R96	Y90-R94 PolarHBondContact O-N 3.48Å; Y90-R94 VanDerWaalsContact O-N 3.13Å; Y90-R94 PolarHBondContact OH-NE 2.97Å; Y90-R94 PolarHBondContact OH-NH1 3Å; Y90-R94 PolarHBondContact OH-NH2 2.98Å; Y91-R94 CarbonylContact O-C 3.56Å; Y91-R94 PolarHBondContact O-N 3.1Å; M92-R94 PolarHBondContact O-N 3.4Å; R94-R96 PolarHBondContact O-N 3.35Å; R94-R96 VanDerWaalsContact O-N 3.1Å
95	G	53.7	Low	58.4	Low	62 Å²	62	123.8 Å²	123.8	64%	0.639	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	60.6	20.7	177	0	0	0	0	0	114	Y91 M92 L93 P97	Y91-G95 PolarHBondContact O-N 3.36Å; M92-G95 PolarHBondContact O-N 3.21Å; L93-G95 VanDerWaalsContact C-N 3.28Å; L93-G95 PolarHBondContact O-N 3.39Å; G95-P97 VanDerWaalsContact O-CD 3.32Å; G95-P97 WeakPolarHBondContact O-CD 3.39Å
96	R	53.3	Low	56.9	Low	188 Å²	188	121.5 Å²	121.5	71%	0.709	60%	0.599	S	S	*	*			trans	-106.8	96.3	176.8	-66.2	-162	-175.4	-146.2	1.6	107.7	Y91 R94 R98	Y91-R96 PolarHBondContact O-N 3.2Å; R94-R96 PolarHBondContact O-N 3.35Å; R94-R96 VanDerWaalsContact O-N 3.1Å; R96-R98 PolarHBondContact O-N 2.95Å
97	P	51.2	Low	55.1	Low	89 Å²	89	124 Å²	124	58%	0.578	61%	0.611	S	S	*	*			trans	-56.2	133.3	175	21.2	-29.3	0	0	0	108.8	G95	G95-P97 VanDerWaalsContact O-CD 3.32Å; G95-P97 WeakPolarHBondContact O-CD 3.39Å
98	R	52.3	Low	53.6	Low	75 Å²	75	129.8 Å²	129.8	28%	0.283	63%	0.634	S	S	.	*	S	Bend	trans	-51.9	143.3	171.3	-66.1	-177.9	176.1	-154.8	-7.2	108.1	M84 L87 D88 R96	M84-R98 PolarHBondContact O-NH2 2.95Å; L87-R98 VanDerWaalsContact CD2-NH2 3.3Å; D88-R98 WeakPolarHBondContact OD1-CD 3.36Å; D88-R98 IonicContact OD1-CZ 3.31Å; D88-R98 VanDerWaalsContact OD1-CZ 3.31Å; D88-R98 IonicContact OD1-NE 2.72Å; D88-R98 PolarHBondContact OD1-NE 3.37Å; D88-R98 IonicContact OD1-NH2 3.62Å; R96-R98 PolarHBondContact O-N 2.95Å
99	F	50.4	Low	52.5	Low	181 Å²	181	132.6 Å²	132.6	79%	0.794	65%	0.649	S	S	*	*	S	Bend	trans	71.6	108.5	-179.9	-43.8	-71.2	0	0	0	110.7	K101	F99-K101 PolarHBondContact O-N 3.46Å
100	G	43.4	Very low	51.5	Low	66 Å²	66	136.8 Å²	136.8	68%	0.68	67%	0.665	S	S	*	*			trans	-39.9	136	-172.2	0	0	0	0	0	110.8	R102	G100-R102 PolarHBondContact O-N 3.48Å
101	K	43.4	Very low	50.6	Low	175 Å²	175	136.3 Å²	136.3	76%	0.761	67%	0.67	S	S	*	*			trans	-41.9	97.7	153.6	-70	176.9	174.6	-178.1	0	105.2	F99 N103	F99-K101 PolarHBondContact O-N 3.46Å; K101-N103 VanDerWaalsContact C-N 3.34Å; K101-N103 PolarHBondContact O-N 3.34Å
102	R	48.4	Very low	50.2	Low	229 Å²	229	136.5 Å²	136.5	86%	0.864	68%	0.678	S	S	*	*			trans	-49.5	118.7	157.7	-64.8	-176.8	-173.2	-154.4	1.9	100.5	G100 Y104	G100-R102 PolarHBondContact O-N 3.48Å; R102-Y104 PolarHBondContact O-N 2.95Å
103	N	43.1	Very low	49.9	Very low	150 Å²	150	135 Å²	135	80%	0.802	67%	0.672	S	S	*	*			trans	-57.6	87.6	172.1	-69.8	-31.6	0	0	0	104.8	K101 N105	K101-N103 VanDerWaalsContact C-N 3.34Å; K101-N103 PolarHBondContact O-N 3.34Å; N103-N105 PolarHBondContact O-N 2.86Å
104	Y	37.5	Very low	49.5	Very low	188 Å²	188	133.6 Å²	133.6	74%	0.737	66%	0.663	S	S	*	*			trans	-77	79.3	172.9	-160.5	-87.7	0	0	0	101.6	R102 P106	R102-Y104 PolarHBondContact O-N 2.95Å; Y104-P106 VanDerWaalsContact C-N 3.33Å; Y104-P106 HydrophobicContact CD1-CB 4.07Å; Y104-P106 HydrophobicContact CD1-CG 4.08Å; Y104-P106 HydrophobicContact CE1-CB 3.92Å; Y104-P106 HydrophobicContact CE1-CG 4.38Å; Y104-P106 WeakPolarHBondContact O-CD 3.34Å
105	N	41.7	Very low	49.5	Very low	143 Å²	143	131.9 Å²	131.9	77%	0.765	66%	0.66	S	S	*	*			trans	-67.9	103.1	153.1	-82.3	-7.4	0	0	0	103.4	N103 I107	N103-N105 PolarHBondContact O-N 2.86Å; N105-I107 PolarHBondContact O-N 3.47Å
106	P	45.1	Very low	50.3	Low	86 Å²	86	133.3 Å²	133.3	56%	0.558	65%	0.653	S	S	*	*			trans	-65.5	135.2	169.5	7.2	10.6	0	0	0	105.4	Y104	Y104-P106 VanDerWaalsContact C-N 3.33Å; Y104-P106 HydrophobicContact CD1-CB 4.07Å; Y104-P106 HydrophobicContact CD1-CG 4.08Å; Y104-P106 HydrophobicContact CE1-CB 3.92Å; Y104-P106 HydrophobicContact CE1-CG 4.38Å; Y104-P106 WeakPolarHBondContact O-CD 3.34Å
107	I	41.3	Very low	51.1	Low	152 Å²	152	128.5 Å²	128.5	78%	0.779	64%	0.642	S	S	*	*	S	Bend	trans	88.9	76.5	168.4	-42.8	154.2	0	0	0	114.7	N105	N105-I107 PolarHBondContact O-N 3.47Å
108	K	44.9	Very low	52.2	Low	163 Å²	163	129.8 Å²	129.8	71%	0.709	64%	0.643	S	S	*	*			trans	-163	50.1	130.1	-109.6	-179.9	-174.1	-178.2	0	110.8	N110 N111	K108-N110 PolarHBondContact O-N 3.16Å; K108-N111 PolarHBondContact O-N 3.42Å
109	D	49.3	Very low	53.4	Low	116 Å²	116	130.6 Å²	130.6	62%	0.62	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.7	-6.5	-171.7	-85.9	-35.8	0	0	0	116.7
110	N	54.1	Low	54.7	Low	134 Å²	134	126.4 Å²	126.4	72%	0.717	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.4	-27.7	-177	-67.6	0.4	0	0	0	114.1	K108	K108-N110 PolarHBondContact O-N 3.16Å
111	N	55.5	Low	56.4	Low	104 Å²	104	127.8 Å²	127.8	56%	0.556	63%	0.63	S	S	*	*	H	α-helix	trans	-90.7	-32.1	-172.2	-79.7	6	0	0	0	113.9	K108 K115	K108-N111 PolarHBondContact O-N 3.42Å; N111-K115 PolarHBondContact O-N 3.34Å
112	D	55.7	Low	58.2	Low	102 Å²	102	126 Å²	126	55%	0.545	62%	0.619	S	S	.	*	H	α-helix	trans	-78.8	-33.2	-174.8	-74.2	-15.7	0	0	0	112.5	K115 N116	D112-K115 PolarHBondContact O-N 2.84Å; D112-N116 WeakPolarHBondContact O-CB 3.46Å; D112-N116 PolarHBondContact O-N 3.38Å; D112-N116 PolarHBondContact O-ND2 2.94Å
113	L	57.3	Low	59.6	Low	110 Å²	110	119.3 Å²	119.3	58%	0.576	60%	0.6	S	S	*	*	H	α-helix	trans	-60.8	-48.6	169.6	-100.6	133.8	0	0	0	111	K115 N116 D117	L113-K115 VanDerWaalsContact C-N 3.3Å; L113-K115 PolarHBondContact O-N 3.35Å; L113-N116 PolarHBondContact O-N 2.98Å; L113-N116 VanDerWaalsContact O-N 3.14Å; L113-D117 PolarHBondContact O-N 3.18Å
114	M	56.3	Low	61.4	Low	125 Å²	125	120.9 Å²	120.9	62%	0.616	59%	0.594	S	S	*	*	H	α-helix	trans	-60.9	-38.8	177.9	-121.1	175	76.5	0	0	112.1	L118	M114-L118 WeakPolarHBondContact O-CB 3.44Å; M114-L118 WeakPolarHBondContact O-CD1 3.34Å; M114-L118 PolarHBondContact O-N 3.48Å
115	K	61.2	Low	63.3	Low	131 Å²	131	118.3 Å²	118.3	57%	0.57	59%	0.589	S	S	*	*	H	α-helix	trans	-63.8	-45.1	173.6	-89	-175.4	175.2	178.6	0	112.3	N111 D112 L113 D117 L118 I119	N111-K115 PolarHBondContact O-N 3.34Å; D112-K115 PolarHBondContact O-N 2.84Å; L113-K115 VanDerWaalsContact C-N 3.3Å; L113-K115 PolarHBondContact O-N 3.35Å; K115-D117 VanDerWaalsContact C-N 3.34Å; K115-L118 PolarHBondContact O-N 3.5Å; K115-I119 WeakPolarHBondContact O-CB 3.33Å; K115-I119 WeakPolarHBondContact O-CD1 3.3Å; K115-I119 VanDerWaalsContact O-CG1 3.23Å; K115-I119 WeakPolarHBondContact O-CG1 3.16Å; K115-I119 PolarHBondContact O-N 3.33Å
116	N	70.1	Confident	65.2	Low	93 Å²	93	117.3 Å²	117.3	50%	0.497	58%	0.578	S	S	.	*	H	α-helix	trans	-64.8	-40	179.9	-73.7	-19.6	0	0	0	111.4	D112 L113 I119 N120	D112-N116 WeakPolarHBondContact O-CB 3.46Å; D112-N116 PolarHBondContact O-N 3.38Å; D112-N116 PolarHBondContact O-ND2 2.94Å; L113-N116 PolarHBondContact O-N 2.98Å; L113-N116 VanDerWaalsContact O-N 3.14Å; N116-I119 PolarHBondContact O-N 2.96Å; N116-N120 VanDerWaalsContact O-CB 3.24Å; N116-N120 WeakPolarHBondContact O-CB 3.24Å; N116-N120 PolarHBondContact O-N 2.85Å; N116-N120 PolarHBondContact O-ND2 2.72Å
117	D	71.8	Confident	66.8	Low	87 Å²	87	119 Å²	119	47%	0.465	58%	0.582	S	S	.	*	H	α-helix	trans	-65.9	-40.3	175.7	-74	-16.4	0	0	0	112.2	L113 K115 N120 N121	L113-D117 PolarHBondContact O-N 3.18Å; K115-D117 VanDerWaalsContact C-N 3.34Å; D117-N120 PolarHBondContact O-N 2.88Å; D117-N121 VanDerWaalsContact O-CB 3.27Å; D117-N121 WeakPolarHBondContact O-CB 3.27Å; D117-N121 PolarHBondContact O-N 2.91Å; D117-N121 PolarHBondContact O-ND2 2.87Å
118	L	74.1	Confident	68.5	Low	116 Å²	116	117 Å²	117	61%	0.607	57%	0.572	S	S	*	*	H	α-helix	trans	-61.6	-46.3	173.3	-93.6	152.1	0	0	0	112.1	M114 K115 N121 Y122	M114-L118 WeakPolarHBondContact O-CB 3.44Å; M114-L118 WeakPolarHBondContact O-CD1 3.34Å; M114-L118 PolarHBondContact O-N 3.48Å; K115-L118 PolarHBondContact O-N 3.5Å; L118-N121 PolarHBondContact O-N 3.3Å; L118-Y122 WeakPolarHBondContact O-CB 3.36Å; L118-Y122 PolarHBondContact O-N 3.27Å
119	I	77.1	Confident	69.9	Low	91 Å²	91	115.2 Å²	115.2	47%	0.467	57%	0.566	S	S	.	*	H	α-helix	trans	-64.7	-45.2	178.6	-68.3	164.4	0	0	0	110.3	K115 N116 N121 Y122 L123	K115-I119 WeakPolarHBondContact O-CB 3.33Å; K115-I119 WeakPolarHBondContact O-CD1 3.3Å; K115-I119 VanDerWaalsContact O-CG1 3.23Å; K115-I119 WeakPolarHBondContact O-CG1 3.16Å; K115-I119 PolarHBondContact O-N 3.33Å; N116-I119 PolarHBondContact O-N 2.96Å; I119-N121 PolarHBondContact O-N 2.93Å; I119-Y122 PolarHBondContact O-N 3.44Å; I119-L123 HydrophobicContact CG2-CD1 3.97Å; I119-L123 HydrophobicContact CG2-CG 4.42Å; I119-L123 WeakPolarHBondContact O-CG 3.35Å; I119-L123 PolarHBondContact O-N 2.86Å
120	N	76.9	Confident	71.3	Confident	93 Å²	93	115.8 Å²	115.8	50%	0.497	56%	0.563	S	S	.	*	H	α-helix	trans	-63.6	-42.8	179.3	-74.9	-24.8	0	0	0	111.5	N116 D117 L123 R124	N116-N120 VanDerWaalsContact O-CB 3.24Å; N116-N120 WeakPolarHBondContact O-CB 3.24Å; N116-N120 PolarHBondContact O-N 2.85Å; N116-N120 PolarHBondContact O-ND2 2.72Å; D117-N120 PolarHBondContact O-N 2.88Å; N120-L123 PolarHBondContact O-N 3.44Å; N120-R124 WeakPolarHBondContact O-CB 3.36Å; N120-R124 PolarHBondContact O-N 3.07Å
121	N	80.5	Confident	72	Confident	96 Å²	96	116.5 Å²	116.5	51%	0.513	56%	0.557	S	S	.	*	H	α-helix	trans	-64.6	-41.5	175.6	-80.1	-26.7	0	0	0	112	D117 L118 I119 R124 Q125	D117-N121 VanDerWaalsContact O-CB 3.27Å; D117-N121 WeakPolarHBondContact O-CB 3.27Å; D117-N121 PolarHBondContact O-N 2.91Å; D117-N121 PolarHBondContact O-ND2 2.87Å; L118-N121 PolarHBondContact O-N 3.3Å; I119-N121 PolarHBondContact O-N 2.93Å; N121-R124 PolarHBondContact O-N 3.32Å; N121-Q125 WeakPolarHBondContact O-CG 3.43Å; N121-Q125 PolarHBondContact O-N 2.85Å
122	Y	80.7	Confident	72.4	Confident	138 Å²	138	117.2 Å²	117.2	54%	0.541	56%	0.56	S	S	.	*	H	α-helix	trans	-62.4	-45.6	176	179.3	-99.9	0	0	0	112.1	L118 I119 R124 Q125 K126	L118-Y122 WeakPolarHBondContact O-CB 3.36Å; L118-Y122 PolarHBondContact O-N 3.27Å; I119-Y122 PolarHBondContact O-N 3.44Å; Y122-R124 VanDerWaalsContact C-N 3.34Å; Y122-R124 PolarHBondContact O-N 3.2Å; Y122-Q125 PolarHBondContact O-N 3.39Å; Y122-K126 HydrophobicContact CE1-CD 4.29Å; Y122-K126 WeakPolarHBondContact O-CB 3.49Å; Y122-K126 PolarHBondContact O-N 3.5Å
123	L	77.3	Confident	72.8	Confident	88 Å²	88	116.4 Å²	116.4	46%	0.461	56%	0.555	S	S	.	*	H	α-helix	trans	-62.9	-40.6	176.8	-70.8	172.9	0	0	0	111.7	I119 N120 K126 L127	I119-L123 HydrophobicContact CG2-CD1 3.97Å; I119-L123 HydrophobicContact CG2-CG 4.42Å; I119-L123 WeakPolarHBondContact O-CG 3.35Å; I119-L123 PolarHBondContact O-N 2.86Å; N120-L123 PolarHBondContact O-N 3.44Å; L123-K126 PolarHBondContact O-N 2.98Å; L123-L127 WeakPolarHBondContact O-CB 3.1Å; L123-L127 WeakPolarHBondContact O-CG 3.39Å; L123-L127 PolarHBondContact O-N 3.01Å
124	R	80.4	Confident	73.1	Confident	182 Å²	182	114.8 Å²	114.8	69%	0.687	55%	0.547	S	S	*	.	H	α-helix	trans	-61.5	-46.3	175.6	-119.8	176.4	176	-161.6	-1.3	112.1	N120 N121 Y122 K126 L127 L128	N120-R124 WeakPolarHBondContact O-CB 3.36Å; N120-R124 PolarHBondContact O-N 3.07Å; N121-R124 PolarHBondContact O-N 3.32Å; Y122-R124 VanDerWaalsContact C-N 3.34Å; Y122-R124 PolarHBondContact O-N 3.2Å; R124-K126 VanDerWaalsContact C-N 3.34Å; R124-K126 PolarHBondContact O-N 3.23Å; R124-L127 PolarHBondContact O-N 2.92Å; R124-L128 WeakPolarHBondContact O-CG 3.48Å; R124-L128 PolarHBondContact O-N 3.48Å
125	Q	78.7	Confident	73	Confident	134 Å²	134	111.8 Å²	111.8	63%	0.626	53%	0.533	S	S	*	.	H	α-helix	trans	-61.3	-43.4	177	-75.4	-179.4	-1.6	0	0	111.4	N121 Y122 L127 L128 Q129	N121-Q125 WeakPolarHBondContact O-CG 3.43Å; N121-Q125 PolarHBondContact O-N 2.85Å; Y122-Q125 PolarHBondContact O-N 3.39Å; Q125-L127 PolarHBondContact O-N 3.33Å; Q125-L128 PolarHBondContact O-N 3.45Å; Q125-Q129 WeakPolarHBondContact O-CB 3.31Å; Q125-Q129 PolarHBondContact O-N 2.91Å
126	K	81.5	Confident	72.8	Confident	122 Å²	122	114.2 Å²	114.2	53%	0.53	54%	0.54	S	S	.	.	H	α-helix	trans	-65.8	-38.4	179.9	-159.7	177.1	-173.5	178.6	0	112.6	Y122 L123 R124 K130	Y122-K126 HydrophobicContact CE1-CD 4.29Å; Y122-K126 WeakPolarHBondContact O-CB 3.49Å; Y122-K126 PolarHBondContact O-N 3.5Å; L123-K126 PolarHBondContact O-N 2.98Å; R124-K126 VanDerWaalsContact C-N 3.34Å; R124-K126 PolarHBondContact O-N 3.23Å; K126-K130 WeakPolarHBondContact O-CB 3.23Å; K126-K130 PolarHBondContact O-N 2.89Å
127	L	78.5	Confident	72	Confident	121 Å²	121	115.1 Å²	115.1	63%	0.634	55%	0.545	S	S	*	.	H	α-helix	trans	-67.6	-42.9	175.4	-74.9	170.1	0	0	0	112.2	L123 R124 Q125 K130 Y131	L123-L127 WeakPolarHBondContact O-CB 3.1Å; L123-L127 WeakPolarHBondContact O-CG 3.39Å; L123-L127 PolarHBondContact O-N 3.01Å; R124-L127 PolarHBondContact O-N 2.92Å; Q125-L127 PolarHBondContact O-N 3.33Å; L127-K130 PolarHBondContact O-N 3.34Å; L127-Y131 PolarHBondContact O-N 2.84Å
128	L	76.1	Confident	70.9	Confident	110 Å²	110	116.2 Å²	116.2	58%	0.576	55%	0.551	S	S	*	*	H	α-helix	trans	-63.9	-42.1	175.8	-75.6	165.4	0	0	0	111.6	R124 Q125 K130 Y131 L132	R124-L128 WeakPolarHBondContact O-CG 3.48Å; R124-L128 PolarHBondContact O-N 3.48Å; Q125-L128 PolarHBondContact O-N 3.45Å; L128-K130 VanDerWaalsContact C-N 3.35Å; L128-K130 PolarHBondContact O-N 2.95Å; L128-Y131 PolarHBondContact O-N 3.19Å; L128-L132 WeakPolarHBondContact O-CG 3.5Å; L128-L132 PolarHBondContact O-N 3.19Å
129	Q	75.1	Confident	69.7	Low	126 Å²	126	116.7 Å²	116.7	59%	0.589	55%	0.554	S	S	*	*	H	α-helix	trans	-63.8	-41.7	177.2	-162.6	174.5	45.9	0	0	111.5	Q125 L132 I133	Q125-Q129 WeakPolarHBondContact O-CB 3.31Å; Q125-Q129 PolarHBondContact O-N 2.91Å; Q129-L132 PolarHBondContact O-N 3.31Å; Q129-I133 HydrophobicContact CG-CD1 4.12Å; Q129-I133 WeakPolarHBondContact O-CD1 3.45Å; Q129-I133 WeakPolarHBondContact O-CG1 3.23Å; Q129-I133 PolarHBondContact O-N 3.28Å
130	K	78.3	Confident	68.4	Low	128 Å²	128	114.9 Å²	114.9	56%	0.557	56%	0.558	S	S	*	*	H	α-helix	trans	-60.1	-47.3	173.8	-173.5	178.9	178	-172.7	0	111.6	K126 L127 L128 L132 I133 D134	K126-K130 WeakPolarHBondContact O-CB 3.23Å; K126-K130 PolarHBondContact O-N 2.89Å; L127-K130 PolarHBondContact O-N 3.34Å; L128-K130 VanDerWaalsContact C-N 3.35Å; L128-K130 PolarHBondContact O-N 2.95Å; K130-L132 VanDerWaalsContact C-N 3.34Å; K130-L132 PolarHBondContact O-N 3.1Å; K130-I133 PolarHBondContact O-N 3.44Å; K130-D134 WeakPolarHBondContact O-CB 3.37Å; K130-D134 PolarHBondContact O-N 2.65Å
131	Y	69.4	Low	67.1	Low	150 Å²	150	116.1 Å²	116.1	59%	0.588	57%	0.565	S	S	*	*	H	α-helix	trans	-62.9	-39.4	179.2	-170.8	-100.1	0	0	0	112.7	L127 L128 N135	L127-Y131 PolarHBondContact O-N 2.84Å; L128-Y131 PolarHBondContact O-N 3.19Å; Y131-N135 WeakPolarHBondContact CD1-ND2 3.39Å; Y131-N135 WeakPolarHBondContact CE1-ND2 3.48Å; Y131-N135 VanDerWaalsContact CZ-ND2 3.26Å; Y131-N135 WeakPolarHBondContact O-CB 3.47Å; Y131-N135 PolarHBondContact O-N 3.34Å; Y131-N135 PolarHBondContact O-ND2 3.39Å
132	L	62.9	Low	65.6	Low	119 Å²	119	119.9 Å²	119.9	62%	0.623	58%	0.579	S	S	*	*	H	α-helix	trans	-65.9	-40.7	174.8	-72.5	171.1	0	0	0	112	L128 Q129 K130 Y136	L128-L132 WeakPolarHBondContact O-CG 3.5Å; L128-L132 PolarHBondContact O-N 3.19Å; Q129-L132 PolarHBondContact O-N 3.31Å; K130-L132 VanDerWaalsContact C-N 3.34Å; K130-L132 PolarHBondContact O-N 3.1Å; L132-Y136 VanDerWaalsContact O-CB 3.24Å; L132-Y136 WeakPolarHBondContact O-CB 3.32Å; L132-Y136 PolarHBondContact O-N 3.06Å
133	I	65.5	Low	63.9	Low	85 Å²	85	120 Å²	120	44%	0.436	59%	0.589	S	S	.	*	H	α-helix	trans	-65.8	-45.6	176.1	-68.1	163.3	0	0	0	110.7	Q129 K130 N135 Y136 N137	Q129-I133 HydrophobicContact CG-CD1 4.12Å; Q129-I133 WeakPolarHBondContact O-CD1 3.45Å; Q129-I133 WeakPolarHBondContact O-CG1 3.23Å; Q129-I133 PolarHBondContact O-N 3.28Å; K130-I133 PolarHBondContact O-N 3.44Å; I133-N135 VanDerWaalsContact C-N 3.28Å; I133-N135 PolarHBondContact O-N 3.13Å; I133-Y136 PolarHBondContact O-N 3.31Å; I133-N137 WeakPolarHBondContact O-CB 3.13Å; I133-N137 VanDerWaalsContact O-CG 3.23Å; I133-N137 PolarHBondContact O-N 2.95Å; I133-N137 PolarHBondContact O-ND2 3.1Å
134	D	62.2	Low	62.6	Low	75 Å²	75	124 Å²	124	40%	0.401	60%	0.603	S	S	.	*	H	α-helix	trans	-63	-36.4	-179.3	-68.8	-17.7	0	0	0	111	K130 N138	K130-D134 WeakPolarHBondContact O-CB 3.37Å; K130-D134 PolarHBondContact O-N 2.65Å; D134-N138 PolarHBondContact O-N 2.98Å; D134-N138 PolarHBondContact O-ND2 3.49Å; D134-N138 VanDerWaalsContact O-ND2 3.11Å
135	N	55.6	Low	61.1	Low	62 Å²	62	123 Å²	123	33%	0.332	61%	0.611	S	S	.	*	H	α-helix	trans	-78.8	-37.3	175.4	-72	-20.5	0	0	0	113.5	Y131 I133 N137 N138 D139	Y131-N135 WeakPolarHBondContact CD1-ND2 3.39Å; Y131-N135 WeakPolarHBondContact CE1-ND2 3.48Å; Y131-N135 VanDerWaalsContact CZ-ND2 3.26Å; Y131-N135 WeakPolarHBondContact O-CB 3.47Å; Y131-N135 PolarHBondContact O-N 3.34Å; Y131-N135 PolarHBondContact O-ND2 3.39Å; I133-N135 VanDerWaalsContact C-N 3.28Å; I133-N135 PolarHBondContact O-N 3.13Å; N135-N137 PolarHBondContact O-N 3.35Å; N135-N138 PolarHBondContact O-N 3.14Å; N135-D139 PolarHBondContact O-N 2.92Å
136	Y	55.3	Low	59.2	Low	183 Å²	183	127.1 Å²	127.1	72%	0.718	62%	0.62	S	S	*	*	H	α-helix	trans	-64.1	-31	176.6	-162.2	-89.5	0	0	0	111.8	L132 I133 N138	L132-Y136 VanDerWaalsContact O-CB 3.24Å; L132-Y136 WeakPolarHBondContact O-CB 3.32Å; L132-Y136 PolarHBondContact O-N 3.06Å; I133-Y136 PolarHBondContact O-N 3.31Å; Y136-N138 VanDerWaalsContact C-N 3.31Å
137	N	53.3	Low	57.3	Low	111 Å²	111	132.7 Å²	132.7	59%	0.594	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.4	-16.9	174.5	-67.4	-22.9	0	0	0	113.1	I133 N135	I133-N137 WeakPolarHBondContact O-CB 3.13Å; I133-N137 VanDerWaalsContact O-CG 3.23Å; I133-N137 PolarHBondContact O-N 2.95Å; I133-N137 PolarHBondContact O-ND2 3.1Å; N135-N137 PolarHBondContact O-N 3.35Å
138	N	50.5	Low	56.2	Low	111 Å²	111	133.3 Å²	133.3	59%	0.594	66%	0.657	S	S	*	*	G	3₁₀ helix	trans	-89	-12	177.4	-76.9	-27.9	0	0	0	113.4	D134 N135 Y136 G140	D134-N138 PolarHBondContact O-N 2.98Å; D134-N138 PolarHBondContact O-ND2 3.49Å; D134-N138 VanDerWaalsContact O-ND2 3.11Å; N135-N138 PolarHBondContact O-N 3.14Å; Y136-N138 VanDerWaalsContact C-N 3.31Å; N138-G140 PolarHBondContact O-N 2.59Å
139	D	48.4	Very low	55.1	Low	125 Å²	125	134.5 Å²	134.5	67%	0.668	66%	0.661	S	S	*	*	G	3₁₀ helix	trans	-72.3	0.2	170.5	-69.6	-20.7	0	0	0	112.5	N135	N135-D139 PolarHBondContact O-N 2.92Å
140	G	48.9	Very low	54	Low	54 Å²	54	134.9 Å²	134.9	56%	0.557	67%	0.665	S	S	*	*	G	3₁₀ helix	trans	-82.5	-14.9	178.7	0	0	0	0	0	116	N138	N138-G140 PolarHBondContact O-N 2.59Å
141	D	49.1	Very low	52.6	Low	119 Å²	119	135.4 Å²	135.4	64%	0.636	67%	0.672	S	S	*	*			trans	-102.8	6.6	-171.5	-94.1	-9.7	0	0	0	114.8	N143 F144	D141-N143 PolarHBondContact O-N 3.38Å; D141-N143 VanDerWaalsContact O-N 3.09Å; D141-F144 PolarHBondContact O-N 3.45Å
142	E	49.7	Very low	51.6	Low	174 Å²	174	134.4 Å²	134.4	81%	0.813	68%	0.677	S	S	*	*	G	3₁₀ helix	trans	-68.1	-4.4	172.9	-71.7	-151.7	161.3	0	0	114.1	F144	E142-F144 VanDerWaalsContact C-N 3.34Å
143	N	45.5	Very low	50.8	Low	140 Å²	140	135.5 Å²	135.5	75%	0.749	68%	0.68	S	S	*	*	G	3₁₀ helix	trans	-84.5	0.2	173	-79.7	-34.5	0	0	0	114.6	D141 L145	D141-N143 PolarHBondContact O-N 3.38Å; D141-N143 VanDerWaalsContact O-N 3.09Å; N143-L145 VanDerWaalsContact C-N 3.31Å; N143-L145 PolarHBondContact O-N 2.87Å
144	F	48.8	Very low	49.8	Very low	173 Å²	173	139.1 Å²	139.1	76%	0.759	70%	0.698	S	S	*	*	G	3₁₀ helix	trans	-78.3	-8.3	177.8	-108.3	-80.9	0	0	0	115.1	D141 E142	D141-F144 PolarHBondContact O-N 3.45Å; E142-F144 VanDerWaalsContact C-N 3.34Å
145	L	50.2	Low	48.8	Very low	161 Å²	161	144 Å²	144	84%	0.843	72%	0.721	S	S	*	*	G	3₁₀ helix	trans	-110.7	16	-178.6	-68.3	174.2	0	0	0	114.7	N143	N143-L145 VanDerWaalsContact C-N 3.31Å; N143-L145 PolarHBondContact O-N 2.87Å
146	R	37.9	Very low	48.2	Very low	221 Å²	221	150.8 Å²	150.8	83%	0.834	75%	0.753	S	S	*	*			trans	-117.8	79.5	168.2	-85	-173.2	168.8	-139.6	0.1	111.2
147	N	41.2	Very low	47.6	Very low	238 Å²	238	147.9 Å²	147.9	100%	1.273	76%	0.756	S	S	*	*			trans	-157.3	0	144.5	-84.6	-29.7	0	0	0	107.9

Retrieved 147 of 147 residues in 174.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).