SYUA_SERCA Loading...

Alpha-synuclein

May be involved in the regulation of dopamine release and transport. May be involved in neuronal plasticity.

AlphaFold DB , UniProt , Accession Q91448, Species SERCA (Serinus canaria, Island canary), Gene SNCA, Length 143 aa.

						>SYUA_SERCA|Q91448|SNCA
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSRTKEGVVHGVTTVAEKTKEQVSNVGGAVVTGVTAVAQKTVEGAGNIAAATGLVKKDQLAKQNEEGFLQEGMVNNTGAAVDPDNEAYEMPPEEEYQDYEPEA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	86.2	Confident	91	Very high	187 Å²	187	116.9 Å²	116.9	92%	0.921	62%	0.621	S	S	*	*				0	-8.1	0	-72.3	-179.3	-174.4	0	0	112.7	V3 F4 M5	M1-V3 PolarHBondContact O-N 2.88Å; M1-F4 WeakPolarHBondContact O-CB 3.35Å; M1-F4 PolarHBondContact O-N 2.87Å; M1-F4 VanDerWaalsContact O-N 3.12Å; M1-M5 PolarHBondContact O-N 3.2Å
2	D	90.6	Very high	91	Very high	135 Å²	135	119.7 Å²	119.7	72%	0.722	62%	0.623	S	S	*	*	H	α-helix	trans	-66.4	-37.8	-168.2	-46.8	-44.5	0	0	0	113.9	F4 M5 K6	D2-F4 VanDerWaalsContact C-N 3.29Å; D2-F4 PolarHBondContact O-N 2.95Å; D2-M5 PolarHBondContact O-N 3.01Å; D2-K6 WeakPolarHBondContact O-CB 3.24Å; D2-K6 PolarHBondContact O-N 3Å
3	V	93	Very high	91	Very high	128 Å²	128	120.7 Å²	120.7	78%	0.776	62%	0.623	S	S	*	*	H	α-helix	trans	-62.9	-38.3	176	-177.1	0	0	0	0	111.2	M1 G7	M1-V3 PolarHBondContact O-N 2.88Å; V3-G7 PolarHBondContact O-N 3.18Å
4	F	91.4	Very high	91	Very high	148 Å²	148	115.1 Å²	115.1	65%	0.649	61%	0.61	S	S	*	*	H	α-helix	trans	-67.5	-47.1	176.3	177.5	-94.5	0	0	0	111.3	M1 D2 K6 G7 L8	M1-F4 WeakPolarHBondContact O-CB 3.35Å; M1-F4 PolarHBondContact O-N 2.87Å; M1-F4 VanDerWaalsContact O-N 3.12Å; D2-F4 VanDerWaalsContact C-N 3.29Å; D2-F4 PolarHBondContact O-N 2.95Å; F4-K6 VanDerWaalsContact C-N 3.31Å; F4-K6 PolarHBondContact O-N 3.29Å; F4-G7 PolarHBondContact O-N 2.91Å; F4-G7 VanDerWaalsContact O-N 3.12Å; F4-L8 WeakPolarHBondContact O-CB 3.34Å; F4-L8 PolarHBondContact O-N 2.81Å
5	M	91.1	Very high	91.2	Very high	106 Å²	106	114.3 Å²	114.3	52%	0.522	61%	0.61	S	S	.	*	H	α-helix	trans	-58.9	-43.1	175.6	-72.2	-68.6	-169.9	0	0	111.6	M1 D2 G7 L8 S9	M1-M5 PolarHBondContact O-N 3.2Å; D2-M5 PolarHBondContact O-N 3.01Å; M5-G7 VanDerWaalsContact C-N 3.34Å; M5-G7 PolarHBondContact O-N 2.88Å; M5-L8 PolarHBondContact O-N 3.47Å; M5-S9 WeakPolarHBondContact O-CB 3.4Å; M5-S9 PolarHBondContact O-N 3.17Å; M5-S9 PolarHBondContact O-OG 3.22Å; M5-S9 VanDerWaalsContact O-OG 3.11Å
6	K	92.1	Very high	91.3	Very high	168 Å²	168	111.3 Å²	111.3	73%	0.73	60%	0.598	S	S	*	*	H	α-helix	trans	-62.4	-41.1	174.7	-171.2	174.2	-176.9	173.5	0	111.9	D2 F4 K10	D2-K6 WeakPolarHBondContact O-CB 3.24Å; D2-K6 PolarHBondContact O-N 3Å; F4-K6 VanDerWaalsContact C-N 3.31Å; F4-K6 PolarHBondContact O-N 3.29Å; K6-K10 WeakPolarHBondContact O-CB 3.48Å; K6-K10 PolarHBondContact O-N 3.07Å
7	G	91.6	Very high	91.3	Very high	39 Å²	39	108.1 Å²	108.1	40%	0.402	59%	0.59	S	S	.	*	H	α-helix	trans	-63.2	-45.7	175.3	0	0	0	0	0	112.9	V3 F4 M5 K10 A11	V3-G7 PolarHBondContact O-N 3.18Å; F4-G7 PolarHBondContact O-N 2.91Å; F4-G7 VanDerWaalsContact O-N 3.12Å; M5-G7 VanDerWaalsContact C-N 3.34Å; M5-G7 PolarHBondContact O-N 2.88Å; G7-K10 PolarHBondContact O-N 3.25Å; G7-A11 PolarHBondContact O-N 2.91Å
8	L	92.1	Very high	91.2	Very high	97 Å²	97	105.2 Å²	105.2	51%	0.508	58%	0.583	S	S	.	*	H	α-helix	trans	-62.2	-45.1	176.7	-179.8	62.5	0	0	0	111.5	F4 M5 A11 K12	F4-L8 WeakPolarHBondContact O-CB 3.34Å; F4-L8 PolarHBondContact O-N 2.81Å; M5-L8 PolarHBondContact O-N 3.47Å; L8-A11 PolarHBondContact O-N 2.93Å; L8-K12 PolarHBondContact O-N 3.09Å
9	S	91.8	Very high	91.3	Very high	62 Å²	62	102.7 Å²	102.7	43%	0.434	58%	0.578	S	S	.	*	H	α-helix	trans	-61.8	-44.4	176.2	-65.6	0	0	0	0	111.9	M5 A11 K12 E13	M5-S9 WeakPolarHBondContact O-CB 3.4Å; M5-S9 PolarHBondContact O-N 3.17Å; M5-S9 PolarHBondContact O-OG 3.22Å; M5-S9 VanDerWaalsContact O-OG 3.11Å; S9-A11 VanDerWaalsContact C-N 3.31Å; S9-A11 PolarHBondContact O-N 3.15Å; S9-K12 WeakPolarHBondContact O-CB 3.25Å; S9-K12 PolarHBondContact O-N 3.43Å; S9-E13 WeakPolarHBondContact O-CG 3.5Å; S9-E13 PolarHBondContact O-N 3.41Å
10	K	91.2	Very high	91.2	Very high	159 Å²	159	103.9 Å²	103.9	69%	0.691	58%	0.578	S	S	*	*	H	α-helix	trans	-62	-38.5	175.8	-171.4	175.5	-177.3	179.4	0	112.3	K6 G7 G14	K6-K10 WeakPolarHBondContact O-CB 3.48Å; K6-K10 PolarHBondContact O-N 3.07Å; G7-K10 PolarHBondContact O-N 3.25Å; K10-G14 PolarHBondContact O-N 2.84Å
11	A	90.1	Very high	91.2	Very high	57 Å²	57	106.8 Å²	106.8	47%	0.471	59%	0.585	S	S	.	*	H	α-helix	trans	-65.3	-44.3	174.8	0	0	0	0	0	111.5	G7 L8 S9 G14 V15	G7-A11 PolarHBondContact O-N 2.91Å; L8-A11 PolarHBondContact O-N 2.93Å; S9-A11 VanDerWaalsContact C-N 3.31Å; S9-A11 PolarHBondContact O-N 3.15Å; A11-G14 PolarHBondContact O-N 3.45Å; A11-V15 WeakPolarHBondContact O-CG2 3.24Å; A11-V15 PolarHBondContact O-N 2.82Å
12	K	90.3	Very high	91.4	Very high	150 Å²	150	102.1 Å²	102.1	65%	0.652	57%	0.567	S	S	*	*	H	α-helix	trans	-59	-47.5	175.1	-178	-176.3	175.6	-174.3	0	111.5	L8 S9 G14 V15 V16	L8-K12 PolarHBondContact O-N 3.09Å; S9-K12 WeakPolarHBondContact O-CB 3.25Å; S9-K12 PolarHBondContact O-N 3.43Å; K12-G14 VanDerWaalsContact C-N 3.32Å; K12-G14 PolarHBondContact O-N 3.39Å; K12-V15 PolarHBondContact O-N 2.85Å; K12-V16 WeakPolarHBondContact O-CG2 3.3Å; K12-V16 PolarHBondContact O-N 2.86Å
13	E	91.2	Very high	91.3	Very high	133 Å²	133	103.4 Å²	103.4	62%	0.621	57%	0.566	S	S	*	*	H	α-helix	trans	-58.1	-43.1	175.6	-74.4	172	-174.7	0	0	111.8	S9 V15 V16 A17	S9-E13 WeakPolarHBondContact O-CG 3.5Å; S9-E13 PolarHBondContact O-N 3.41Å; E13-V15 PolarHBondContact O-N 3.27Å; E13-V16 PolarHBondContact O-N 3.35Å; E13-A17 WeakPolarHBondContact O-CB 3.5Å; E13-A17 PolarHBondContact O-N 3.2Å
14	G	90.7	Very high	91	Very high	42 Å²	42	103.6 Å²	103.6	43%	0.433	56%	0.558	S	S	.	*	H	α-helix	trans	-61.1	-42.1	176	0	0	0	0	0	113.3	K10 A11 K12 A18	K10-G14 PolarHBondContact O-N 2.84Å; A11-G14 PolarHBondContact O-N 3.45Å; K12-G14 VanDerWaalsContact C-N 3.32Å; K12-G14 PolarHBondContact O-N 3.39Å; G14-A18 WeakPolarHBondContact O-CB 3.41Å; G14-A18 PolarHBondContact O-N 3.46Å
15	V	94.6	Very high	90.8	Very high	103 Å²	103	98.4 Å²	98.4	62%	0.624	55%	0.547	S	S	*	.	H	α-helix	trans	-65.3	-44.9	176.3	172.7	0	0	0	0	111.1	A11 K12 E13 A18 A19	A11-V15 WeakPolarHBondContact O-CG2 3.24Å; A11-V15 PolarHBondContact O-N 2.82Å; K12-V15 PolarHBondContact O-N 2.85Å; E13-V15 PolarHBondContact O-N 3.27Å; V15-A18 PolarHBondContact O-N 3.46Å; V15-A19 WeakPolarHBondContact O-CB 3.33Å; V15-A19 PolarHBondContact O-N 3.33Å
16	V	93.2	Very high	90.7	Very high	67 Å²	67	97.9 Å²	97.9	41%	0.406	55%	0.55	S	S	.	.	H	α-helix	trans	-62.6	-47.4	177.9	173.7	0	0	0	0	110.6	K12 E13 A18 A19 E20	K12-V16 WeakPolarHBondContact O-CG2 3.3Å; K12-V16 PolarHBondContact O-N 2.86Å; E13-V16 PolarHBondContact O-N 3.35Å; V16-A18 VanDerWaalsContact C-N 3.34Å; V16-A18 PolarHBondContact O-N 3.03Å; V16-A19 PolarHBondContact O-N 3.41Å; V16-E20 HydrophobicContact CG1-CG 4.32Å; V16-E20 WeakPolarHBondContact O-CB 3.36Å; V16-E20 WeakPolarHBondContact O-CG 3.41Å; V16-E20 PolarHBondContact O-N 3.36Å
17	A	90.2	Very high	90.3	Very high	57 Å²	57	92.8 Å²	92.8	47%	0.471	54%	0.539	S	S	.	.	H	α-helix	trans	-61.2	-40.4	178.5	0	0	0	0	0	112.5	E13 K21	E13-A17 WeakPolarHBondContact O-CB 3.5Å; E13-A17 PolarHBondContact O-N 3.2Å; A17-K21 VanDerWaalsContact O-CB 3.3Å; A17-K21 WeakPolarHBondContact O-CB 3.47Å; A17-K21 PolarHBondContact O-N 2.87Å
18	A	90.5	Very high	89.9	Confident	55 Å²	55	95.4 Å²	95.4	46%	0.455	54%	0.541	S	S	.	.	H	α-helix	trans	-66.5	-42.6	175.6	0	0	0	0	0	112.1	G14 V15 V16 T22	G14-A18 WeakPolarHBondContact O-CB 3.41Å; G14-A18 PolarHBondContact O-N 3.46Å; V15-A18 PolarHBondContact O-N 3.46Å; V16-A18 VanDerWaalsContact C-N 3.34Å; V16-A18 PolarHBondContact O-N 3.03Å; A18-T22 WeakPolarHBondContact O-CB 3.5Å; A18-T22 PolarHBondContact O-N 2.86Å; A18-T22 PolarHBondContact O-OG1 3.41Å
19	A	91.8	Very high	89.5	Confident	59 Å²	59	93.4 Å²	93.4	49%	0.488	54%	0.538	S	S	.	.	H	α-helix	trans	-64	-42.8	176.2	0	0	0	0	0	111.7	V15 V16 T22 K23	V15-A19 WeakPolarHBondContact O-CB 3.33Å; V15-A19 PolarHBondContact O-N 3.33Å; V16-A19 PolarHBondContact O-N 3.41Å; A19-T22 PolarHBondContact O-N 2.96Å; A19-K23 WeakPolarHBondContact O-CB 3.33Å; A19-K23 PolarHBondContact O-N 2.91Å
20	E	90.1	Very high	89	Confident	126 Å²	126	93.4 Å²	93.4	59%	0.589	54%	0.542	S	S	*	.	H	α-helix	trans	-65.2	-47	176.6	-76.9	-177	178.5	0	0	112.3	V16 T22 K23 Q24	V16-E20 HydrophobicContact CG1-CG 4.32Å; V16-E20 WeakPolarHBondContact O-CB 3.36Å; V16-E20 WeakPolarHBondContact O-CG 3.41Å; V16-E20 PolarHBondContact O-N 3.36Å; E20-T22 PolarHBondContact O-N 3.12Å; E20-K23 PolarHBondContact O-N 3.48Å; E20-K23 VanDerWaalsContact O-N 3.16Å; E20-Q24 WeakPolarHBondContact O-CB 3.21Å; E20-Q24 PolarHBondContact O-N 3.04Å
21	K	91.7	Very high	88.4	Confident	164 Å²	164	87.5 Å²	87.5	71%	0.713	53%	0.526	S	S	*	.	H	α-helix	trans	-57.9	-38.9	175.4	-174.5	174.4	-177.9	176.8	0	111.6	A17 G25	A17-K21 VanDerWaalsContact O-CB 3.3Å; A17-K21 WeakPolarHBondContact O-CB 3.47Å; A17-K21 PolarHBondContact O-N 2.87Å; K21-G25 PolarHBondContact O-N 3.12Å
22	T	89.7	Confident	87.9	Confident	90 Å²	90	92 Å²	92	55%	0.552	54%	0.535	S	S	*	.	H	α-helix	trans	-68.2	-46.4	176.1	-54.8	0	0	0	0	111.3	A18 A19 E20 Q24 G25 V26	A18-T22 WeakPolarHBondContact O-CB 3.5Å; A18-T22 PolarHBondContact O-N 2.86Å; A18-T22 PolarHBondContact O-OG1 3.41Å; A19-T22 PolarHBondContact O-N 2.96Å; E20-T22 PolarHBondContact O-N 3.12Å; T22-Q24 VanDerWaalsContact C-N 3.32Å; T22-Q24 PolarHBondContact O-N 2.83Å; T22-G25 PolarHBondContact O-N 2.9Å; T22-V26 HydrophobicContact CG2-CG2 4.35Å; T22-V26 WeakPolarHBondContact O-CB 3.42Å; T22-V26 VanDerWaalsContact O-CG2 3.28Å; T22-V26 WeakPolarHBondContact O-CG2 3.46Å; T22-V26 PolarHBondContact O-N 3.39Å
23	K	88.4	Confident	87.1	Confident	162 Å²	162	88.5 Å²	88.5	70%	0.704	53%	0.526	S	S	*	.	H	α-helix	trans	-58.5	-43.7	176.4	-175.4	-178.9	178.7	-176.4	0	111.6	A19 E20 A27	A19-K23 WeakPolarHBondContact O-CB 3.33Å; A19-K23 PolarHBondContact O-N 2.91Å; E20-K23 PolarHBondContact O-N 3.48Å; E20-K23 VanDerWaalsContact O-N 3.16Å; K23-A27 WeakPolarHBondContact O-CB 3.4Å; K23-A27 PolarHBondContact O-N 3.31Å
24	Q	87.2	Confident	85.6	Confident	131 Å²	131	89.6 Å²	89.6	61%	0.612	53%	0.529	S	S	*	.	H	α-helix	trans	-65.2	-47.1	176.8	-174.2	179.7	1	0	0	111.4	E20 T22 V26 A27 E28	E20-Q24 WeakPolarHBondContact O-CB 3.21Å; E20-Q24 PolarHBondContact O-N 3.04Å; T22-Q24 VanDerWaalsContact C-N 3.32Å; T22-Q24 PolarHBondContact O-N 2.83Å; Q24-V26 PolarHBondContact O-N 2.84Å; Q24-A27 PolarHBondContact O-N 2.89Å; Q24-E28 VanDerWaalsContact O-CB 3.28Å; Q24-E28 WeakPolarHBondContact O-CB 3.32Å; Q24-E28 PolarHBondContact O-N 2.85Å
25	G	86.8	Confident	84.1	Confident	39 Å²	39	96.9 Å²	96.9	40%	0.402	55%	0.551	S	S	.	*	H	α-helix	trans	-61.2	-42.4	178.6	0	0	0	0	0	112.9	K21 T22 A29	K21-G25 PolarHBondContact O-N 3.12Å; T22-G25 PolarHBondContact O-N 2.9Å; G25-A29 WeakPolarHBondContact O-CB 3.27Å; G25-A29 PolarHBondContact O-N 3.35Å
26	V	89.7	Confident	82.4	Confident	96 Å²	96	94.5 Å²	94.5	58%	0.582	55%	0.548	S	S	*	.	H	α-helix	trans	-65.6	-44.9	175.4	173.1	0	0	0	0	111.1	T22 Q24 A29 A30	T22-V26 HydrophobicContact CG2-CG2 4.35Å; T22-V26 WeakPolarHBondContact O-CB 3.42Å; T22-V26 VanDerWaalsContact O-CG2 3.28Å; T22-V26 WeakPolarHBondContact O-CG2 3.46Å; T22-V26 PolarHBondContact O-N 3.39Å; Q24-V26 PolarHBondContact O-N 2.84Å; V26-A29 PolarHBondContact O-N 2.75Å; V26-A30 WeakPolarHBondContact O-CB 3.14Å; V26-A30 PolarHBondContact O-N 3.25Å
27	A	84.5	Confident	80.6	Confident	61 Å²	61	95.6 Å²	95.6	50%	0.504	56%	0.555	S	S	.	*	H	α-helix	trans	-65.5	-39.9	178.6	0	0	0	0	0	112.4	K23 Q24 G31	K23-A27 WeakPolarHBondContact O-CB 3.4Å; K23-A27 PolarHBondContact O-N 3.31Å; Q24-A27 PolarHBondContact O-N 2.89Å; A27-G31 PolarHBondContact O-N 3.36Å
28	E	82.7	Confident	79.2	Confident	94 Å²	94	99.6 Å²	99.6	44%	0.439	57%	0.567	S	S	.	*	H	α-helix	trans	-68.1	-42	177.6	-168.9	-176.6	157.5	0	0	111.4	Q24 G31 K32	Q24-E28 VanDerWaalsContact O-CB 3.28Å; Q24-E28 WeakPolarHBondContact O-CB 3.32Å; Q24-E28 PolarHBondContact O-N 2.85Å; E28-G31 PolarHBondContact O-N 3.06Å; E28-K32 HydrophobicContact CG-CD 4.18Å; E28-K32 WeakPolarHBondContact O-CB 3.42Å; E28-K32 WeakPolarHBondContact O-CG 3.37Å; E28-K32 PolarHBondContact O-N 3.43Å; E28-K32 WeakPolarHBondContact OE1-CE 3.41Å; E28-K32 IonicContact OE1-NZ 2.63Å; E28-K32 PolarHBondContact OE1-NZ 3.21Å
29	A	82.8	Confident	77.7	Confident	55 Å²	55	105.4 Å²	105.4	46%	0.455	58%	0.579	S	S	.	*	H	α-helix	trans	-61.1	-48.3	174	0	0	0	0	0	111.3	G25 V26 G31 K32 T33	G25-A29 WeakPolarHBondContact O-CB 3.27Å; G25-A29 PolarHBondContact O-N 3.35Å; V26-A29 PolarHBondContact O-N 2.75Å; A29-G31 VanDerWaalsContact C-N 3.3Å; A29-G31 PolarHBondContact O-N 3Å; A29-K32 PolarHBondContact O-N 3.02Å; A29-T33 WeakPolarHBondContact O-CG2 3.3Å; A29-T33 PolarHBondContact O-N 3.36Å; A29-T33 VanDerWaalsContact O-N 3.12Å; A29-T33 PolarHBondContact O-OG1 3.11Å
30	A	81.6	Confident	76.3	Confident	62 Å²	62	106.5 Å²	106.5	51%	0.512	58%	0.579	S	S	.	*	H	α-helix	trans	-60.7	-38.3	176	0	0	0	0	0	112.4	V26 T33	V26-A30 WeakPolarHBondContact O-CB 3.14Å; V26-A30 PolarHBondContact O-N 3.25Å; A30-T33 WeakPolarHBondContact CA-OG1 3.34Å; A30-T33 PolarHBondContact O-N 2.91Å; A30-T33 PolarHBondContact O-OG1 3.03Å
31	G	78	Confident	75	Confident	35 Å²	35	101.5 Å²	101.5	36%	0.361	56%	0.562	S	S	.	*	H	α-helix	trans	-73.9	-27.4	176.8	0	0	0	0	0	114.4	A27 E28 A29 K34	A27-G31 PolarHBondContact O-N 3.36Å; E28-G31 PolarHBondContact O-N 3.06Å; A29-G31 VanDerWaalsContact C-N 3.3Å; A29-G31 PolarHBondContact O-N 3Å; G31-K34 VanDerWaalsContact O-CD 3.25Å; G31-K34 WeakPolarHBondContact O-CD 3.25Å; G31-K34 VanDerWaalsContact O-CE 3.22Å; G31-K34 WeakPolarHBondContact O-CE 3.43Å; G31-K34 WeakPolarHBondContact O-CG 3.33Å
32	K	79.2	Confident	73.7	Confident	151 Å²	151	97.6 Å²	97.6	66%	0.657	56%	0.555	S	S	*	*	H	α-helix	trans	-75.8	-26.8	173.3	-78.9	174.1	169.9	171.7	0	111.8	E28 A29 K34	E28-K32 HydrophobicContact CG-CD 4.18Å; E28-K32 WeakPolarHBondContact O-CB 3.42Å; E28-K32 WeakPolarHBondContact O-CG 3.37Å; E28-K32 PolarHBondContact O-N 3.43Å; E28-K32 WeakPolarHBondContact OE1-CE 3.41Å; E28-K32 IonicContact OE1-NZ 2.63Å; E28-K32 PolarHBondContact OE1-NZ 3.21Å; A29-K32 PolarHBondContact O-N 3.02Å; K32-K34 PolarHBondContact O-N 3.4Å
33	T	73.6	Confident	72.4	Confident	76 Å²	76	102.8 Å²	102.8	47%	0.466	57%	0.565	S	S	.	*	T	Hydrogen-bonded Turn	trans	-75.3	29.2	175.3	53.8	0	0	0	0	115.1	A29 A30 E35 G36	A29-T33 WeakPolarHBondContact O-CG2 3.3Å; A29-T33 PolarHBondContact O-N 3.36Å; A29-T33 VanDerWaalsContact O-N 3.12Å; A29-T33 PolarHBondContact O-OG1 3.11Å; A30-T33 WeakPolarHBondContact CA-OG1 3.34Å; A30-T33 PolarHBondContact O-N 2.91Å; A30-T33 PolarHBondContact O-OG1 3.03Å; T33-E35 PolarHBondContact O-N 3.27Å; T33-G36 PolarHBondContact O-N 2.89Å
34	K	61.2	Low	71.5	Confident	157 Å²	157	98.1 Å²	98.1	68%	0.683	55%	0.55	S	S	*	.	H	α-helix	trans	-54.3	-21.9	-178.7	-88.2	163.1	-174.6	-174.2	0	114.7	G31 K32	G31-K34 VanDerWaalsContact O-CD 3.25Å; G31-K34 WeakPolarHBondContact O-CD 3.25Å; G31-K34 VanDerWaalsContact O-CE 3.22Å; G31-K34 WeakPolarHBondContact O-CE 3.43Å; G31-K34 WeakPolarHBondContact O-CG 3.33Å; K32-K34 PolarHBondContact O-N 3.4Å
35	E	57.9	Low	70.6	Confident	194 Å²	194	98.4 Å²	98.4	91%	0.907	55%	0.549	S	S	*	.	H	α-helix	trans	-83.8	-27	-179.6	-124.1	169.4	176.5	0	0	114	T33	T33-E35 PolarHBondContact O-N 3.27Å
36	G	59	Low	69.7	Low	54 Å²	54	104.6 Å²	104.6	56%	0.557	57%	0.568	S	S	*	*	H	α-helix	trans	-82.5	-20.5	-175.6	0	0	0	0	0	115.1	T33	T33-G36 PolarHBondContact O-N 2.89Å
37	V	55.8	Low	68.9	Low	90 Å²	90	102.5 Å²	102.5	55%	0.545	57%	0.565	S	S	.	*	H	α-helix	trans	-113.4	-23	-163.2	-169.1	0	0	0	0	114.1	Y39 G41	V37-Y39 PolarHBondContact O-N 2.94Å; V37-G41 WeakPolarHBondContact O-CA 3.4Å; V37-G41 PolarHBondContact O-N 3.38Å
38	L	60.3	Low	68.6	Low	140 Å²	140	103.2 Å²	103.2	73%	0.733	56%	0.563	S	S	*	*	H	α-helix	trans	-61.8	-31.8	179	-86.9	162	0	0	0	112.7
39	Y	60.2	Low	68.3	Low	177 Å²	177	103.5 Å²	103.5	69%	0.694	57%	0.571	S	S	*	*	H	α-helix	trans	-80.2	-42.6	-178.7	-173.4	-105.7	0	0	0	113.6	V37	V37-Y39 PolarHBondContact O-N 2.94Å
40	V	62.8	Low	68	Low	82 Å²	82	107.7 Å²	107.7	50%	0.497	58%	0.581	S	S	.	*	H	α-helix	trans	-81.8	-36.5	-179.1	-179.9	0	0	0	0	111.4	S42 R43 T44	V40-S42 VanDerWaalsContact C-N 3.32Å; V40-S42 PolarHBondContact O-N 3.3Å; V40-R43 PolarHBondContact O-N 2.64Å; V40-T44 WeakPolarHBondContact CG1-OG1 3.34Å; V40-T44 PolarHBondContact O-N 2.86Å; V40-T44 PolarHBondContact O-OG1 3.27Å; V40-T44 VanDerWaalsContact O-OG1 3.1Å
41	G	62.4	Low	67.9	Low	22 Å²	22	106.1 Å²	106.1	23%	0.227	57%	0.571	C	S	.	*	H	α-helix	trans	-59.1	-38	-175.4	0	0	0	0	0	113.7	V37 K45	V37-G41 WeakPolarHBondContact O-CA 3.4Å; V37-G41 PolarHBondContact O-N 3.38Å; G41-K45 WeakPolarHBondContact O-CB 3.28Å; G41-K45 WeakPolarHBondContact O-CG 3.36Å; G41-K45 PolarHBondContact O-N 3.21Å
42	S	63.8	Low	68.2	Low	82 Å²	82	108.5 Å²	108.5	57%	0.573	58%	0.579	S	S	*	*	H	α-helix	trans	-70.2	-32.5	177.3	-60.8	0	0	0	0	113	V40	V40-S42 VanDerWaalsContact C-N 3.32Å; V40-S42 PolarHBondContact O-N 3.3Å
43	R	62.5	Low	68.2	Low	199 Å²	199	105.2 Å²	105.2	75%	0.751	57%	0.571	S	S	*	*	H	α-helix	trans	-78.2	-32.2	176.8	-73.4	-152.2	-176.7	-173.7	3.2	113.5	V40	V40-R43 PolarHBondContact O-N 2.64Å
44	T	69.6	Low	68.5	Low	64 Å²	64	104.2 Å²	104.2	39%	0.393	57%	0.565	S	S	.	*	H	α-helix	trans	-92.8	-13.3	-176.4	-40	0	0	0	0	112.5	V40 E46 G47 V48	V40-T44 WeakPolarHBondContact CG1-OG1 3.34Å; V40-T44 PolarHBondContact O-N 2.86Å; V40-T44 PolarHBondContact O-OG1 3.27Å; V40-T44 VanDerWaalsContact O-OG1 3.1Å; T44-E46 PolarHBondContact O-N 2.93Å; T44-G47 PolarHBondContact O-N 3.49Å; T44-G47 VanDerWaalsContact O-N 3.15Å; T44-V48 HydrophobicContact CG2-CG2 3.57Å; T44-V48 WeakPolarHBondContact O-CB 3.47Å; T44-V48 VanDerWaalsContact O-CG2 3.25Å; T44-V48 WeakPolarHBondContact O-CG2 3.22Å; T44-V48 PolarHBondContact O-N 3.01Å
45	K	67.6	Low	69.8	Low	136 Å²	136	100.7 Å²	100.7	59%	0.591	56%	0.556	S	S	*	*	H	α-helix	trans	-50	-49.5	-179.6	-96.9	167.3	-168	-176.7	0	113.5	G41 V48 V49	G41-K45 WeakPolarHBondContact O-CB 3.28Å; G41-K45 WeakPolarHBondContact O-CG 3.36Å; G41-K45 PolarHBondContact O-N 3.21Å; K45-V48 PolarHBondContact O-N 3.43Å; K45-V49 VanDerWaalsContact O-CG2 3.28Å; K45-V49 WeakPolarHBondContact O-CG2 3.32Å; K45-V49 PolarHBondContact O-N 2.84Å
46	E	67.7	Low	70.9	Confident	170 Å²	170	94.1 Å²	94.1	79%	0.794	54%	0.535	S	S	*	.	H	α-helix	trans	-67.2	-42.4	-179.8	-67	179	175.7	0	0	112	T44 V49 H50	T44-E46 PolarHBondContact O-N 2.93Å; E46-V49 PolarHBondContact O-N 2.76Å; E46-H50 PolarHBondContact O-N 2.93Å
47	G	72.8	Confident	72.1	Confident	52 Å²	52	97.8 Å²	97.8	54%	0.536	54%	0.538	S	S	.	.	H	α-helix	trans	-66.2	-36.8	176.5	0	0	0	0	0	113.5	T44 G51	T44-G47 PolarHBondContact O-N 3.49Å; T44-G47 VanDerWaalsContact O-N 3.15Å; G47-G51 PolarHBondContact O-N 3.21Å
48	V	79.5	Confident	73.6	Confident	76 Å²	76	99.7 Å²	99.7	46%	0.461	54%	0.539	S	S	.	.	H	α-helix	trans	-67.7	-42.1	174.6	173.6	0	0	0	0	110.4	T44 K45 H50 G51 V52	T44-V48 HydrophobicContact CG2-CG2 3.57Å; T44-V48 WeakPolarHBondContact O-CB 3.47Å; T44-V48 VanDerWaalsContact O-CG2 3.25Å; T44-V48 WeakPolarHBondContact O-CG2 3.22Å; T44-V48 PolarHBondContact O-N 3.01Å; K45-V48 PolarHBondContact O-N 3.43Å; V48-H50 VanDerWaalsContact C-N 3.32Å; V48-H50 PolarHBondContact O-N 2.97Å; V48-G51 CarbonylContact O-C 3.59Å; V48-G51 PolarHBondContact O-N 3.4Å; V48-V52 HydrophobicContact CG1-CG2 3.71Å; V48-V52 VanDerWaalsContact O-CB 3.31Å; V48-V52 WeakPolarHBondContact O-CB 3.21Å; V48-V52 WeakPolarHBondContact O-CG2 3.44Å; V48-V52 PolarHBondContact O-N 3.03Å
49	V	76.5	Confident	74.7	Confident	100 Å²	100	95.7 Å²	95.7	61%	0.606	52%	0.52	S	S	*	.	H	α-helix	trans	-59.8	-45	178.8	170.1	0	0	0	0	110.9	K45 E46 V52 T53	K45-V49 VanDerWaalsContact O-CG2 3.28Å; K45-V49 WeakPolarHBondContact O-CG2 3.32Å; K45-V49 PolarHBondContact O-N 2.84Å; E46-V49 PolarHBondContact O-N 2.76Å; V49-V52 PolarHBondContact O-N 3.01Å; V49-T53 PolarHBondContact O-N 2.87Å; V49-T53 PolarHBondContact O-OG1 3.47Å
50	H	75.4	Confident	75.8	Confident	142 Å²	142	95.2 Å²	95.2	66%	0.657	52%	0.522	S	S	*	.	H	α-helix	trans	-63.6	-45.3	175	-170	72.6	0	0	0	111.9	E46 V48 V52 T53 T54	E46-H50 PolarHBondContact O-N 2.93Å; V48-H50 VanDerWaalsContact C-N 3.32Å; V48-H50 PolarHBondContact O-N 2.97Å; H50-V52 VanDerWaalsContact C-N 3.32Å; H50-V52 PolarHBondContact O-N 3.39Å; H50-T53 PolarHBondContact O-N 3.34Å; H50-T54 PolarHBondContact O-N 3.24Å
51	G	79.5	Confident	76.8	Confident	30 Å²	30	97.9 Å²	97.9	31%	0.309	53%	0.529	S	S	.	.	H	α-helix	trans	-61.5	-37.7	176.7	0	0	0	0	0	113.3	G47 V48 T53 T54 V55	G47-G51 PolarHBondContact O-N 3.21Å; V48-G51 CarbonylContact O-C 3.59Å; V48-G51 PolarHBondContact O-N 3.4Å; G51-T53 VanDerWaalsContact C-N 3.34Å; G51-T53 PolarHBondContact O-N 2.95Å; G51-T54 PolarHBondContact O-N 2.88Å; G51-V55 WeakPolarHBondContact O-CB 3.28Å; G51-V55 WeakPolarHBondContact O-CG2 3.41Å; G51-V55 PolarHBondContact O-N 3.27Å
52	V	84.2	Confident	77.5	Confident	85 Å²	85	102.8 Å²	102.8	52%	0.515	55%	0.546	S	S	.	.	H	α-helix	trans	-66.1	-36.8	178.3	167.1	0	0	0	0	110.6	V48 V49 H50 V55 A56	V48-V52 HydrophobicContact CG1-CG2 3.71Å; V48-V52 VanDerWaalsContact O-CB 3.31Å; V48-V52 WeakPolarHBondContact O-CB 3.21Å; V48-V52 WeakPolarHBondContact O-CG2 3.44Å; V48-V52 PolarHBondContact O-N 3.03Å; V49-V52 PolarHBondContact O-N 3.01Å; H50-V52 VanDerWaalsContact C-N 3.32Å; H50-V52 PolarHBondContact O-N 3.39Å; V52-V55 PolarHBondContact O-N 2.93Å; V52-A56 WeakPolarHBondContact O-CB 3.44Å; V52-A56 PolarHBondContact O-N 2.9Å
53	T	80	Confident	78.4	Confident	81 Å²	81	103.2 Å²	103.2	50%	0.497	55%	0.545	S	S	.	.	H	α-helix	trans	-61.9	-49.6	173.3	-56.7	0	0	0	0	111.2	V49 H50 G51 V55 A56 E57	V49-T53 PolarHBondContact O-N 2.87Å; V49-T53 PolarHBondContact O-OG1 3.47Å; H50-T53 PolarHBondContact O-N 3.34Å; G51-T53 VanDerWaalsContact C-N 3.34Å; G51-T53 PolarHBondContact O-N 2.95Å; T53-V55 VanDerWaalsContact C-N 3.34Å; T53-V55 PolarHBondContact O-N 2.93Å; T53-A56 WeakPolarHBondContact O-CB 3.26Å; T53-A56 PolarHBondContact O-N 2.63Å; T53-E57 PolarHBondContact O-N 3.44Å; T53-E57 VanDerWaalsContact O-N 3.1Å
54	T	80.9	Confident	79.5	Confident	56 Å²	56	97.8 Å²	97.8	34%	0.344	54%	0.537	S	S	.	.	H	α-helix	trans	-62.5	-40.9	176.9	-55.6	0	0	0	0	112.3	H50 G51 E57 K58	H50-T54 PolarHBondContact O-N 3.24Å; G51-T54 PolarHBondContact O-N 2.88Å; T54-E57 PolarHBondContact O-N 2.9Å; T54-K58 WeakPolarHBondContact O-CG 3.45Å; T54-K58 PolarHBondContact O-N 2.97Å; T54-K58 VanDerWaalsContact O-N 3.15Å
55	V	87.1	Confident	80.2	Confident	82 Å²	82	100.4 Å²	100.4	50%	0.497	55%	0.549	S	S	.	.	H	α-helix	trans	-65.5	-41.7	175.9	170.7	0	0	0	0	109.9	G51 V52 T53 E57 K58 T59	G51-V55 WeakPolarHBondContact O-CB 3.28Å; G51-V55 WeakPolarHBondContact O-CG2 3.41Å; G51-V55 PolarHBondContact O-N 3.27Å; V52-V55 PolarHBondContact O-N 2.93Å; T53-V55 VanDerWaalsContact C-N 3.34Å; T53-V55 PolarHBondContact O-N 2.93Å; V55-E57 VanDerWaalsContact C-N 3.31Å; V55-E57 PolarHBondContact O-N 3.48Å; V55-K58 CarbonylContact O-C 3.54Å; V55-K58 PolarHBondContact O-N 2.88Å; V55-T59 WeakPolarHBondContact O-CA 3.42Å; V55-T59 WeakPolarHBondContact O-CB 3.44Å; V55-T59 PolarHBondContact O-N 3.28Å; V55-T59 PolarHBondContact O-OG1 2.84Å
56	A	81.6	Confident	81.2	Confident	56 Å²	56	98.1 Å²	98.1	46%	0.463	55%	0.546	S	S	.	.	H	α-helix	trans	-60.1	-40.9	178.9	0	0	0	0	0	111.9	V52 T53 T59 K60	V52-A56 WeakPolarHBondContact O-CB 3.44Å; V52-A56 PolarHBondContact O-N 2.9Å; T53-A56 WeakPolarHBondContact O-CB 3.26Å; T53-A56 PolarHBondContact O-N 2.63Å; A56-T59 PolarHBondContact O-N 2.94Å; A56-K60 PolarHBondContact O-N 3.16Å
57	E	84.8	Confident	82	Confident	131 Å²	131	91.6 Å²	91.6	61%	0.612	53%	0.525	S	S	*	.	H	α-helix	trans	-61.9	-50.6	173.5	-70	178.5	162.9	0	0	111.6	T53 T54 V55 T59 K60 E61	T53-E57 PolarHBondContact O-N 3.44Å; T53-E57 VanDerWaalsContact O-N 3.1Å; T54-E57 PolarHBondContact O-N 2.9Å; V55-E57 VanDerWaalsContact C-N 3.31Å; V55-E57 PolarHBondContact O-N 3.48Å; E57-T59 VanDerWaalsContact C-N 3.31Å; E57-T59 PolarHBondContact O-N 3.41Å; E57-K60 WeakPolarHBondContact O-CB 3.32Å; E57-K60 PolarHBondContact O-N 2.87Å; E57-E61 PolarHBondContact O-N 3.29Å
58	K	87.2	Confident	82.7	Confident	131 Å²	131	90.9 Å²	90.9	57%	0.57	52%	0.517	S	S	*	.	H	α-helix	trans	-62.3	-37.8	176.2	-69.2	-177.7	178.4	-171.8	0	112.6	T54 V55 K60 E61 Q62	T54-K58 WeakPolarHBondContact O-CG 3.45Å; T54-K58 PolarHBondContact O-N 2.97Å; T54-K58 VanDerWaalsContact O-N 3.15Å; V55-K58 CarbonylContact O-C 3.54Å; V55-K58 PolarHBondContact O-N 2.88Å; K58-K60 VanDerWaalsContact C-N 3.33Å; K58-E61 PolarHBondContact O-N 3.36Å; K58-Q62 WeakPolarHBondContact O-CG 3.38Å; K58-Q62 PolarHBondContact O-N 2.82Å
59	T	83.5	Confident	83.1	Confident	55 Å²	55	90 Å²	90	34%	0.337	52%	0.518	S	S	.	.	H	α-helix	trans	-66.8	-35.6	178	-65.5	0	0	0	0	110.3	V55 A56 E57 E61 Q62 V63	V55-T59 WeakPolarHBondContact O-CA 3.42Å; V55-T59 WeakPolarHBondContact O-CB 3.44Å; V55-T59 PolarHBondContact O-N 3.28Å; V55-T59 PolarHBondContact O-OG1 2.84Å; A56-T59 PolarHBondContact O-N 2.94Å; E57-T59 VanDerWaalsContact C-N 3.31Å; E57-T59 PolarHBondContact O-N 3.41Å; T59-E61 VanDerWaalsContact C-N 3.34Å; T59-E61 PolarHBondContact O-N 2.82Å; T59-Q62 CarbonylContact O-C 3.57Å; T59-Q62 PolarHBondContact O-N 3.47Å; T59-V63 HydrophobicContact CG2-CG2 3.8Å; T59-V63 VanDerWaalsContact O-CB 3.28Å; T59-V63 WeakPolarHBondContact O-CB 3.44Å; T59-V63 WeakPolarHBondContact O-CG2 3.28Å; T59-V63 PolarHBondContact O-N 2.91Å
60	K	83.5	Confident	83.9	Confident	167 Å²	167	89.2 Å²	89.2	73%	0.726	51%	0.513	S	S	*	.	H	α-helix	trans	-59.5	-45	174.6	-173.9	179.4	178.2	-178.5	0	111.7	A56 E57 K58 V63 S64	A56-K60 PolarHBondContact O-N 3.16Å; E57-K60 WeakPolarHBondContact O-CB 3.32Å; E57-K60 PolarHBondContact O-N 2.87Å; K58-K60 VanDerWaalsContact C-N 3.33Å; K60-V63 PolarHBondContact O-N 2.84Å; K60-S64 PolarHBondContact O-N 2.99Å
61	E	81.9	Confident	84.5	Confident	139 Å²	139	87 Å²	87	65%	0.65	51%	0.509	S	S	*	.	H	α-helix	trans	-64.1	-44.5	175	-66.1	-177.6	170.4	0	0	111.6	E57 K58 T59 V63 S64 N65	E57-E61 PolarHBondContact O-N 3.29Å; K58-E61 PolarHBondContact O-N 3.36Å; T59-E61 VanDerWaalsContact C-N 3.34Å; T59-E61 PolarHBondContact O-N 2.82Å; E61-V63 PolarHBondContact O-N 3.37Å; E61-S64 WeakPolarHBondContact O-CB 3.21Å; E61-S64 PolarHBondContact O-N 2.73Å; E61-N65 PolarHBondContact O-N 2.97Å
62	Q	78.5	Confident	85	Confident	124 Å²	124	89.9 Å²	89.9	58%	0.579	52%	0.521	S	S	*	.	H	α-helix	trans	-63.9	-40.8	176.6	-72.5	-175.7	-7.3	0	0	112.9	K58 T59 S64 N65 V66	K58-Q62 WeakPolarHBondContact O-CG 3.38Å; K58-Q62 PolarHBondContact O-N 2.82Å; T59-Q62 CarbonylContact O-C 3.57Å; T59-Q62 PolarHBondContact O-N 3.47Å; Q62-S64 VanDerWaalsContact C-N 3.29Å; Q62-S64 PolarHBondContact O-N 3.42Å; Q62-N65 PolarHBondContact O-N 3.37Å; Q62-V66 WeakPolarHBondContact O-CB 3.34Å; Q62-V66 VanDerWaalsContact O-CG2 3.24Å; Q62-V66 WeakPolarHBondContact O-CG2 3.37Å; Q62-V66 PolarHBondContact O-N 3.47Å
63	V	82.3	Confident	85.3	Confident	91 Å²	91	87.4 Å²	87.4	55%	0.552	51%	0.513	S	S	*	.	H	α-helix	trans	-64.6	-37	177.2	167.8	0	0	0	0	110.2	T59 K60 E61 G67	T59-V63 HydrophobicContact CG2-CG2 3.8Å; T59-V63 VanDerWaalsContact O-CB 3.28Å; T59-V63 WeakPolarHBondContact O-CB 3.44Å; T59-V63 WeakPolarHBondContact O-CG2 3.28Å; T59-V63 PolarHBondContact O-N 2.91Å; K60-V63 PolarHBondContact O-N 2.84Å; E61-V63 PolarHBondContact O-N 3.37Å; V63-G67 WeakPolarHBondContact O-CA 3.29Å; V63-G67 PolarHBondContact O-N 3.37Å
64	S	84.8	Confident	85.8	Confident	85 Å²	85	88 Å²	88	59%	0.594	52%	0.516	S	S	*	.	H	α-helix	trans	-62.4	-46.6	171.8	-168.4	0	0	0	0	111.5	K60 E61 Q62 G67 G68	K60-S64 PolarHBondContact O-N 2.99Å; E61-S64 WeakPolarHBondContact O-CB 3.21Å; E61-S64 PolarHBondContact O-N 2.73Å; Q62-S64 VanDerWaalsContact C-N 3.29Å; Q62-S64 PolarHBondContact O-N 3.42Å; S64-G67 PolarHBondContact O-N 3.34Å; S64-G68 PolarHBondContact O-N 2.92Å
65	N	84.3	Confident	86.2	Confident	119 Å²	119	88.4 Å²	88.4	64%	0.636	52%	0.519	S	S	*	.	H	α-helix	trans	-63.8	-44	177.9	-69.3	-17.9	0	0	0	112.5	E61 Q62 G67 G68 A69	E61-N65 PolarHBondContact O-N 2.97Å; Q62-N65 PolarHBondContact O-N 3.37Å; N65-G67 VanDerWaalsContact C-N 3.35Å; N65-G68 PolarHBondContact O-N 2.89Å; N65-A69 WeakPolarHBondContact O-CB 3.49Å; N65-A69 PolarHBondContact O-N 3.12Å
66	V	89	Confident	86.3	Confident	89 Å²	89	87 Å²	87	54%	0.539	52%	0.515	S	S	.	.	H	α-helix	trans	-64.9	-41.6	175.3	172	0	0	0	0	110.1	Q62 G68 A69 V70	Q62-V66 WeakPolarHBondContact O-CB 3.34Å; Q62-V66 VanDerWaalsContact O-CG2 3.24Å; Q62-V66 WeakPolarHBondContact O-CG2 3.37Å; Q62-V66 PolarHBondContact O-N 3.47Å; V66-G68 VanDerWaalsContact C-N 3.33Å; V66-G68 PolarHBondContact O-N 3.21Å; V66-A69 CarbonylContact O-C 3.59Å; V66-A69 PolarHBondContact O-N 3.21Å; V66-A69 VanDerWaalsContact O-N 3.15Å; V66-V70 HydrophobicContact CG1-CG2 4.28Å; V66-V70 VanDerWaalsContact O-CG2 3.29Å; V66-V70 WeakPolarHBondContact O-CG2 3.37Å; V66-V70 PolarHBondContact O-N 2.83Å
67	G	85.3	Confident	86.9	Confident	33 Å²	33	88.8 Å²	88.8	34%	0.34	52%	0.521	S	S	.	.	H	α-helix	trans	-58.1	-46.6	174.4	0	0	0	0	0	111.3	V63 S64 N65 A69 V70 V71	V63-G67 WeakPolarHBondContact O-CA 3.29Å; V63-G67 PolarHBondContact O-N 3.37Å; S64-G67 PolarHBondContact O-N 3.34Å; N65-G67 VanDerWaalsContact C-N 3.35Å; G67-A69 PolarHBondContact O-N 3.46Å; G67-V70 PolarHBondContact O-N 2.81Å; G67-V71 VanDerWaalsContact O-CG2 3.29Å; G67-V71 WeakPolarHBondContact O-CG2 3.35Å; G67-V71 PolarHBondContact O-N 2.93Å
68	G	86.9	Confident	87.1	Confident	36 Å²	36	85.1 Å²	85.1	37%	0.371	51%	0.513	S	S	.	.	H	α-helix	trans	-57.5	-47	172	0	0	0	0	0	112.4	S64 N65 V66 V70 V71 T72	S64-G68 PolarHBondContact O-N 2.92Å; N65-G68 PolarHBondContact O-N 2.89Å; V66-G68 VanDerWaalsContact C-N 3.33Å; V66-G68 PolarHBondContact O-N 3.21Å; G68-V70 PolarHBondContact O-N 2.87Å; G68-V71 PolarHBondContact O-N 2.96Å; G68-T72 WeakPolarHBondContact O-CG2 3.29Å; G68-T72 PolarHBondContact O-N 3.29Å; G68-T72 PolarHBondContact O-OG1 3.15Å
69	A	88.3	Confident	87.2	Confident	58 Å²	58	84.5 Å²	84.5	48%	0.479	51%	0.512	S	S	.	.	H	α-helix	trans	-64.1	-35.9	178.3	0	0	0	0	0	113.4	N65 V66 G67 T72 G73	N65-A69 WeakPolarHBondContact O-CB 3.49Å; N65-A69 PolarHBondContact O-N 3.12Å; V66-A69 CarbonylContact O-C 3.59Å; V66-A69 PolarHBondContact O-N 3.21Å; V66-A69 VanDerWaalsContact O-N 3.15Å; G67-A69 PolarHBondContact O-N 3.46Å; A69-T72 WeakPolarHBondContact CA-OG1 3.24Å; A69-T72 PolarHBondContact O-OG1 3.31Å; A69-G73 PolarHBondContact O-N 3.15Å
70	V	92.3	Very high	87.6	Confident	84 Å²	84	89.5 Å²	89.5	51%	0.509	53%	0.529	S	S	.	.	H	α-helix	trans	-68.2	-45.5	174.9	171.8	0	0	0	0	109.8	V66 G67 G68 G73 V74	V66-V70 HydrophobicContact CG1-CG2 4.28Å; V66-V70 VanDerWaalsContact O-CG2 3.29Å; V66-V70 WeakPolarHBondContact O-CG2 3.37Å; V66-V70 PolarHBondContact O-N 2.83Å; G67-V70 PolarHBondContact O-N 2.81Å; G68-V70 PolarHBondContact O-N 2.87Å; V70-G73 PolarHBondContact O-N 3.28Å; V70-V74 HydrophobicContact CG1-CG2 4.27Å; V70-V74 WeakPolarHBondContact O-CB 3.25Å; V70-V74 VanDerWaalsContact O-CG2 3.26Å; V70-V74 WeakPolarHBondContact O-CG2 3.22Å; V70-V74 PolarHBondContact O-N 2.95Å
71	V	88.7	Confident	87.9	Confident	95 Å²	95	85.8 Å²	85.8	58%	0.576	52%	0.52	S	S	*	.	H	α-helix	trans	-62.6	-45.2	178.2	171.8	0	0	0	0	111.3	G67 G68 V74 T75	G67-V71 VanDerWaalsContact O-CG2 3.29Å; G67-V71 WeakPolarHBondContact O-CG2 3.35Å; G67-V71 PolarHBondContact O-N 2.93Å; G68-V71 PolarHBondContact O-N 2.96Å; V71-V74 PolarHBondContact O-N 3.45Å; V71-T75 WeakPolarHBondContact O-CB 3.17Å; V71-T75 PolarHBondContact O-N 3.48Å; V71-T75 PolarHBondContact O-OG1 2.91Å
72	T	90.1	Very high	88.3	Confident	91 Å²	91	84.2 Å²	84.2	56%	0.558	52%	0.52	S	S	*	.	H	α-helix	trans	-64.4	-41.4	175.8	56.3	0	0	0	0	111.3	G68 A69 T75 A76	G68-T72 WeakPolarHBondContact O-CG2 3.29Å; G68-T72 PolarHBondContact O-N 3.29Å; G68-T72 PolarHBondContact O-OG1 3.15Å; A69-T72 WeakPolarHBondContact CA-OG1 3.24Å; A69-T72 PolarHBondContact O-OG1 3.31Å; T72-T75 PolarHBondContact O-N 3.46Å; T72-A76 VanDerWaalsContact O-CB 3.28Å; T72-A76 WeakPolarHBondContact O-CB 3.47Å; T72-A76 PolarHBondContact O-N 2.81Å
73	G	89.8	Confident	88.8	Confident	33 Å²	33	84.8 Å²	84.8	34%	0.34	52%	0.522	S	S	.	.	H	α-helix	trans	-60.7	-48.9	175.5	0	0	0	0	0	112.7	A69 V70 T75 A76 V77	A69-G73 PolarHBondContact O-N 3.15Å; V70-G73 PolarHBondContact O-N 3.28Å; G73-T75 VanDerWaalsContact C-N 3.33Å; G73-T75 PolarHBondContact O-N 2.89Å; G73-A76 PolarHBondContact O-N 3.29Å; G73-V77 WeakPolarHBondContact O-CB 3.43Å; G73-V77 VanDerWaalsContact O-CG2 3.25Å; G73-V77 WeakPolarHBondContact O-CG2 3.4Å; G73-V77 PolarHBondContact O-N 3.06Å
74	V	91	Very high	89	Confident	93 Å²	93	81.8 Å²	81.8	56%	0.564	51%	0.51	S	S	*	.	H	α-helix	trans	-61.1	-43.7	176.8	170.3	0	0	0	0	110.7	V70 V71 V77 A78	V70-V74 HydrophobicContact CG1-CG2 4.27Å; V70-V74 WeakPolarHBondContact O-CB 3.25Å; V70-V74 VanDerWaalsContact O-CG2 3.26Å; V70-V74 WeakPolarHBondContact O-CG2 3.22Å; V70-V74 PolarHBondContact O-N 2.95Å; V71-V74 PolarHBondContact O-N 3.45Å; V74-V77 PolarHBondContact O-N 3.31Å; V74-A78 WeakPolarHBondContact O-CB 3.46Å; V74-A78 PolarHBondContact O-N 3.07Å
75	T	89.2	Confident	89	Confident	65 Å²	65	80.4 Å²	80.4	40%	0.399	50%	0.504	S	S	.	.	H	α-helix	trans	-62.9	-47.7	178.3	-56.7	0	0	0	0	111.1	V71 T72 G73 V77 A78 Q79	V71-T75 WeakPolarHBondContact O-CB 3.17Å; V71-T75 PolarHBondContact O-N 3.48Å; V71-T75 PolarHBondContact O-OG1 2.91Å; T72-T75 PolarHBondContact O-N 3.46Å; G73-T75 VanDerWaalsContact C-N 3.33Å; G73-T75 PolarHBondContact O-N 2.89Å; T75-V77 PolarHBondContact O-N 2.97Å; T75-A78 PolarHBondContact O-N 3.1Å; T75-Q79 HydrophobicContact CG2-CG 4.49Å; T75-Q79 WeakPolarHBondContact O-CB 3.45Å; T75-Q79 WeakPolarHBondContact O-CG 3.5Å; T75-Q79 PolarHBondContact O-N 2.98Å
76	A	90.5	Very high	89.1	Confident	52 Å²	52	76.7 Å²	76.7	43%	0.43	49%	0.494	S	S	.	.	H	α-helix	trans	-63.3	-40.8	178.3	0	0	0	0	0	112.1	T72 G73 K80	T72-A76 VanDerWaalsContact O-CB 3.28Å; T72-A76 WeakPolarHBondContact O-CB 3.47Å; T72-A76 PolarHBondContact O-N 2.81Å; G73-A76 PolarHBondContact O-N 3.29Å; A76-K80 WeakPolarHBondContact O-CB 3.21Å; A76-K80 PolarHBondContact O-N 2.96Å
77	V	92.6	Very high	89	Confident	94 Å²	94	78 Å²	78	57%	0.57	50%	0.498	S	S	*	.	H	α-helix	trans	-64.7	-44	174.8	170.7	0	0	0	0	110.8	G73 V74 T75 T81	G73-V77 WeakPolarHBondContact O-CB 3.43Å; G73-V77 VanDerWaalsContact O-CG2 3.25Å; G73-V77 WeakPolarHBondContact O-CG2 3.4Å; G73-V77 PolarHBondContact O-N 3.06Å; V74-V77 PolarHBondContact O-N 3.31Å; T75-V77 PolarHBondContact O-N 2.97Å; V77-T81 WeakPolarHBondContact O-CB 3.16Å; V77-T81 PolarHBondContact O-N 2.73Å; V77-T81 PolarHBondContact O-OG1 3.47Å
78	A	88.9	Confident	89	Confident	54 Å²	54	81.7 Å²	81.7	45%	0.446	51%	0.509	S	S	.	.	H	α-helix	trans	-62	-50	178.2	0	0	0	0	0	111.7	V74 T75 T81 V82	V74-A78 WeakPolarHBondContact O-CB 3.46Å; V74-A78 PolarHBondContact O-N 3.07Å; T75-A78 PolarHBondContact O-N 3.1Å; A78-T81 PolarHBondContact O-N 3.07Å; A78-V82 WeakPolarHBondContact O-CG2 3.28Å; A78-V82 PolarHBondContact O-N 3.46Å
79	Q	90.3	Very high	88.7	Confident	118 Å²	118	81.5 Å²	81.5	55%	0.551	50%	0.504	S	S	*	.	H	α-helix	trans	-58.5	-51.3	177.1	-73.1	177.4	-35.8	0	0	111.3	T75 T81 V82 E83	T75-Q79 HydrophobicContact CG2-CG 4.49Å; T75-Q79 WeakPolarHBondContact O-CB 3.45Å; T75-Q79 WeakPolarHBondContact O-CG 3.5Å; T75-Q79 PolarHBondContact O-N 2.98Å; Q79-T81 VanDerWaalsContact C-N 3.27Å; Q79-T81 PolarHBondContact O-N 2.72Å; Q79-V82 PolarHBondContact O-N 2.78Å; Q79-E83 WeakPolarHBondContact O-CG 3.21Å; Q79-E83 PolarHBondContact O-N 3.28Å
80	K	92.5	Very high	88.4	Confident	159 Å²	159	82.1 Å²	82.1	69%	0.691	51%	0.509	S	S	*	.	H	α-helix	trans	-64.7	-30.5	-180	-167.8	173.2	-174.8	176.9	0	113	A76 G84	A76-K80 WeakPolarHBondContact O-CB 3.21Å; A76-K80 PolarHBondContact O-N 2.96Å; K80-G84 PolarHBondContact O-N 3.46Å
81	T	89.8	Confident	87.8	Confident	89 Å²	89	82.1 Å²	82.1	55%	0.546	52%	0.518	S	S	.	.	H	α-helix	trans	-71.2	-42.1	176	-59.3	0	0	0	0	111.1	V77 A78 Q79 G84 A85	V77-T81 WeakPolarHBondContact O-CB 3.16Å; V77-T81 PolarHBondContact O-N 2.73Å; V77-T81 PolarHBondContact O-OG1 3.47Å; A78-T81 PolarHBondContact O-N 3.07Å; Q79-T81 VanDerWaalsContact C-N 3.27Å; Q79-T81 PolarHBondContact O-N 2.72Å; T81-G84 PolarHBondContact O-N 3.5Å; T81-A85 VanDerWaalsContact O-CB 3.27Å; T81-A85 WeakPolarHBondContact O-CB 3.38Å; T81-A85 PolarHBondContact O-N 3.01Å
82	V	90	Very high	87.5	Confident	107 Å²	107	81.2 Å²	81.2	65%	0.648	51%	0.513	S	S	*	.	H	α-helix	trans	-65	-46.5	175.5	173.4	0	0	0	0	110.7	A78 Q79 G84 A85 G86	A78-V82 WeakPolarHBondContact O-CG2 3.28Å; A78-V82 PolarHBondContact O-N 3.46Å; Q79-V82 PolarHBondContact O-N 2.78Å; V82-G84 PolarHBondContact O-N 3.19Å; V82-A85 PolarHBondContact O-N 2.86Å; V82-G86 PolarHBondContact O-N 3.25Å
83	E	88.8	Confident	87	Confident	135 Å²	135	79.4 Å²	79.4	63%	0.631	51%	0.511	S	S	*	.	H	α-helix	trans	-60.5	-44.7	175	-71.7	173.4	-168.4	0	0	111.7	Q79 G86 N87	Q79-E83 WeakPolarHBondContact O-CG 3.21Å; Q79-E83 PolarHBondContact O-N 3.28Å; E83-G86 PolarHBondContact O-N 2.87Å; E83-N87 WeakPolarHBondContact O-CB 3.5Å; E83-N87 PolarHBondContact O-N 2.75Å
84	G	86.4	Confident	86.4	Confident	29 Å²	29	84.6 Å²	84.6	30%	0.299	53%	0.531	S	S	.	.	H	α-helix	trans	-62.7	-44.9	177.4	0	0	0	0	0	112.6	K80 T81 V82 N87 I88	K80-G84 PolarHBondContact O-N 3.46Å; T81-G84 PolarHBondContact O-N 3.5Å; V82-G84 PolarHBondContact O-N 3.19Å; G84-N87 PolarHBondContact O-N 3.35Å; G84-I88 WeakPolarHBondContact O-CD1 3.11Å; G84-I88 VanDerWaalsContact O-CG1 3.24Å; G84-I88 WeakPolarHBondContact O-CG1 3.42Å; G84-I88 PolarHBondContact O-N 2.89Å
85	A	85.4	Confident	85.7	Confident	56 Å²	56	84.4 Å²	84.4	46%	0.463	53%	0.53	S	S	.	.	H	α-helix	trans	-63.3	-42.7	175.7	0	0	0	0	0	111.5	T81 V82 I88 A89	T81-A85 VanDerWaalsContact O-CB 3.27Å; T81-A85 WeakPolarHBondContact O-CB 3.38Å; T81-A85 PolarHBondContact O-N 3.01Å; V82-A85 PolarHBondContact O-N 2.86Å; A85-I88 PolarHBondContact O-N 2.69Å; A85-A89 WeakPolarHBondContact O-CB 3.42Å; A85-A89 PolarHBondContact O-N 3.42Å
86	G	84.6	Confident	84.8	Confident	41 Å²	41	91.6 Å²	91.6	42%	0.423	56%	0.555	S	S	.	*	H	α-helix	trans	-61	-43.3	174.2	0	0	0	0	0	112.3	V82 E83 A89 A90	V82-G86 PolarHBondContact O-N 3.25Å; E83-G86 PolarHBondContact O-N 2.87Å; G86-A89 PolarHBondContact O-N 3.19Å; G86-A90 VanDerWaalsContact O-CB 3.3Å; G86-A90 WeakPolarHBondContact O-CB 3.25Å; G86-A90 PolarHBondContact O-N 3.25Å
87	N	87.8	Confident	83.9	Confident	116 Å²	116	96.2 Å²	96.2	62%	0.62	57%	0.566	S	S	*	*	H	α-helix	trans	-66.4	-39	177.4	-169.6	49.3	0	0	0	112.4	E83 G84 A91	E83-N87 WeakPolarHBondContact O-CB 3.5Å; E83-N87 PolarHBondContact O-N 2.75Å; G84-N87 PolarHBondContact O-N 3.35Å; N87-A91 VanDerWaalsContact O-CB 3.24Å; N87-A91 WeakPolarHBondContact O-CB 3.45Å; N87-A91 PolarHBondContact O-N 3.45Å
88	I	85.5	Confident	82.6	Confident	110 Å²	110	99 Å²	99	56%	0.564	58%	0.577	S	S	*	*	H	α-helix	trans	-64.1	-48.2	173.3	-67.5	162.8	0	0	0	110	G84 A85 A90 A91 T92	G84-I88 WeakPolarHBondContact O-CD1 3.11Å; G84-I88 VanDerWaalsContact O-CG1 3.24Å; G84-I88 WeakPolarHBondContact O-CG1 3.42Å; G84-I88 PolarHBondContact O-N 2.89Å; A85-I88 PolarHBondContact O-N 2.69Å; I88-A90 VanDerWaalsContact C-N 3.31Å; I88-A90 PolarHBondContact O-N 3Å; I88-A91 PolarHBondContact O-N 3.39Å; I88-T92 HydrophobicContact CG2-CG2 4.21Å; I88-T92 WeakPolarHBondContact O-CB 3.17Å; I88-T92 VanDerWaalsContact O-CG2 3.25Å; I88-T92 WeakPolarHBondContact O-CG2 3.31Å; I88-T92 PolarHBondContact O-N 3.36Å; I88-T92 PolarHBondContact O-OG1 3.28Å; I88-T92 VanDerWaalsContact O-OG1 3.09Å
89	A	81.3	Confident	81.2	Confident	33 Å²	33	101 Å²	101	27%	0.273	58%	0.577	S	S	.	*	H	α-helix	trans	-58.9	-43.6	178.5	0	0	0	0	0	111.6	A85 G86 T92 G93 L94	A85-A89 WeakPolarHBondContact O-CB 3.42Å; A85-A89 PolarHBondContact O-N 3.42Å; G86-A89 PolarHBondContact O-N 3.19Å; A89-T92 WeakPolarHBondContact CA-OG1 3.17Å; A89-T92 PolarHBondContact O-N 3.43Å; A89-T92 PolarHBondContact O-OG1 3.03Å; A89-G93 PolarHBondContact O-N 3.37Å; A89-L94 HydrophobicContact CB-CD2 3.86Å; A89-L94 PolarHBondContact O-N 3.36Å
90	A	80.7	Confident	79.8	Confident	70 Å²	70	103.7 Å²	103.7	58%	0.579	60%	0.595	S	S	*	*	H	α-helix	trans	-63.4	-45.3	174.6	0	0	0	0	0	112.4	G86 I88 T92 G93	G86-A90 VanDerWaalsContact O-CB 3.3Å; G86-A90 WeakPolarHBondContact O-CB 3.25Å; G86-A90 PolarHBondContact O-N 3.25Å; I88-A90 VanDerWaalsContact C-N 3.31Å; I88-A90 PolarHBondContact O-N 3Å; A90-T92 VanDerWaalsContact C-N 3.33Å; A90-T92 PolarHBondContact O-N 3.2Å; A90-G93 PolarHBondContact O-N 3.09Å
91	A	80.5	Confident	77.8	Confident	85 Å²	85	99.5 Å²	99.5	70%	0.702	59%	0.59	S	S	*	*	H	α-helix	trans	-65.8	-33.8	178	0	0	0	0	0	112.8	N87 I88 G93	N87-A91 VanDerWaalsContact O-CB 3.24Å; N87-A91 WeakPolarHBondContact O-CB 3.45Å; N87-A91 PolarHBondContact O-N 3.45Å; I88-A91 PolarHBondContact O-N 3.39Å; A91-G93 PolarHBondContact O-N 3.26Å
92	T	81.2	Confident	76.1	Confident	76 Å²	76	104.3 Å²	104.3	47%	0.466	60%	0.603	S	S	.	*	T	Hydrogen-bonded Turn	trans	-76.3	-6.2	173.5	60.7	0	0	0	0	113.3	I88 A89 A90 L94 V95	I88-T92 HydrophobicContact CG2-CG2 4.21Å; I88-T92 WeakPolarHBondContact O-CB 3.17Å; I88-T92 VanDerWaalsContact O-CG2 3.25Å; I88-T92 WeakPolarHBondContact O-CG2 3.31Å; I88-T92 PolarHBondContact O-N 3.36Å; I88-T92 PolarHBondContact O-OG1 3.28Å; I88-T92 VanDerWaalsContact O-OG1 3.09Å; A89-T92 WeakPolarHBondContact CA-OG1 3.17Å; A89-T92 PolarHBondContact O-N 3.43Å; A89-T92 PolarHBondContact O-OG1 3.03Å; A90-T92 VanDerWaalsContact C-N 3.33Å; A90-T92 PolarHBondContact O-N 3.2Å; T92-L94 PolarHBondContact O-N 2.92Å; T92-V95 WeakPolarHBondContact O-CG2 3.49Å
93	G	79.8	Confident	74.5	Confident	52 Å²	52	105 Å²	105	54%	0.536	60%	0.599	S	S	.	*	T	Hydrogen-bonded Turn	trans	66	20	178.9	0	0	0	0	0	114.7	A89 A90 A91 V95	A89-G93 PolarHBondContact O-N 3.37Å; A90-G93 PolarHBondContact O-N 3.09Å; A91-G93 PolarHBondContact O-N 3.26Å; G93-V95 PolarHBondContact O-N 3.06Å; G93-V95 VanDerWaalsContact O-N 3.17Å
94	L	78.2	Confident	72.8	Confident	143 Å²	143	105.3 Å²	105.3	75%	0.749	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	54.3	30	-177.7	-56.8	175.3	0	0	0	114.1	A89 T92	A89-L94 HydrophobicContact CB-CD2 3.86Å; A89-L94 PolarHBondContact O-N 3.36Å; T92-L94 PolarHBondContact O-N 2.92Å
95	V	75.7	Confident	71.3	Confident	88 Å²	88	112.9 Å²	112.9	53%	0.533	63%	0.633	S	S	.	*			trans	-78	135.5	-179.1	-57	0	0	0	0	111.3	T92 G93 K97	T92-V95 WeakPolarHBondContact O-CG2 3.49Å; G93-V95 PolarHBondContact O-N 3.06Å; G93-V95 VanDerWaalsContact O-N 3.17Å; V95-K97 VanDerWaalsContact C-N 3.32Å
96	K	71.2	Confident	69.8	Low	216 Å²	216	119 Å²	119	94%	0.939	65%	0.652	S	S	*	*	S	Bend	trans	-70.8	-27.8	178.3	-70.4	-177.4	179.9	178	0	113.1
97	K	70.1	Confident	67.8	Low	150 Å²	150	119.8 Å²	119.8	65%	0.652	66%	0.659	S	S	*	*	S	Bend	trans	-142.9	132.2	177.7	-70.6	179.2	178.7	165.4	0	108.1	V95 Q99	V95-K97 VanDerWaalsContact C-N 3.32Å; K97-Q99 HydrophobicContact CB-CG 4Å; K97-Q99 PolarHBondContact O-N 3.1Å
98	D	67.1	Low	66.1	Low	151 Å²	151	124.1 Å²	124.1	81%	0.807	67%	0.673	S	S	*	*			trans	-73	80.5	170.9	-168.5	9.7	0	0	0	108.5
99	Q	58.5	Low	64.3	Low	96 Å²	96	127.7 Å²	127.7	45%	0.449	69%	0.692	S	S	.	*			trans	-111.2	97.8	179	-77	-175.6	98.1	0	0	109.1	K97 A101 Q103	K97-Q99 HydrophobicContact CB-CG 4Å; K97-Q99 PolarHBondContact O-N 3.1Å; Q99-A101 PolarHBondContact O-N 2.99Å; Q99-Q103 VanDerWaalsContact CD-NE2 3.28Å
100	L	59.9	Low	63	Low	176 Å²	176	134.9 Å²	134.9	92%	0.921	72%	0.721	S	S	*	*			trans	-78	8.6	173.2	-149.3	101.1	0	0	0	113.2
101	A	51.4	Low	61.8	Low	71 Å²	71	141.3 Å²	141.3	59%	0.587	74%	0.738	S	S	*	*	S	Bend	trans	-115.1	126.9	-179.7	0	0	0	0	0	109.7	Q99 Q103	Q99-A101 PolarHBondContact O-N 2.99Å; A101-Q103 PolarHBondContact O-N 3.06Å
102	K	53.8	Low	60.8	Low	190 Å²	190	139.8 Å²	139.8	83%	0.826	73%	0.731	S	S	*	*			trans	-50.2	111.8	170.4	-70.1	177.3	-179.1	177.8	0	108.5	N104	K102-N104 HydrophobicContact CB-CB 4.34Å; K102-N104 PolarHBondContact O-N 3.15Å
103	Q	57.5	Low	59.7	Low	121 Å²	121	144.3 Å²	144.3	57%	0.565	75%	0.749	S	S	*	*			trans	-71.6	32.5	167.7	-66.5	-170.8	-43	0	0	111.7	Q99 A101	Q99-Q103 VanDerWaalsContact CD-NE2 3.28Å; A101-Q103 PolarHBondContact O-N 3.06Å
104	N	53.4	Low	58.8	Low	141 Å²	141	148.5 Å²	148.5	75%	0.754	76%	0.764	S	S	*	*			trans	-107.2	37.2	-174.1	-66.4	9	0	0	0	111.9	K102	K102-N104 HydrophobicContact CB-CB 4.34Å; K102-N104 PolarHBondContact O-N 3.15Å
105	E	53.4	Low	57.7	Low	189 Å²	189	148.5 Å²	148.5	88%	0.883	77%	0.765	S	S	*	*			trans	-115.7	32.7	163.2	-74.9	-171.9	162.6	0	0	111.1	G107	E105-G107 PolarHBondContact O-N 2.76Å
106	E	55	Low	56.9	Low	185 Å²	185	150.1 Å²	150.1	86%	0.864	77%	0.77	S	S	*	*			trans	-74.5	72.6	161.9	-68.7	-173	174.6	0	0	109
107	G	42.8	Very low	56.2	Low	56 Å²	56	147 Å²	147	58%	0.577	77%	0.77	S	S	*	*			trans	-122.9	46	-175.3	0	0	0	0	0	112.6	E105	E105-G107 PolarHBondContact O-N 2.76Å
108	F	50.9	Low	55.6	Low	207 Å²	207	141.6 Å²	141.6	91%	0.908	76%	0.756	S	S	*	*			trans	-151.1	112.6	159.9	-90.9	-82.1	0	0	0	109.3	Q110	F108-Q110 PolarHBondContact O-N 3.19Å
109	L	48	Very low	55.3	Low	185 Å²	185	139 Å²	139	97%	0.969	76%	0.755	S	S	*	*			trans	-65.2	99.1	168.4	-64.7	169.5	0	0	0	107.9
110	Q	54.7	Low	55.8	Low	185 Å²	185	138.9 Å²	138.9	86%	0.864	77%	0.771	S	S	*	*			trans	-99	91.5	168.8	-169	167.5	38.2	0	0	108.3	F108 G112	F108-Q110 PolarHBondContact O-N 3.19Å; Q110-G112 VanDerWaalsContact C-N 3.26Å; Q110-G112 PolarHBondContact O-N 2.95Å
111	E	54.7	Low	56.5	Low	204 Å²	204	137.1 Å²	137.1	95%	0.953	77%	0.767	S	S	*	*			trans	-67.5	90.7	160.9	-89.4	-175	145.1	0	0	108
112	G	59.6	Low	57.5	Low	53 Å²	53	138 Å²	138	55%	0.546	76%	0.762	S	S	.	*			trans	-114.7	120.4	167.4	0	0	0	0	0	108.9	Q110 V114	Q110-G112 VanDerWaalsContact C-N 3.26Å; Q110-G112 PolarHBondContact O-N 2.95Å; G112-V114 PolarHBondContact O-N 3.4Å
113	M	57.4	Low	58.7	Low	171 Å²	171	134.3 Å²	134.3	84%	0.842	76%	0.758	S	S	*	*			trans	-57.8	123.5	164.7	-69.7	179.9	-175.8	0	0	107.7	N115	M113-N115 VanDerWaalsContact C-N 3.27Å; M113-N115 PolarHBondContact O-N 2.71Å
114	V	61	Low	59.7	Low	140 Å²	140	134 Å²	134	85%	0.848	76%	0.76	S	S	*	*			trans	-65.2	91.6	174.9	-124.9	0	0	0	0	107.2	G112 N116	G112-V114 PolarHBondContact O-N 3.4Å; V114-N116 PolarHBondContact O-N 3.2Å
115	N	56.8	Low	60.7	Low	144 Å²	144	132.6 Å²	132.6	77%	0.77	75%	0.752	S	S	*	*			trans	-75.6	43.8	173.7	-68.6	-28	0	0	0	110.5	M113 T117	M113-N115 VanDerWaalsContact C-N 3.27Å; M113-N115 PolarHBondContact O-N 2.71Å; N115-T117 PolarHBondContact O-N 3.5Å
116	N	57.6	Low	61.8	Low	122 Å²	122	131.6 Å²	131.6	65%	0.652	75%	0.748	S	S	*	*			trans	-77.1	104.1	169.1	-162.8	6.6	0	0	0	106.7	V114 G118	V114-N116 PolarHBondContact O-N 3.2Å; N116-G118 CarbonylContact O-C 3.55Å; N116-G118 PolarHBondContact O-N 3.26Å; N116-G118 VanDerWaalsContact O-O 3.14Å
117	T	56.3	Low	63	Low	151 Å²	151	125.6 Å²	125.6	93%	0.926	73%	0.73	S	S	*	*	S	Bend	trans	-66.2	11	178.4	-27.3	0	0	0	0	113.2	N115	N115-T117 PolarHBondContact O-N 3.5Å
118	G	57.6	Low	64.6	Low	36 Å²	36	134.4 Å²	134.4	37%	0.371	75%	0.747	S	S	.	*	S	Bend	trans	-118.5	124.9	162	0	0	0	0	0	108.2	N116 A120	N116-G118 CarbonylContact O-C 3.55Å; N116-G118 PolarHBondContact O-N 3.26Å; N116-G118 VanDerWaalsContact O-O 3.14Å; G118-A120 PolarHBondContact O-N 3.39Å
119	A	62.1	Low	65.7	Low	95 Å²	95	132.1 Å²	132.1	79%	0.785	74%	0.739	S	S	*	*			trans	-43.4	140.1	175.1	0	0	0	0	0	110.4	V121	A119-V121 PolarHBondContact O-N 3.41Å; A119-V121 VanDerWaalsContact O-N 3.15Å
120	A	68.1	Low	67.1	Low	94 Å²	94	127.6 Å²	127.6	78%	0.777	71%	0.714	S	S	*	*			trans	-49.2	127.4	171.2	0	0	0	0	0	108.2	G118 D122	G118-A120 PolarHBondContact O-N 3.39Å; A120-D122 VanDerWaalsContact C-N 3.34Å; A120-D122 PolarHBondContact O-N 2.74Å
121	V	75.1	Confident	68.3	Low	139 Å²	139	122.4 Å²	122.4	84%	0.842	70%	0.697	S	S	*	*			trans	-69.1	101.1	176.1	179.5	0	0	0	0	106	A119 P123	A119-V121 PolarHBondContact O-N 3.41Å; A119-V121 VanDerWaalsContact O-N 3.15Å; V121-P123 WeakPolarHBondContact O-CD 3.47Å
122	D	73	Confident	69.3	Low	89 Å²	89	119 Å²	119	48%	0.476	69%	0.693	S	S	.	*			trans	-74.4	113.6	168	-158.8	-27.4	0	0	0	107.6	A120 D124	A120-D122 VanDerWaalsContact C-N 3.34Å; A120-D122 PolarHBondContact O-N 2.74Å; D122-D124 PolarHBondContact O-N 3.2Å; D122-D124 WeakPolarHBondContact OD1-CB 3.39Å; D122-D124 PolarHBondContact OD1-N 2.82Å
123	P	78.6	Confident	69.7	Low	114 Å²	114	125 Å²	125	74%	0.74	71%	0.706	S	S	*	*	S	Bend	trans	-69.8	-22.1	177	31.2	-35.5	0	0	0	111.6	V121 N125	V121-P123 WeakPolarHBondContact O-CD 3.47Å; P123-N125 PolarHBondContact O-N 3.43Å
124	D	78.6	Confident	70	Confident	114 Å²	114	122.4 Å²	122.4	61%	0.61	69%	0.692	S	S	*	*	S	Bend	trans	-82.7	117.5	179.1	-64.5	-33.7	0	0	0	107.8	D122 E126	D122-D124 PolarHBondContact O-N 3.2Å; D122-D124 WeakPolarHBondContact OD1-CB 3.39Å; D122-D124 PolarHBondContact OD1-N 2.82Å; D124-E126 PolarHBondContact O-N 3.44Å
125	N	73.7	Confident	70	Confident	111 Å²	111	124.4 Å²	124.4	59%	0.594	69%	0.692	S	S	*	*			trans	-70.8	102.5	166.8	-171.1	25.5	0	0	0	106.1	P123 A127	P123-N125 PolarHBondContact O-N 3.43Å; N125-A127 PolarHBondContact O-N 3.32Å
126	E	77.1	Confident	70.5	Confident	169 Å²	169	125.7 Å²	125.7	79%	0.79	69%	0.687	S	S	*	*	S	Bend	trans	-63.1	22	177.9	-69.3	-77.3	-176.8	0	0	113.7	D124	D124-E126 PolarHBondContact O-N 3.44Å
127	A	78.8	Confident	71.1	Confident	58 Å²	58	128.2 Å²	128.2	48%	0.479	70%	0.695	S	S	.	*	S	Bend	trans	-120	140.2	177	0	0	0	0	0	109.5	N125 E129	N125-A127 PolarHBondContact O-N 3.32Å; A127-E129 PolarHBondContact O-N 3.3Å
128	Y	76.7	Confident	72	Confident	241 Å²	241	128 Å²	128	95%	0.945	69%	0.688	S	S	*	*			trans	-62.6	104.8	165.8	-82.3	-85.8	0	0	0	109
129	E	75	Confident	72.9	Confident	159 Å²	159	136 Å²	136	74%	0.743	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-80.2	124.6	173.4	-166.9	169.3	-178	0	0	109	A127	A127-E129 PolarHBondContact O-N 3.3Å
130	M	76.8	Confident	73.3	Confident	90 Å²	90	140.3 Å²	140.3	44%	0.443	71%	0.713	S	S	.	*	P	Polyproline II helix	trans	-66.8	136.3	174.8	-63.9	-148.2	-51.7	0	0	109.2	Y136	M130-Y136 HydrophobicContact CE-CE1 4.1Å; M130-Y136 HydrophobicContact CE-CE2 4.46Å; M130-Y136 WeakPolarHBondContact CE-OH 3.28Å
131	P	79.2	Confident	73.7	Confident	77 Å²	77	141.5 Å²	141.5	50%	0.5	71%	0.713	S	S	.	*	P	Polyproline II helix	trans	-59.5	143.1	177.5	26.1	-33.3	0	0	0	109.5	E133 E134	P131-E133 PolarHBondContact O-N 3.15Å; P131-E134 PolarHBondContact O-N 3.49Å
132	P	75.6	Confident	73.7	Confident	133 Å²	133	144.3 Å²	144.3	86%	0.864	72%	0.717	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.5	-2	-179.4	27.5	-35.8	0	0	0	113.8	E134	P132-E134 VanDerWaalsContact C-N 3.34Å
133	E	69.3	Low	73.2	Confident	179 Å²	179	148.4 Å²	148.4	84%	0.836	76%	0.763	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.8	-15.3	176.9	-60.4	-173.2	179.9	0	0	113.2	P131 E135	P131-E133 PolarHBondContact O-N 3.15Å; E133-E135 PolarHBondContact O-N 3.28Å; E133-E135 VanDerWaalsContact O-N 3.1Å
134	E	62.8	Low	72.9	Confident	116 Å²	116	150.2 Å²	150.2	54%	0.542	76%	0.764	S	S	.	*	S	Bend	trans	-78.7	91.9	167.8	-68.4	-159	-179.4	0	0	109.5	P131 P132 Y136	P131-E134 PolarHBondContact O-N 3.49Å; P132-E134 VanDerWaalsContact C-N 3.34Å; E134-Y136 PolarHBondContact O-N 3.1Å
135	E	61.9	Low	72.6	Confident	182 Å²	182	152.1 Å²	152.1	85%	0.85	77%	0.772	S	S	*	*			trans	-57.9	104.1	170.6	-169.7	171.6	-155.4	0	0	109	E133 Q137	E133-E135 PolarHBondContact O-N 3.28Å; E133-E135 VanDerWaalsContact O-N 3.1Å; E135-Q137 PolarHBondContact O-N 3.46Å; E135-Q137 VanDerWaalsContact O-N 3.07Å
136	Y	66.2	Low	72.6	Confident	171 Å²	171	154.3 Å²	154.3	67%	0.671	78%	0.782	S	S	*	*			trans	-59	113.8	170.6	-72.5	-92	0	0	0	107.9	M130 E134 D138	M130-Y136 HydrophobicContact CE-CE1 4.1Å; M130-Y136 HydrophobicContact CE-CE2 4.46Å; M130-Y136 WeakPolarHBondContact CE-OH 3.28Å; E134-Y136 PolarHBondContact O-N 3.1Å; Y136-D138 PolarHBondContact O-N 3.01Å
137	Q	69.8	Low	72.3	Confident	175 Å²	175	153.5 Å²	153.5	82%	0.818	78%	0.782	S	S	*	*			trans	-69.5	98.7	171.3	-73	-177.5	15.9	0	0	108.3	E135 Y139	E135-Q137 PolarHBondContact O-N 3.46Å; E135-Q137 VanDerWaalsContact O-N 3.07Å; Q137-Y139 PolarHBondContact O-N 3.23Å
138	D	75.4	Confident	71.9	Confident	146 Å²	146	159.4 Å²	159.4	78%	0.781	80%	0.8	S	S	*	*			trans	-72.1	14	176.3	-83.9	-19.7	0	0	0	113.7	Y136	Y136-D138 PolarHBondContact O-N 3.01Å
139	Y	76.3	Confident	71.6	Confident	205 Å²	205	154 Å²	154	80%	0.804	79%	0.791	S	S	*	*	S	Bend	trans	-127.3	123.8	-178.8	-61.3	-86	0	0	0	110.7	Q137	Q137-Y139 PolarHBondContact O-N 3.23Å
140	E	71.9	Confident	71.4	Confident	184 Å²	184	153.6 Å²	153.6	86%	0.86	79%	0.794	S	S	*	*			trans	-68.1	130.8	167.2	-81.6	-174.7	140.3	0	0	109.8	E142	E140-E142 PolarHBondContact O-N 3.36Å; E140-E142 VanDerWaalsContact O-N 3.09Å
141	P	75.7	Confident	70.9	Confident	120 Å²	120	158.5 Å²	158.5	78%	0.779	82%	0.821	S	S	*	*			trans	-71.3	105.4	171.1	28.3	-31	0	0	0	108.7	A143	P141-A143 PolarHBondContact O-N 3.28Å
142	E	75.6	Confident	70.2	Confident	198 Å²	198	165.3 Å²	165.3	93%	0.925	85%	0.848	S	S	*	*			trans	-56.2	132.1	175.6	-67.3	-152.4	174.4	0	0	111.2	E140	E140-E142 PolarHBondContact O-N 3.36Å; E140-E142 VanDerWaalsContact O-N 3.09Å
143	A	62.5	Low	69.8	Low	175 Å²	175	168.3 Å²	168.3	100%	1.446	85%	0.847	S	S	*	*			trans	-85.9	0	179.3	0	0	0	0	0	112.6	P141	P141-A143 PolarHBondContact O-N 3.28Å

Retrieved 143 of 143 residues in 330.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).