GPHA2_HUMAN Loading...

Glycoprotein hormone alpha-2

Functions as a heterodimeric glycoprotein hormone with GPHB5 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production¹. Plays a central role in controlling thyroid cell metabolism².

AlphaFold DB , UniProt , Accession Q96T91, Species HUMAN (Homo sapiens, Human), Gene GPHA2, Length 129 aa.

						>GPHA2_HUMAN|Q96T91|GPHA2
MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.4	Low	78.1	Confident	228 Å²	228	117.5 Å²	117.5	100%	1.123	66%	0.662	S	S	*	*				0	113.6	0	-67.5	-175.4	158.3	0	0	107.4	M3	M1-M3 PolarHBondContact O-N 2.66Å; M1-M3 VanDerWaalsContact O-N 3.16Å
2	P	62.9	Low	79	Confident	140 Å²	140	120.9 Å²	120.9	91%	0.909	66%	0.658	S	S	*	*			trans	-69	113	179	27.1	-29.6	0	0	0	108.7	A4	P2-A4 PolarHBondContact O-N 2.87Å
3	M	68.9	Low	79.8	Confident	186 Å²	186	120.5 Å²	120.5	92%	0.916	65%	0.654	S	S	*	*	P	Polyproline II helix	trans	-69.3	118.8	170.6	-72.8	-173.2	169.8	0	0	107.5	M1 S5	M1-M3 PolarHBondContact O-N 2.66Å; M1-M3 VanDerWaalsContact O-N 3.16Å; M3-S5 PolarHBondContact O-N 3.3Å
4	A	69.2	Low	80.4	Confident	64 Å²	64	119.4 Å²	119.4	53%	0.529	65%	0.647	S	S	.	*	P	Polyproline II helix	trans	-54.6	128.1	171	0	0	0	0	0	108.3	P2	P2-A4 PolarHBondContact O-N 2.87Å
5	S	81.3	Confident	80.7	Confident	49 Å²	49	117 Å²	117	34%	0.343	64%	0.637	S	S	.	*	P	Polyproline II helix	trans	-61.3	148.1	178.4	82.1	0	0	0	0	109.2	M3 Q7 T8 L9	M3-S5 PolarHBondContact O-N 3.3Å; S5-Q7 PolarHBondContact O-N 2.96Å; S5-Q7 VanDerWaalsContact O-N 3.08Å; S5-T8 WeakPolarHBondContact O-CB 3.04Å; S5-T8 PolarHBondContact O-N 3.31Å; S5-T8 PolarHBondContact OG-N 2.8Å; S5-T8 PolarHBondContact OG-OG1 3.25Å; S5-L9 PolarHBondContact O-N 2.04Å
6	P	82.6	Confident	80.9	Confident	103 Å²	103	114.1 Å²	114.1	67%	0.669	62%	0.621	S	S	*	*	H	α-helix	trans	-55.3	-30	177.7	20.1	-31.7	0	0	0	112.3	L9 V10	P6-L9 PolarHBondContact O-N 3.3Å; P6-V10 WeakPolarHBondContact O-CG2 3.41Å; P6-V10 PolarHBondContact O-N 3.02Å; P6-V10 VanDerWaalsContact O-N 3.13Å
7	Q	86.2	Confident	80.9	Confident	151 Å²	151	110.6 Å²	110.6	71%	0.706	61%	0.61	S	S	*	*	H	α-helix	trans	-65.7	-37.4	175.2	-61.5	-175.9	-3.2	0	0	112.5	S5 V10 L11	S5-Q7 PolarHBondContact O-N 2.96Å; S5-Q7 VanDerWaalsContact O-N 3.08Å; Q7-V10 PolarHBondContact O-N 3.46Å; Q7-L11 WeakPolarHBondContact O-CB 3.42Å; Q7-L11 PolarHBondContact O-N 3.38Å
8	T	87.1	Confident	80.6	Confident	75 Å²	75	108.9 Å²	108.9	46%	0.46	60%	0.603	S	S	.	*	H	α-helix	trans	-67.3	-39.2	178.2	-43.4	0	0	0	0	111.3	S5 L11 Y12	S5-T8 WeakPolarHBondContact O-CB 3.04Å; S5-T8 PolarHBondContact O-N 3.31Å; S5-T8 PolarHBondContact OG-N 2.8Å; S5-T8 PolarHBondContact OG-OG1 3.25Å; T8-L11 PolarHBondContact O-N 3.42Å; T8-Y12 PolarHBondContact O-N 2.63Å
9	L	88.7	Confident	80.1	Confident	103 Å²	103	107.4 Å²	107.4	54%	0.539	60%	0.597	S	S	.	*	H	α-helix	trans	-64.1	-44.2	174.7	-82	163.9	0	0	0	111.9	S5 P6 Y12 L13	S5-L9 PolarHBondContact O-N 2.04Å; P6-L9 PolarHBondContact O-N 3.3Å; L9-Y12 PolarHBondContact O-N 3.24Å; L9-L13 WeakPolarHBondContact O-CG 2.97Å; L9-L13 PolarHBondContact O-N 3.18Å
10	V	90	Very high	79.1	Confident	82 Å²	82	108.3 Å²	108.3	50%	0.497	60%	0.597	S	S	.	*	H	α-helix	trans	-62.2	-44	176.8	173.6	0	0	0	0	111.1	P6 Q7 Y12 L13 L14	P6-V10 WeakPolarHBondContact O-CG2 3.41Å; P6-V10 PolarHBondContact O-N 3.02Å; P6-V10 VanDerWaalsContact O-N 3.13Å; Q7-V10 PolarHBondContact O-N 3.46Å; V10-Y12 VanDerWaalsContact C-N 3.33Å; V10-Y12 PolarHBondContact O-N 3.04Å; V10-L13 PolarHBondContact O-N 3.37Å; V10-L14 HydrophobicContact CG1-CD1 3.95Å; V10-L14 HydrophobicContact CG1-CG 4.46Å; V10-L14 WeakPolarHBondContact O-CB 3.44Å; V10-L14 VanDerWaalsContact O-CG 3.3Å; V10-L14 WeakPolarHBondContact O-CG 3.23Å; V10-L14 PolarHBondContact O-N 3.44Å
11	L	90.5	Very high	78.2	Confident	112 Å²	112	105.8 Å²	105.8	59%	0.586	59%	0.59	S	S	*	*	H	α-helix	trans	-59.7	-42.2	174.7	-102.9	140.4	0	0	0	112.3	Q7 T8 L14 V15	Q7-L11 WeakPolarHBondContact O-CB 3.42Å; Q7-L11 PolarHBondContact O-N 3.38Å; T8-L11 PolarHBondContact O-N 3.42Å; L11-L14 PolarHBondContact O-N 2.69Å; L11-V15 VanDerWaalsContact O-CG2 3.31Å; L11-V15 WeakPolarHBondContact O-CG2 3.08Å; L11-V15 PolarHBondContact O-N 2.93Å
12	Y	89.3	Confident	78.5	Confident	158 Å²	158	105.2 Å²	105.2	62%	0.62	58%	0.576	S	S	*	*	H	α-helix	trans	-65.9	-43.1	179.1	-155.7	-97.6	0	0	0	112.1	T8 L9 V10 L14 V15 L16	T8-Y12 PolarHBondContact O-N 2.63Å; L9-Y12 PolarHBondContact O-N 3.24Å; V10-Y12 VanDerWaalsContact C-N 3.33Å; V10-Y12 PolarHBondContact O-N 3.04Å; Y12-L14 VanDerWaalsContact C-N 3.34Å; Y12-L14 PolarHBondContact O-N 2.94Å; Y12-V15 PolarHBondContact O-N 3.06Å; Y12-L16 HydrophobicContact CD1-CD1 3.74Å; Y12-L16 HydrophobicContact CD1-CG 4.25Å; Y12-L16 HydrophobicContact CE1-CD1 3.82Å; Y12-L16 HydrophobicContact CE1-CG 4.26Å; Y12-L16 WeakPolarHBondContact O-CG 3.47Å; Y12-L16 PolarHBondContact O-N 3.17Å
13	L	89.5	Confident	78.1	Confident	116 Å²	116	101.3 Å²	101.3	61%	0.607	56%	0.561	S	S	*	*	H	α-helix	trans	-63.1	-40.1	175.1	-72.4	169.2	0	0	0	112	L9 V10 L16 A17	L9-L13 WeakPolarHBondContact O-CG 2.97Å; L9-L13 PolarHBondContact O-N 3.18Å; V10-L13 PolarHBondContact O-N 3.37Å; L13-L16 PolarHBondContact O-N 2.95Å; L13-A17 WeakPolarHBondContact O-CB 3.42Å; L13-A17 PolarHBondContact O-N 2.93Å
14	L	88.3	Confident	77.3	Confident	105 Å²	105	98.9 Å²	98.9	55%	0.55	55%	0.547	S	S	.	.	H	α-helix	trans	-63.8	-43.8	175.1	-75.1	167.5	0	0	0	111.6	V10 L11 Y12 A17 V18	V10-L14 HydrophobicContact CG1-CD1 3.95Å; V10-L14 HydrophobicContact CG1-CG 4.46Å; V10-L14 WeakPolarHBondContact O-CB 3.44Å; V10-L14 VanDerWaalsContact O-CG 3.3Å; V10-L14 WeakPolarHBondContact O-CG 3.23Å; V10-L14 PolarHBondContact O-N 3.44Å; L11-L14 PolarHBondContact O-N 2.69Å; Y12-L14 VanDerWaalsContact C-N 3.34Å; Y12-L14 PolarHBondContact O-N 2.94Å; L14-A17 PolarHBondContact O-N 2.78Å; L14-V18 WeakPolarHBondContact O-CG2 3.28Å; L14-V18 PolarHBondContact O-N 2.91Å
15	V	85.2	Confident	76.6	Confident	83 Å²	83	104.4 Å²	104.4	50%	0.503	56%	0.562	S	S	.	*	H	α-helix	trans	-61.2	-46.2	176.5	171.6	0	0	0	0	110.6	L11 Y12 A17 V18 T19	L11-V15 VanDerWaalsContact O-CG2 3.31Å; L11-V15 WeakPolarHBondContact O-CG2 3.08Å; L11-V15 PolarHBondContact O-N 2.93Å; Y12-V15 PolarHBondContact O-N 3.06Å; V15-A17 PolarHBondContact O-N 2.84Å; V15-V18 PolarHBondContact O-N 2.97Å; V15-T19 HydrophobicContact CG1-CG2 4.44Å; V15-T19 WeakPolarHBondContact O-CG2 3.43Å; V15-T19 PolarHBondContact O-N 2.9Å; V15-T19 PolarHBondContact O-OG1 3.33Å
16	L	83.2	Confident	75.3	Confident	71 Å²	71	104.9 Å²	104.9	37%	0.372	57%	0.569	S	S	.	*	H	α-helix	trans	-58.5	-49.1	176.4	-73.6	170.6	0	0	0	111.8	Y12 L13 V18 T19 E20	Y12-L16 HydrophobicContact CD1-CD1 3.74Å; Y12-L16 HydrophobicContact CD1-CG 4.25Å; Y12-L16 HydrophobicContact CE1-CD1 3.82Å; Y12-L16 HydrophobicContact CE1-CG 4.26Å; Y12-L16 WeakPolarHBondContact O-CG 3.47Å; Y12-L16 PolarHBondContact O-N 3.17Å; L13-L16 PolarHBondContact O-N 2.95Å; L16-V18 VanDerWaalsContact C-N 3.31Å; L16-V18 PolarHBondContact O-N 2.86Å; L16-T19 WeakPolarHBondContact CA-OG1 3.17Å; L16-T19 PolarHBondContact O-N 2.85Å; L16-T19 VanDerWaalsContact O-N 3.15Å; L16-T19 PolarHBondContact O-OG1 2.84Å; L16-E20 WeakPolarHBondContact O-CG 3.4Å; L16-E20 PolarHBondContact O-N 2.91Å
17	A	80.5	Confident	74.4	Confident	54 Å²	54	103.9 Å²	103.9	45%	0.446	56%	0.561	S	S	.	*	H	α-helix	trans	-60.7	-38.4	178.8	0	0	0	0	0	112.7	L13 L14 V15 A21	L13-A17 WeakPolarHBondContact O-CB 3.42Å; L13-A17 PolarHBondContact O-N 2.93Å; L14-A17 PolarHBondContact O-N 2.78Å; V15-A17 PolarHBondContact O-N 2.84Å; A17-A21 VanDerWaalsContact O-CB 3.31Å; A17-A21 WeakPolarHBondContact O-CB 3.49Å; A17-A21 PolarHBondContact O-N 3.47Å
18	V	75.7	Confident	73.7	Confident	80 Å²	80	102.2 Å²	102.2	49%	0.485	56%	0.556	S	S	.	*	H	α-helix	trans	-69.2	-39.7	176.2	175	0	0	0	0	111.1	L14 V15 L16 A21 W22	L14-V18 WeakPolarHBondContact O-CG2 3.28Å; L14-V18 PolarHBondContact O-N 2.91Å; V15-V18 PolarHBondContact O-N 2.97Å; L16-V18 VanDerWaalsContact C-N 3.31Å; L16-V18 PolarHBondContact O-N 2.86Å; V18-A21 PolarHBondContact O-N 2.75Å; V18-W22 HydrophobicContact CG1-CE3 4.32Å; V18-W22 HydrophobicContact CG1-CZ3 4.5Å; V18-W22 PolarHBondContact O-N 2.99Å
19	T	72	Confident	73.5	Confident	80 Å²	80	104.1 Å²	104.1	49%	0.491	57%	0.569	S	S	.	*	H	α-helix	trans	-67.3	-36.1	176.2	58.8	0	0	0	0	113	V15 L16 G23	V15-T19 HydrophobicContact CG1-CG2 4.44Å; V15-T19 WeakPolarHBondContact O-CG2 3.43Å; V15-T19 PolarHBondContact O-N 2.9Å; V15-T19 PolarHBondContact O-OG1 3.33Å; L16-T19 WeakPolarHBondContact CA-OG1 3.17Å; L16-T19 PolarHBondContact O-N 2.85Å; L16-T19 VanDerWaalsContact O-N 3.15Å; L16-T19 PolarHBondContact O-OG1 2.84Å; T19-G23 PolarHBondContact O-N 3.36Å
20	E	60.6	Low	73.6	Confident	126 Å²	126	100.3 Å²	100.3	59%	0.589	55%	0.554	S	S	*	*	H	α-helix	trans	-69.3	-39.7	174.8	-71.2	-178.7	-179.2	0	0	111.6	L16 W22 G23 Q24	L16-E20 WeakPolarHBondContact O-CG 3.4Å; L16-E20 PolarHBondContact O-N 2.91Å; E20-W22 PolarHBondContact O-N 3.44Å; E20-G23 PolarHBondContact O-N 3.1Å; E20-G23 VanDerWaalsContact O-N 3.17Å; E20-Q24 PolarHBondContact O-N 2.89Å
21	A	59.3	Low	73.9	Confident	55 Å²	55	97.4 Å²	97.4	46%	0.455	54%	0.538	S	S	.	.	H	α-helix	trans	-65.5	-36.5	177	0	0	0	0	0	112.7	A17 V18 G23 Q24	A17-A21 VanDerWaalsContact O-CB 3.31Å; A17-A21 WeakPolarHBondContact O-CB 3.49Å; A17-A21 PolarHBondContact O-N 3.47Å; V18-A21 PolarHBondContact O-N 2.75Å; A21-G23 VanDerWaalsContact C-N 3.27Å; A21-G23 PolarHBondContact O-N 3.37Å; A21-Q24 WeakPolarHBondContact O-CB 3.27Å; A21-Q24 PolarHBondContact O-N 2.87Å; A21-Q24 VanDerWaalsContact O-N 3.09Å
22	W	57	Low	74.1	Confident	217 Å²	217	95.5 Å²	95.5	82%	0.822	53%	0.526	S	S	*	.	H	α-helix	trans	-70.7	-21.4	174.1	-101.6	-27.6	0	0	0	113.8	V18 E20 Q24	V18-W22 HydrophobicContact CG1-CE3 4.32Å; V18-W22 HydrophobicContact CG1-CZ3 4.5Å; V18-W22 PolarHBondContact O-N 2.99Å; E20-W22 PolarHBondContact O-N 3.44Å; W22-Q24 VanDerWaalsContact C-N 3.32Å
23	G	54.2	Low	74.5	Confident	57 Å²	57	91.5 Å²	91.5	59%	0.588	51%	0.514	S	S	*	.	H	α-helix	trans	-79.8	-14.6	169	0	0	0	0	0	113.6	T19 E20 A21 E25 A26	T19-G23 PolarHBondContact O-N 3.36Å; E20-G23 PolarHBondContact O-N 3.1Å; E20-G23 VanDerWaalsContact O-N 3.17Å; A21-G23 VanDerWaalsContact C-N 3.27Å; A21-G23 PolarHBondContact O-N 3.37Å; G23-E25 PolarHBondContact O-N 2.72Å; G23-A26 PolarHBondContact O-N 3.33Å
24	Q	53	Low	74.8	Confident	136 Å²	136	90.4 Å²	90.4	64%	0.636	51%	0.506	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.1	12.3	-175.2	-85.5	160.9	-2.1	0	0	115.4	E20 A21 W22 A26	E20-Q24 PolarHBondContact O-N 2.89Å; A21-Q24 WeakPolarHBondContact O-CB 3.27Å; A21-Q24 PolarHBondContact O-N 2.87Å; A21-Q24 VanDerWaalsContact O-N 3.09Å; W22-Q24 VanDerWaalsContact C-N 3.32Å; Q24-A26 HydrophobicContact CB-CB 4.44Å; Q24-A26 HydrophobicContact CG-CB 4.47Å; Q24-A26 WeakPolarHBondContact O-CB 3.34Å; Q24-A26 PolarHBondContact O-N 3.39Å
25	E	55.3	Low	75.2	Confident	179 Å²	179	88.7 Å²	88.7	84%	0.836	50%	0.502	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.4	2.3	145.8	-143.1	75.9	-140.1	0	0	111.3	G23 V27	G23-E25 PolarHBondContact O-N 2.72Å; E25-V27 PolarHBondContact O-N 3.01Å
26	A	53.7	Low	75.7	Confident	60 Å²	60	88.8 Å²	88.8	50%	0.496	50%	0.495	S	S	.	.			trans	3.3	77.1	148.1	0	0	0	0	0	112.3	G23 Q24 I28	G23-A26 PolarHBondContact O-N 3.33Å; Q24-A26 HydrophobicContact CB-CB 4.44Å; Q24-A26 HydrophobicContact CG-CB 4.47Å; Q24-A26 WeakPolarHBondContact O-CB 3.34Å; Q24-A26 PolarHBondContact O-N 3.39Å; A26-I28 PolarHBondContact O-N 3.25Å
27	V	64	Low	76.4	Confident	82 Å²	82	91.3 Å²	91.3	50%	0.497	51%	0.509	S	S	.	.			trans	-0.5	92.1	150.1	-178.6	0	0	0	0	110.3	E25 P29 H60	E25-V27 PolarHBondContact O-N 3.01Å; V27-P29 WeakPolarHBondContact O-CD 3.46Å; V27-H60 HydrophobicContact CG1-CB 3.99Å; V27-H60 WeakPolarHBondContact CG1-ND1 3.02Å
28	I	70.6	Confident	77	Confident	116 Å²	116	90.3 Å²	90.3	60%	0.595	50%	0.497	S	S	*	.			trans	-54.4	115.5	168.1	-62.8	170.1	0	0	0	105	A26 G30	A26-I28 PolarHBondContact O-N 3.25Å; I28-G30 PolarHBondContact O-N 3.44Å
29	P	82.1	Confident	77.9	Confident	115 Å²	115	91.1 Å²	91.1	75%	0.747	50%	0.503	S	S	*	.	B	Isolated β-bridge	trans	-60.6	144.4	-178.5	24.1	-32.4	0	0	0	109.1	V27	V27-P29 WeakPolarHBondContact O-CD 3.46Å
30	G	92.4	Very high	79	Confident	22 Å²	22	88.6 Å²	88.6	23%	0.227	49%	0.487	C	S	.	.	E	Extended strand (participates in β ladder)	trans	101.8	-161.3	-175.5	0	0	0	0	0	113.2	I28 G59 H60	I28-G30 PolarHBondContact O-N 3.44Å; G30-G59 CarbonylContact O-C 3.56Å; G30-G59 VanDerWaalsContact O-CA 3.24Å; G30-G59 WeakPolarHBondContact O-CA 3.4Å; G30-H60 CarbonylContact C-O 3.58Å; G30-H60 WeakPolarHBondContact CA-O 3.49Å; G30-H60 PolarHBondContact N-O 2.94Å; G30-H60 PolarHBondContact O-N 2.86Å
31	C	95.4	Very high	80.6	Confident	22 Å²	22	89.4 Å²	89.4	15%	0.149	49%	0.485	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	121.3	-168.9	-178.3	0	0	0	0	109.2	C89 Q120	C31-C89 HydrophobicContact CB-CB 3.73Å; C31-C89 WeakPolarHBondContact CB-SG 3.36Å; C31-C89 WeakPolarHBondContact SG-CA 3.32Å; C31-C89 WeakPolarHBondContact SG-CB 3.39Å; C31-C89 CovalentContact SG-SG 2.03Å; C31-C89 PolarHBondContact SG-SG 2.98Å; C31-Q120 PolarHBondContact SG-O 3.45Å; C31-Q120 VanDerWaalsContact SG-O 3.41Å
32	H	95	Very high	82.1	Confident	72 Å²	72	89.5 Å²	89.5	33%	0.333	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.8	164.3	-170	58.7	-89.9	0	0	0	112.4	C57 V58	H32-C57 WeakPolarHBondContact O-CA 3.48Å; H32-V58 PolarHBondContact N-O 3Å; H32-V58 PolarHBondContact ND1-O 2.92Å; H32-V58 WeakPolarHBondContact NE2-CG2 3.47Å; H32-V58 PolarHBondContact O-N 3.5Å
33	L	96.9	Very high	83.6	Confident	73 Å²	73	81.1 Å²	81.1	38%	0.382	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.4	133.8	177.9	-70.7	165.8	0	0	0	110.5	Q55 A56 A116 C119	L33-Q55 HydrophobicContact CD2-CB 3.89Å; L33-A56 CarbonylContact C-O 3.59Å; L33-A56 WeakPolarHBondContact CA-O 3.41Å; L33-A116 HydrophobicContact CD2-CB 3.73Å; L33-C119 WeakPolarHBondContact CD2-SG 3.47Å
34	H	95.6	Very high	85.3	Confident	93 Å²	93	90.9 Å²	90.9	43%	0.431	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	120.1	174.4	-178.1	75.4	0	0	0	110.7	Q55 A56 V58	H34-Q55 WeakPolarHBondContact O-CA 3.48Å; H34-A56 PolarHBondContact N-O 2.9Å; H34-A56 PolarHBondContact O-N 2.91Å; H34-V58 HydrophobicContact CB-CB 4.43Å; H34-V58 HydrophobicContact CB-CG1 3.97Å; H34-V58 HydrophobicContact CB-CG2 3.59Å
35	P	97.2	Very high	86.9	Confident	70 Å²	70	92.6 Å²	92.6	46%	0.455	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.3	134.5	177.8	29.2	-32.8	0	0	0	110.9	V53 A54	P35-V53 HydrophobicContact CB-CG1 3.86Å; P35-A54 CarbonylContact C-O 3.4Å; P35-A54 VanDerWaalsContact CA-O 3.32Å; P35-A54 WeakPolarHBondContact CA-O 3.24Å
36	F	96.5	Very high	88.5	Confident	84 Å²	84	85 Å²	85	37%	0.368	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.6	148.6	174.8	72.1	-71.9	0	0	0	111.8	V38 V53 A54 A56	F36-V38 HydrophobicContact CD2-CG1 3.58Å; F36-V38 HydrophobicContact CE2-CG1 3.06Å; F36-V38 HydrophobicContact CZ-CG1 3.66Å; F36-V53 CarbonylContact O-C 3.39Å; F36-A54 HydrophobicContact CD1-CB 4.19Å; F36-A54 HydrophobicContact CE1-CB 3.65Å; F36-A54 HydrophobicContact CZ-CB 3.85Å; F36-A54 PolarHBondContact N-O 3.3Å; F36-A54 PolarHBondContact O-N 2.8Å; F36-A56 HydrophobicContact CD1-CB 3.81Å; F36-A56 HydrophobicContact CE1-CB 3.54Å; F36-A56 HydrophobicContact CZ-CB 4.35Å
37	N	96.5	Very high	90.3	Very high	125 Å²	125	84.9 Å²	84.9	67%	0.668	44%	0.444	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79.7	124.7	178.2	-71.7	-45.2	0	0	0	110.3
38	V	94.9	Very high	91.7	Very high	32 Å²	32	81.6 Å²	81.6	19%	0.194	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	136.4	171.2	-66.5	0	0	0	0	110.2	F36 V40 S51 H52 A54 I113	F36-V38 HydrophobicContact CD2-CG1 3.58Å; F36-V38 HydrophobicContact CE2-CG1 3.06Å; F36-V38 HydrophobicContact CZ-CG1 3.66Å; V38-V40 HydrophobicContact CG2-CG2 4.49Å; V38-S51 WeakPolarHBondContact O-CA 2.99Å; V38-S51 PolarHBondContact O-OG 3.32Å; V38-H52 HydrophobicContact CG2-CB 4.33Å; V38-H52 VanDerWaalsContact CG2-O 3.26Å; V38-H52 WeakPolarHBondContact CG2-O 3.48Å; V38-H52 PolarHBondContact N-O 3.06Å; V38-H52 PolarHBondContact O-N 3.29Å; V38-A54 HydrophobicContact CG1-CB 4Å; V38-A54 HydrophobicContact CG2-CB 3.78Å; V38-I113 HydrophobicContact CG2-CD1 3.76Å
39	T	94.6	Very high	92.8	Very high	98 Å²	98	80.4 Å²	80.4	60%	0.601	42%	0.416	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.4	133.5	168.1	51.4	0	0	0	0	108.7	G50	T39-G50 WeakPolarHBondContact CA-O 3.32Å
40	V	94.1	Very high	93.4	Very high	26 Å²	26	75.5 Å²	75.5	16%	0.158	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	140.4	-177.7	-146.1	0	0	0	0	108.7	V38 Q49 G50 V99 L111 I113	V38-V40 HydrophobicContact CG2-CG2 4.49Å; V40-Q49 CarbonylContact O-C 3.53Å; V40-Q49 VanDerWaalsContact O-CA 3.27Å; V40-Q49 WeakPolarHBondContact O-CA 3.4Å; V40-G50 PolarHBondContact N-O 2.03Å; V40-G50 PolarHBondContact O-N 3.02Å; V40-V99 HydrophobicContact CG2-CG1 4.45Å; V40-L111 HydrophobicContact CB-CD2 4.1Å; V40-L111 HydrophobicContact CG1-CD2 3.35Å; V40-I113 HydrophobicContact CG1-CG2 3.88Å; V40-I113 HydrophobicContact CG2-CD1 4.23Å; V40-I113 HydrophobicContact CG2-CG2 3.97Å
41	R	93.9	Very high	93.5	Very high	144 Å²	144	78.2 Å²	78.2	54%	0.543	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.5	136.7	-179.1	-59.5	-179.2	177.8	119.8	1.7	109	C48 Q49	R41-C48 WeakPolarHBondContact CA-O 3.38Å; R41-Q49 HydrophobicContact CG-CB 3.95Å
42	S	90.9	Very high	93.6	Very high	57 Å²	57	79.5 Å²	79.5	40%	0.399	41%	0.406	S	S	.	.	S	Bend	trans	-83.6	-20.1	173.1	58.1	0	0	0	0	112.4	C48 E109	S42-C48 PolarHBondContact N-O 2.03Å; S42-C48 WeakPolarHBondContact OG-CB 3.26Å; S42-E109 PolarHBondContact OG-OE2 3.31Å
43	D	88.8	Confident	93.7	Very high	41 Å²	41	79.7 Å²	79.7	22%	0.219	41%	0.412	C	S	.	.	S	Bend	trans	-128.6	158.2	-176.7	71.2	-45.9	0	0	0	113	Q45 G46 T47 C48	D43-Q45 VanDerWaalsContact C-N 3.29Å; D43-Q45 PolarHBondContact O-N 2.85Å; D43-Q45 WeakPolarHBondContact OD2-CB 3.45Å; D43-Q45 PolarHBondContact OD2-N 3.09Å; D43-G46 PolarHBondContact O-N 3Å; D43-G46 WeakPolarHBondContact OD1-CA 3.1Å; D43-G46 PolarHBondContact OD1-N 3.11Å; D43-G46 PolarHBondContact OD2-N 3.01Å; D43-T47 VanDerWaalsContact CG-OG1 3.23Å; D43-T47 PolarHBondContact OD1-N 3.41Å; D43-T47 WeakPolarHBondContact OD2-CB 3.28Å; D43-T47 PolarHBondContact OD2-N 3.43Å; D43-T47 PolarHBondContact OD2-OG1 2.03Å; D43-C48 PolarHBondContact OD1-N 2.95Å
44	R	89.1	Confident	93.7	Very high	261 Å²	261	76.4 Å²	76.4	99%	0.985	40%	0.395	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.6	-25.9	179	-66.9	-172.1	-178.6	-169.8	1.1	113.4	G46	R44-G46 VanDerWaalsContact C-N 3.3Å
45	Q	88.3	Confident	93.8	Very high	172 Å²	172	74.9 Å²	74.9	80%	0.804	39%	0.388	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.8	-14.3	-179.1	-64.8	174.2	-23.6	0	0	111.9	D43 T47	D43-Q45 VanDerWaalsContact C-N 3.29Å; D43-Q45 PolarHBondContact O-N 2.85Å; D43-Q45 WeakPolarHBondContact OD2-CB 3.45Å; D43-Q45 PolarHBondContact OD2-N 3.09Å; Q45-T47 VanDerWaalsContact C-N 3.28Å; Q45-T47 HydrophobicContact CB-CG2 3.97Å
46	G	87.3	Confident	93.7	Very high	21 Å²	21	72.9 Å²	72.9	22%	0.216	38%	0.377	C	S	.	.			trans	70.1	24.9	-177.7	0	0	0	0	0	113.3	D43 R44 C48	D43-G46 PolarHBondContact O-N 3Å; D43-G46 WeakPolarHBondContact OD1-CA 3.1Å; D43-G46 PolarHBondContact OD1-N 3.11Å; D43-G46 PolarHBondContact OD2-N 3.01Å; R44-G46 VanDerWaalsContact C-N 3.3Å; G46-C48 PolarHBondContact O-N 3.3Å
47	T	91.5	Very high	93.7	Very high	57 Å²	57	70.1 Å²	70.1	35%	0.35	37%	0.368	S	S	.	.	S	Bend	trans	-70.8	-22	175.2	61.6	0	0	0	0	112	D43 Q45 C103 V104	D43-T47 VanDerWaalsContact CG-OG1 3.23Å; D43-T47 PolarHBondContact OD1-N 3.41Å; D43-T47 WeakPolarHBondContact OD2-CB 3.28Å; D43-T47 PolarHBondContact OD2-N 3.43Å; D43-T47 PolarHBondContact OD2-OG1 2.03Å; Q45-T47 VanDerWaalsContact C-N 3.28Å; Q45-T47 HydrophobicContact CB-CG2 3.97Å; T47-C103 CarbonylContact O-C 3.57Å; T47-C103 VanDerWaalsContact O-CA 3.23Å; T47-C103 WeakPolarHBondContact O-CA 3.35Å; T47-V104 HydrophobicContact CG2-CG2 4.16Å; T47-V104 PolarHBondContact O-N 3.35Å
48	C	93.8	Very high	93.6	Very high	12 Å²	12	66.7 Å²	66.7	8%	0.081	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126	107.6	176.6	-73.2	0	0	0	0	110.1	R41 S42 D43 G46 Q102 C103	R41-C48 WeakPolarHBondContact CA-O 3.38Å; S42-C48 PolarHBondContact N-O 2.03Å; S42-C48 WeakPolarHBondContact OG-CB 3.26Å; D43-C48 PolarHBondContact OD1-N 2.95Å; G46-C48 PolarHBondContact O-N 3.3Å; C48-Q102 WeakPolarHBondContact CA-O 3.18Å; C48-C103 HydrophobicContact CB-CB 4.13Å; C48-C103 WeakPolarHBondContact CB-SG 3.49Å; C48-C103 WeakPolarHBondContact SG-CB 3.48Å; C48-C103 CovalentContact SG-SG 2.04Å; C48-C103 PolarHBondContact SG-SG 3.3Å
49	Q	95	Very high	93.5	Very high	92 Å²	92	66.5 Å²	66.5	43%	0.43	36%	0.356	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.2	152.9	-178	70.1	175.5	16.7	0	0	113.6	V40 R41 Q102	V40-Q49 CarbonylContact O-C 3.53Å; V40-Q49 VanDerWaalsContact O-CA 3.27Å; V40-Q49 WeakPolarHBondContact O-CA 3.4Å; R41-Q49 HydrophobicContact CG-CB 3.95Å; Q49-Q102 PolarHBondContact N-O 3.15Å; Q49-Q102 PolarHBondContact O-N 2.93Å
50	G	94.4	Very high	93.3	Very high	12 Å²	12	67.9 Å²	67.9	12%	0.124	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.7	160.5	176	0	0	0	0	0	110.9	T39 V40	T39-G50 WeakPolarHBondContact CA-O 3.32Å; V40-G50 PolarHBondContact N-O 2.03Å; V40-G50 PolarHBondContact O-N 3.02Å
51	S	94.8	Very high	93.3	Very high	78 Å²	78	67.8 Å²	67.8	55%	0.545	36%	0.356	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	144	175.1	-173	0	0	0	0	109.6	V38	V38-S51 WeakPolarHBondContact O-CA 2.99Å; V38-S51 PolarHBondContact O-OG 3.32Å
52	H	96	Very high	93.2	Very high	50 Å²	50	68.6 Å²	68.6	23%	0.231	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.5	147.6	177.2	-173.9	-88.7	0	0	0	110.1	V38 A54 V99 I113	V38-H52 HydrophobicContact CG2-CB 4.33Å; V38-H52 VanDerWaalsContact CG2-O 3.26Å; V38-H52 WeakPolarHBondContact CG2-O 3.48Å; V38-H52 PolarHBondContact N-O 3.06Å; V38-H52 PolarHBondContact O-N 3.29Å; H52-A54 PolarHBondContact O-N 2.03Å; H52-V99 HydrophobicContact CB-CG1 4.12Å; H52-V99 HydrophobicContact CB-CG2 3.66Å; H52-I113 HydrophobicContact CB-CD1 4.26Å
53	V	96.9	Very high	93.4	Very high	76 Å²	76	69.2 Å²	69.2	46%	0.461	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.1	102.7	170.4	-178.9	0	0	0	0	108.2	P35 F36	P35-V53 HydrophobicContact CB-CG1 3.86Å; F36-V53 CarbonylContact O-C 3.39Å
54	A	97.1	Very high	93.7	Very high	4 Å²	4	70.2 Å²	70.2	3%	0.033	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.9	172.6	171	0	0	0	0	0	110.6	P35 F36 V38 H52	P35-A54 CarbonylContact C-O 3.4Å; P35-A54 VanDerWaalsContact CA-O 3.32Å; P35-A54 WeakPolarHBondContact CA-O 3.24Å; F36-A54 HydrophobicContact CD1-CB 4.19Å; F36-A54 HydrophobicContact CE1-CB 3.65Å; F36-A54 HydrophobicContact CZ-CB 3.85Å; F36-A54 PolarHBondContact N-O 3.3Å; F36-A54 PolarHBondContact O-N 2.8Å; V38-A54 HydrophobicContact CG1-CB 4Å; V38-A54 HydrophobicContact CG2-CB 3.78Å; H52-A54 PolarHBondContact O-N 2.03Å
55	Q	97.9	Very high	94	Very high	60 Å²	60	60.9 Å²	60.9	28%	0.28	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	129.1	178	-62.5	-70.2	-23.7	0	0	108.1	L33 H34 T115 A116	L33-Q55 HydrophobicContact CD2-CB 3.89Å; H34-Q55 WeakPolarHBondContact O-CA 3.48Å; Q55-T115 WeakPolarHBondContact CA-OG1 3.37Å; Q55-T115 WeakPolarHBondContact CB-OG1 3.46Å; Q55-T115 PolarHBondContact N-OG1 3.37Å; Q55-T115 PolarHBondContact O-OG1 2.94Å; Q55-A116 HydrophobicContact CB-CB 4.19Å; Q55-A116 VanDerWaalsContact CB-O 3.28Å; Q55-A116 WeakPolarHBondContact CB-O 3.46Å; Q55-A116 WeakPolarHBondContact O-CB 3.49Å; Q55-A116 PolarHBondContact O-N 3.38Å
56	A	96.2	Very high	94.5	Very high	28 Å²	28	56.7 Å²	56.7	23%	0.231	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	166.9	171.7	0	0	0	0	0	109.9	L33 H34 F36	L33-A56 CarbonylContact C-O 3.59Å; L33-A56 WeakPolarHBondContact CA-O 3.41Å; H34-A56 PolarHBondContact N-O 2.9Å; H34-A56 PolarHBondContact O-N 2.91Å; F36-A56 HydrophobicContact CD1-CB 3.81Å; F36-A56 HydrophobicContact CE1-CB 3.54Å; F36-A56 HydrophobicContact CZ-CB 4.35Å
57	C	95.3	Very high	95	Very high	27 Å²	27	60.5 Å²	60.5	18%	0.182	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.1	124	169.7	-64.5	0	0	0	0	109.6	H32 I91 C119	H32-C57 WeakPolarHBondContact O-CA 3.48Å; C57-I91 HydrophobicContact CB-CG1 4.36Å; C57-C119 WeakPolarHBondContact CA-SG 3.2Å; C57-C119 HydrophobicContact CB-CB 3.75Å; C57-C119 WeakPolarHBondContact CB-SG 3.39Å; C57-C119 WeakPolarHBondContact SG-CA 3.31Å; C57-C119 WeakPolarHBondContact SG-CB 3.36Å; C57-C119 CovalentContact SG-SG 2.03Å; C57-C119 PolarHBondContact SG-SG 2.99Å
58	V	94.6	Very high	95.3	Very high	53 Å²	53	58.2 Å²	58.2	32%	0.321	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133	153.3	177.7	-54.9	0	0	0	0	109.9	H32 H34 C89	H32-V58 PolarHBondContact N-O 3Å; H32-V58 PolarHBondContact ND1-O 2.92Å; H32-V58 WeakPolarHBondContact NE2-CG2 3.47Å; H32-V58 PolarHBondContact O-N 3.5Å; H34-V58 HydrophobicContact CB-CB 4.43Å; H34-V58 HydrophobicContact CB-CG1 3.97Å; H34-V58 HydrophobicContact CB-CG2 3.59Å; V58-C89 VanDerWaalsContact C-SG 3.54Å
59	G	93.1	Very high	95.5	Very high	28 Å²	28	66.9 Å²	66.9	29%	0.289	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	137.7	-172.9	178.6	0	0	0	0	0	112.8	G30	G30-G59 CarbonylContact O-C 3.56Å; G30-G59 VanDerWaalsContact O-CA 3.24Å; G30-G59 WeakPolarHBondContact O-CA 3.4Å
60	H	91	Very high	95.6	Very high	127 Å²	127	70.3 Å²	70.3	59%	0.588	39%	0.387	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-130.3	131.8	-174.5	-62	80.3	0	0	0	109.7	V27 G30	V27-H60 HydrophobicContact CG1-CB 3.99Å; V27-H60 WeakPolarHBondContact CG1-ND1 3.02Å; G30-H60 CarbonylContact C-O 3.58Å; G30-H60 WeakPolarHBondContact CA-O 3.49Å; G30-H60 PolarHBondContact N-O 2.94Å; G30-H60 PolarHBondContact O-N 2.86Å
61	C	93	Very high	95.8	Very high	23 Å²	23	73.8 Å²	73.8	16%	0.155	41%	0.409	C	S	.	.			trans	-111.6	144.4	-177.9	-61.9	0	0	0	0	110.5	S63 Q87 C121	C61-S63 PolarHBondContact O-N 3.05Å; C61-Q87 HydrophobicContact CB-CB 3.69Å; C61-C121 HydrophobicContact CB-CB 3.62Å; C61-C121 WeakPolarHBondContact CB-SG 3.3Å; C61-C121 WeakPolarHBondContact SG-CA 3.43Å; C61-C121 WeakPolarHBondContact SG-CB 3.41Å; C61-C121 CovalentContact SG-SG 2.03Å; C61-C121 PolarHBondContact SG-SG 3.42Å
62	E	92.9	Very high	95.9	Very high	162 Å²	162	72.8 Å²	72.8	76%	0.757	40%	0.399	S	S	*	.			trans	-71.2	127.7	-179.7	-170.4	179.5	170.9	0	0	110.6	Q87	E62-Q87 WeakPolarHBondContact O-CB 2.97Å; E62-Q87 WeakPolarHBondContact O-CG 3.24Å; E62-Q87 PolarHBondContact O-OE1 3.49Å
63	S	94.1	Very high	96	Very high	69 Å²	69	72 Å²	72	48%	0.483	40%	0.397	S	S	.	.			trans	-115.8	145.7	173.9	-65	0	0	0	0	109.4	C61 V85 Q87	C61-S63 PolarHBondContact O-N 3.05Å; S63-V85 WeakPolarHBondContact CA-O 3.01Å; S63-Q87 PolarHBondContact OG-N 3.23Å; S63-Q87 PolarHBondContact OG-O 3.39Å
64	S	95.4	Very high	96.1	Very high	62 Å²	62	71.9 Å²	71.9	43%	0.434	40%	0.396	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.4	158.3	-178	60.4	0	0	0	0	111.8	S84 V85	S64-S84 CarbonylContact O-C 3.59Å; S64-S84 WeakPolarHBondContact O-CA 3.36Å; S64-V85 PolarHBondContact N-O 3.24Å; S64-V85 PolarHBondContact O-N 3.04Å
65	A	96.6	Very high	96.1	Very high	65 Å²	65	76 Å²	76	54%	0.537	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.5	136.6	172.3	0	0	0	0	0	108.8	I82 T83	A65-I82 HydrophobicContact CB-CG2 3.81Å; A65-T83 WeakPolarHBondContact CA-O 3.45Å
66	F	97.4	Very high	96	Very high	84 Å²	84	73.7 Å²	73.7	37%	0.368	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.3	160	-176.6	50.8	-93.4	0	0	0	110.5	S68 T83 V85	F66-S68 PolarHBondContact O-N 3.44Å; F66-T83 HydrophobicContact CE2-CG2 3.9Å; F66-T83 HydrophobicContact CZ-CG2 3.84Å; F66-T83 PolarHBondContact N-O 3.49Å; F66-T83 PolarHBondContact O-N 3.36Å; F66-V85 HydrophobicContact CE1-CG2 3.63Å; F66-V85 HydrophobicContact CZ-CG2 3.96Å
67	P	98.1	Very high	96.1	Very high	102 Å²	102	74.8 Å²	74.8	66%	0.662	44%	0.435	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-53.3	130.6	175.9	-26.9	35.7	0	0	0	111.6	R69	P67-R69 PolarHBondContact O-N 2.88Å
68	S	97.8	Very high	96.1	Very high	9 Å²	9	79.9 Å²	79.9	6%	0.063	45%	0.451	C	S	.	.	P	Polyproline II helix	trans	-58.9	138.4	179.2	-71.6	0	0	0	0	111.1	F66 H80 N81 I82 T83	F66-S68 PolarHBondContact O-N 3.44Å; S68-H80 WeakPolarHBondContact CB-O 3.43Å; S68-H80 PolarHBondContact OG-O 3.17Å; S68-N81 PolarHBondContact N-O 2.82Å; S68-N81 PolarHBondContact OG-O 2.71Å; S68-I82 PolarHBondContact OG-N 3.06Å; S68-I82 PolarHBondContact OG-O 2.66Å; S68-T83 WeakPolarHBondContact CA-OG1 3.29Å; S68-T83 WeakPolarHBondContact CB-OG1 3.34Å; S68-T83 PolarHBondContact OG-N 3.46Å; S68-T83 VanDerWaalsContact OG-N 3.17Å; S68-T83 PolarHBondContact OG-OG1 3.35Å
69	R	97.7	Very high	96.3	Very high	193 Å²	193	86.8 Å²	86.8	73%	0.728	47%	0.471	S	S	*	.	P	Polyproline II helix	trans	-57.7	148.6	171.6	-67.1	-175.7	176.7	-179	-0.8	109.8	P67 S71 V72 L73	P67-R69 PolarHBondContact O-N 2.88Å; R69-S71 PolarHBondContact O-N 2.8Å; R69-S71 VanDerWaalsContact O-N 3.09Å; R69-V72 WeakPolarHBondContact O-CB 3.02Å; R69-V72 PolarHBondContact O-N 2.98Å; R69-L73 PolarHBondContact O-N 3.38Å; R69-L73 VanDerWaalsContact O-N 3.14Å
70	Y	97.7	Very high	96.4	Very high	165 Å²	165	90.7 Å²	90.7	65%	0.647	48%	0.482	S	S	*	.	H	α-helix	trans	-51.6	-38.2	-178.7	-176.7	-101.1	0	0	0	113.3	V72 L73 V74	Y70-V72 VanDerWaalsContact C-N 3.33Å; Y70-V72 PolarHBondContact O-N 3.21Å; Y70-L73 WeakPolarHBondContact O-CB 3.43Å; Y70-L73 PolarHBondContact O-N 3.09Å; Y70-V74 HydrophobicContact CD1-CG2 4.12Å; Y70-V74 HydrophobicContact CE1-CG2 3.63Å; Y70-V74 HydrophobicContact CE2-CG2 4.16Å; Y70-V74 WeakPolarHBondContact O-CG2 3.37Å; Y70-V74 PolarHBondContact O-N 3.14Å
71	S	98.2	Very high	96.7	Very high	84 Å²	84	89.2 Å²	89.2	59%	0.587	48%	0.478	S	S	*	.	H	α-helix	trans	-60.3	-38.3	175.8	52.9	0	0	0	0	113.7	R69 A75	R69-S71 PolarHBondContact O-N 2.8Å; R69-S71 VanDerWaalsContact O-N 3.09Å; S71-A75 VanDerWaalsContact O-CB 3.27Å; S71-A75 WeakPolarHBondContact O-CB 3.4Å; S71-A75 PolarHBondContact O-N 2.99Å
72	V	97.4	Very high	96.9	Very high	57 Å²	57	92.9 Å²	92.9	35%	0.345	50%	0.495	S	S	.	.	H	α-helix	trans	-72.6	-37.8	177.2	178.1	0	0	0	0	110.8	R69 Y70 S76	R69-V72 WeakPolarHBondContact O-CB 3.02Å; R69-V72 PolarHBondContact O-N 2.98Å; Y70-V72 VanDerWaalsContact C-N 3.33Å; Y70-V72 PolarHBondContact O-N 3.21Å; V72-S76 VanDerWaalsContact O-CB 3.28Å; V72-S76 WeakPolarHBondContact O-CB 3.08Å; V72-S76 PolarHBondContact O-N 2.97Å; V72-S76 PolarHBondContact O-OG 3.5Å
73	L	98	Very high	97	Very high	34 Å²	34	87 Å²	87	18%	0.178	47%	0.471	C	S	.	.	H	α-helix	trans	-59.6	-52.6	174.9	-63.6	176.2	0	0	0	110.7	R69 Y70 A75 S76 G77 Y78 H80	R69-L73 PolarHBondContact O-N 3.38Å; R69-L73 VanDerWaalsContact O-N 3.14Å; Y70-L73 WeakPolarHBondContact O-CB 3.43Å; Y70-L73 PolarHBondContact O-N 3.09Å; L73-A75 PolarHBondContact O-N 3.26Å; L73-S76 PolarHBondContact O-N 3.47Å; L73-S76 PolarHBondContact O-OG 3.09Å; L73-G77 PolarHBondContact O-N 3.24Å; L73-Y78 HydrophobicContact CB-CD1 3.94Å; L73-Y78 HydrophobicContact CB-CE1 4.04Å; L73-Y78 WeakPolarHBondContact O-CA 3.08Å; L73-Y78 PolarHBondContact O-N 3.43Å; L73-H80 WeakPolarHBondContact CD2-O 3.08Å
74	V	98	Very high	97.1	Very high	73 Å²	73	87.8 Å²	87.8	44%	0.442	48%	0.476	S	S	.	.	H	α-helix	trans	-61.6	-46.6	179.2	175.6	0	0	0	0	111.2	Y70 S76 G77	Y70-V74 HydrophobicContact CD1-CG2 4.12Å; Y70-V74 HydrophobicContact CE1-CG2 3.63Å; Y70-V74 HydrophobicContact CE2-CG2 4.16Å; Y70-V74 WeakPolarHBondContact O-CG2 3.37Å; Y70-V74 PolarHBondContact O-N 3.14Å; V74-S76 PolarHBondContact O-N 3.14Å; V74-G77 PolarHBondContact O-N 3.26Å; V74-G77 VanDerWaalsContact O-N 3.14Å
75	A	97.8	Very high	97	Very high	90 Å²	90	87.3 Å²	87.3	74%	0.744	47%	0.471	S	S	*	.	H	α-helix	trans	-63.9	-28	-179.7	0	0	0	0	0	113.5	S71 L73	S71-A75 VanDerWaalsContact O-CB 3.27Å; S71-A75 WeakPolarHBondContact O-CB 3.4Å; S71-A75 PolarHBondContact O-N 2.99Å; L73-A75 PolarHBondContact O-N 3.26Å
76	S	96.8	Very high	96.9	Very high	12 Å²	12	87.1 Å²	87.1	8%	0.084	47%	0.465	C	S	.	.	H	α-helix	trans	-89.4	-3.7	178.2	62.7	0	0	0	0	114.5	V72 L73 V74 Y78 R79 H80	V72-S76 VanDerWaalsContact O-CB 3.28Å; V72-S76 WeakPolarHBondContact O-CB 3.08Å; V72-S76 PolarHBondContact O-N 2.97Å; V72-S76 PolarHBondContact O-OG 3.5Å; L73-S76 PolarHBondContact O-N 3.47Å; L73-S76 PolarHBondContact O-OG 3.09Å; V74-S76 PolarHBondContact O-N 3.14Å; S76-Y78 VanDerWaalsContact C-N 3.3Å; S76-R79 WeakPolarHBondContact O-CB 3.31Å; S76-R79 PolarHBondContact O-N 3.03Å; S76-R79 PolarHBondContact O-NE 2.79Å; S76-R79 PolarHBondContact OG-N 2.82Å; S76-H80 WeakPolarHBondContact CB-ND1 3.04Å; S76-H80 PolarHBondContact OG-N 2.8Å
77	G	97.3	Very high	96.7	Very high	52 Å²	52	86.7 Å²	86.7	54%	0.536	46%	0.464	S	S	.	.	T	Hydrogen-bonded Turn	trans	62.8	38.9	-167.6	0	0	0	0	0	111.9	L73 V74 R79	L73-G77 PolarHBondContact O-N 3.24Å; V74-G77 PolarHBondContact O-N 3.26Å; V74-G77 VanDerWaalsContact O-N 3.14Å; G77-R79 PolarHBondContact O-N 3.24Å
78	Y	96	Very high	96.5	Very high	133 Å²	133	84.4 Å²	84.4	52%	0.522	45%	0.45	S	S	.	.	S	Bend	trans	58.8	28	-177.9	-60.5	-93.2	0	0	0	114.4	L73 S76 N81	L73-Y78 HydrophobicContact CB-CD1 3.94Å; L73-Y78 HydrophobicContact CB-CE1 4.04Å; L73-Y78 WeakPolarHBondContact O-CA 3.08Å; L73-Y78 PolarHBondContact O-N 3.43Å; S76-Y78 VanDerWaalsContact C-N 3.3Å; Y78-N81 PolarHBondContact O-OD1 3.44Å
79	R	97.7	Very high	96.4	Very high	199 Å²	199	85.8 Å²	85.8	75%	0.751	46%	0.459	S	S	*	.			trans	-92	-22.4	177.2	-66.8	-176.2	-67.7	153.3	-4.3	113.6	S76 G77	S76-R79 WeakPolarHBondContact O-CB 3.31Å; S76-R79 PolarHBondContact O-N 3.03Å; S76-R79 PolarHBondContact O-NE 2.79Å; S76-R79 PolarHBondContact OG-N 2.82Å; G77-R79 PolarHBondContact O-N 3.24Å
80	H	96.4	Very high	96.2	Very high	109 Å²	109	79.2 Å²	79.2	51%	0.505	44%	0.441	S	S	.	.			trans	-111.9	78.5	-179	-62.8	106.2	0	0	0	110.4	S68 L73 S76 I82	S68-H80 WeakPolarHBondContact CB-O 3.43Å; S68-H80 PolarHBondContact OG-O 3.17Å; L73-H80 WeakPolarHBondContact CD2-O 3.08Å; S76-H80 WeakPolarHBondContact CB-ND1 3.04Å; S76-H80 PolarHBondContact OG-N 2.8Å; H80-I82 VanDerWaalsContact C-N 3.34Å
81	N	96.5	Very high	96.1	Very high	96 Å²	96	75.1 Å²	75.1	51%	0.513	43%	0.429	S	S	.	.			trans	-75.7	-23.3	-174.2	-64.1	-3.9	0	0	0	113.7	S68 Y78	S68-N81 PolarHBondContact N-O 2.82Å; S68-N81 PolarHBondContact OG-O 2.71Å; Y78-N81 PolarHBondContact O-OD1 3.44Å
82	I	97.3	Very high	96	Very high	100 Å²	100	73.7 Å²	73.7	51%	0.513	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.9	132.8	179.6	-58	-60.8	0	0	0	108.4	A65 S68 H80	A65-I82 HydrophobicContact CB-CG2 3.81Å; S68-I82 PolarHBondContact OG-N 3.06Å; S68-I82 PolarHBondContact OG-O 2.66Å; H80-I82 VanDerWaalsContact C-N 3.34Å
83	T	95.5	Very high	96	Very high	39 Å²	39	72 Å²	72	24%	0.239	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.4	126.4	169.7	-64.5	0	0	0	0	108.3	A65 F66 S68	A65-T83 WeakPolarHBondContact CA-O 3.45Å; F66-T83 HydrophobicContact CE2-CG2 3.9Å; F66-T83 HydrophobicContact CZ-CG2 3.84Å; F66-T83 PolarHBondContact N-O 3.49Å; F66-T83 PolarHBondContact O-N 3.36Å; S68-T83 WeakPolarHBondContact CA-OG1 3.29Å; S68-T83 WeakPolarHBondContact CB-OG1 3.34Å; S68-T83 PolarHBondContact OG-N 3.46Å; S68-T83 VanDerWaalsContact OG-N 3.17Å; S68-T83 PolarHBondContact OG-OG1 3.35Å
84	S	94.9	Very high	96	Very high	86 Å²	86	75.1 Å²	75.1	60%	0.601	43%	0.43	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.1	133.6	177.3	-55.7	0	0	0	0	110.4	S64	S64-S84 CarbonylContact O-C 3.59Å; S64-S84 WeakPolarHBondContact O-CA 3.36Å
85	V	93.6	Very high	95.9	Very high	52 Å²	52	77.1 Å²	77.1	32%	0.315	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	104.9	170	176.8	0	0	0	0	107.4	S63 S64 F66	S63-V85 WeakPolarHBondContact CA-O 3.01Å; S64-V85 PolarHBondContact N-O 3.24Å; S64-V85 PolarHBondContact O-N 3.04Å; F66-V85 HydrophobicContact CE1-CG2 3.63Å; F66-V85 HydrophobicContact CZ-CG2 3.96Å
86	S	94.4	Very high	95.9	Very high	60 Å²	60	78.7 Å²	78.7	42%	0.42	42%	0.422	S	S	.	.			trans	-95.3	122.2	176.6	51.5	0	0	0	0	110.5	M123 C124	S86-M123 WeakPolarHBondContact O-CA 3.31Å; S86-C124 PolarHBondContact O-N 3.29Å
87	Q	93.9	Very high	95.9	Very high	75 Å²	75	79 Å²	79	35%	0.35	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	135	172.7	-60.6	-171.3	-8.1	0	0	110.3	C61 E62 S63 D122	C61-Q87 HydrophobicContact CB-CB 3.69Å; E62-Q87 WeakPolarHBondContact O-CB 2.97Å; E62-Q87 WeakPolarHBondContact O-CG 3.24Å; E62-Q87 PolarHBondContact O-OE1 3.49Å; S63-Q87 PolarHBondContact OG-N 3.23Å; S63-Q87 PolarHBondContact OG-O 3.39Å; Q87-D122 CarbonylContact C-O 3.58Å; Q87-D122 VanDerWaalsContact CA-O 3.29Å; Q87-D122 WeakPolarHBondContact CA-O 3.47Å
88	C	94.2	Very high	95.9	Very high	55 Å²	55	82.4 Å²	82.4	37%	0.372	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	150.3	177.7	-76	0	0	0	0	110	T90 D122 C124	C88-T90 PolarHBondContact O-N 3.01Å; C88-D122 PolarHBondContact N-O 2.99Å; C88-D122 PolarHBondContact O-N 3.26Å; C88-D122 VanDerWaalsContact O-N 3.11Å; C88-C124 HydrophobicContact CB-CB 3.92Å; C88-C124 WeakPolarHBondContact CB-SG 3.35Å; C88-C124 PolarHBondContact N-SG 3.27Å; C88-C124 WeakPolarHBondContact SG-CB 3.42Å; C88-C124 CovalentContact SG-SG 2.03Å; C88-C124 PolarHBondContact SG-SG 2.9Å
89	C	94.5	Very high	95.9	Very high	37 Å²	37	76.2 Å²	76.2	25%	0.25	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74	121.9	172.2	-179.1	0	0	0	0	109.4	C31 V58	C31-C89 HydrophobicContact CB-CB 3.73Å; C31-C89 WeakPolarHBondContact CB-SG 3.36Å; C31-C89 WeakPolarHBondContact SG-CA 3.32Å; C31-C89 WeakPolarHBondContact SG-CB 3.39Å; C31-C89 CovalentContact SG-SG 2.03Å; C31-C89 PolarHBondContact SG-SG 2.98Å; V58-C89 VanDerWaalsContact C-SG 3.54Å
90	T	94.4	Very high	95.8	Very high	56 Å²	56	73 Å²	73	34%	0.344	39%	0.393	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.7	162.1	-176.7	-169.3	0	0	0	0	112.3	C88 S92 C119 Q120 D122	C88-T90 PolarHBondContact O-N 3.01Å; T90-S92 PolarHBondContact O-N 3.46Å; T90-C119 WeakPolarHBondContact O-CA 3.48Å; T90-Q120 HydrophobicContact CG2-CG 4.27Å; T90-Q120 PolarHBondContact N-O 3.13Å; T90-Q120 PolarHBondContact O-N 3.23Å; T90-D122 HydrophobicContact CG2-CB 3.76Å
91	I	95.9	Very high	95.8	Very high	79 Å²	79	67.9 Å²	67.9	41%	0.405	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.3	118.2	173.6	-58.6	174	0	0	0	108.7	C57 G93 L94 A116	C57-I91 HydrophobicContact CB-CG1 4.36Å; I91-G93 WeakPolarHBondContact CG2-O 3.06Å; I91-L94 HydrophobicContact CD1-CD2 4.19Å; I91-L94 HydrophobicContact CG2-CD2 3.75Å; I91-L94 HydrophobicContact CG2-CG 4.06Å; I91-A116 HydrophobicContact CD1-CB 4.24Å; I91-A116 HydrophobicContact CG1-CB 4.07Å; I91-A116 HydrophobicContact CG2-CB 4.14Å
92	S	95.9	Very high	95.7	Very high	53 Å²	53	70.9 Å²	70.9	37%	0.371	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.6	-15.6	174.9	61	0	0	0	0	113.3	T90 A118 C119	T90-S92 PolarHBondContact O-N 3.46Å; S92-A118 PolarHBondContact N-O 2.91Å; S92-A118 VanDerWaalsContact OG-CB 3.24Å; S92-A118 WeakPolarHBondContact OG-CB 3.35Å; S92-A118 PolarHBondContact OG-O 3.42Å; S92-C119 PolarHBondContact OG-N 2.98Å
93	G	97.3	Very high	95.5	Very high	21 Å²	21	66.9 Å²	66.9	22%	0.216	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.8	142.6	174.8	0	0	0	0	0	111.7	I91 R117 A118	I91-G93 WeakPolarHBondContact CG2-O 3.06Å; G93-R117 PolarHBondContact O-N 2.99Å; G93-A118 PolarHBondContact N-O 3.17Å; G93-A118 PolarHBondContact O-N 3.49Å
94	L	97.5	Very high	95.2	Very high	101 Å²	101	70.4 Å²	70.4	53%	0.529	38%	0.382	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	152.2	175.1	-69.6	168.3	0	0	0	110.7	I91 F114 T115	I91-L94 HydrophobicContact CD1-CD2 4.19Å; I91-L94 HydrophobicContact CG2-CD2 3.75Å; I91-L94 HydrophobicContact CG2-CG 4.06Å; L94-F114 HydrophobicContact CB-CD1 4.27Å; L94-F114 HydrophobicContact CD1-CD1 4.45Å; L94-F114 HydrophobicContact CD2-CB 4.39Å; L94-T115 WeakPolarHBondContact CA-O 3.48Å
95	K	96.9	Very high	94.9	Very high	115 Å²	115	69.3 Å²	69.3	50%	0.5	39%	0.385	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.4	136.3	168.4	176.3	-179.8	179.2	-173.4	0	108.7	V97 F114 T115 R117	K95-V97 HydrophobicContact CD-CG1 4.41Å; K95-F114 WeakPolarHBondContact O-CA 3.13Å; K95-T115 HydrophobicContact CB-CG2 3.97Å; K95-T115 HydrophobicContact CG-CG2 4.45Å; K95-T115 PolarHBondContact N-O 2.88Å; K95-T115 WeakPolarHBondContact O-CG2 3.21Å; K95-T115 PolarHBondContact O-N 3.28Å; K95-R117 HydrophobicContact CB-CB 4.07Å
96	K	97.2	Very high	94.5	Very high	123 Å²	123	73.2 Å²	73.2	54%	0.535	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.1	136.2	167.1	-71	-176.3	174.7	-169.3	0	109.7	E112 I113 F114	K96-E112 IonicContact NZ-OE2 3.68Å; K96-I113 WeakPolarHBondContact CA-O 3.37Å; K96-F114 HydrophobicContact CD-CE1 3.99Å; K96-F114 HydrophobicContact CD-CZ 4.19Å; K96-F114 VanDerWaalsContact CE-CE1 3.44Å; K96-F114 HydrophobicContact CG-CD1 3.7Å; K96-F114 HydrophobicContact CG-CE1 3.33Å; K96-F114 HydrophobicContact CG-CZ 3.93Å
97	V	96.6	Very high	94.3	Very high	19 Å²	19	77.9 Å²	77.9	12%	0.115	42%	0.423	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.8	139.7	176.5	-91.3	0	0	0	0	109.3	K95 E112 I113 T115	K95-V97 HydrophobicContact CD-CG1 4.41Å; V97-E112 WeakPolarHBondContact O-CA 3.27Å; V97-I113 HydrophobicContact CG2-CD1 4.41Å; V97-I113 HydrophobicContact CG2-CG1 3.72Å; V97-I113 WeakPolarHBondContact CG2-O 3.14Å; V97-I113 PolarHBondContact N-O 2.96Å; V97-I113 PolarHBondContact O-N 2.92Å; V97-T115 HydrophobicContact CG2-CG2 3.76Å
98	K	96.3	Very high	94.2	Very high	123 Å²	123	83.9 Å²	83.9	54%	0.535	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.6	125.3	179	-73.9	166	168.4	-120.5	0	109	E110 E112	K98-E110 HydrophobicContact CB-CG 3.86Å; K98-E110 WeakPolarHBondContact CD-OE1 3.44Å; K98-E110 VanDerWaalsContact CE-OE1 3.28Å; K98-E110 WeakPolarHBondContact CE-OE1 3.41Å; K98-E110 HydrophobicContact CG-CG 4.12Å; K98-E110 WeakPolarHBondContact CG-OE1 3.44Å; K98-E110 IonicContact NZ-OE1 3.05Å; K98-E110 PolarHBondContact NZ-OE1 2.79Å; K98-E112 HydrophobicContact CG-CG 4.03Å
99	V	96.5	Very high	94.1	Very high	3 Å²	3	83.8 Å²	83.8	2%	0.018	44%	0.436	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	123.4	179.5	-174.5	0	0	0	0	108.3	V40 H52 L101 E110 L111 I113	V40-V99 HydrophobicContact CG2-CG1 4.45Å; H52-V99 HydrophobicContact CB-CG1 4.12Å; H52-V99 HydrophobicContact CB-CG2 3.66Å; V99-L101 HydrophobicContact CG1-CD2 4.34Å; V99-E110 WeakPolarHBondContact O-CA 3.28Å; V99-L111 PolarHBondContact N-O 3.32Å; V99-L111 PolarHBondContact O-N 3.5Å; V99-I113 HydrophobicContact CG2-CD1 3.77Å; V99-I113 HydrophobicContact CG2-CG1 3.87Å; V99-I113 HydrophobicContact CG2-CG2 4.36Å
100	Q	95.5	Very high	94.1	Very high	132 Å²	132	87.1 Å²	87.1	62%	0.617	45%	0.448	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76	127	171.7	-70.7	-174	10.3	0	0	109.8	E109	Q100-E109 WeakPolarHBondContact CA-O 3.45Å
101	L	96.1	Very high	94.1	Very high	1 Å²	1	87.1 Å²	87.1	1%	0.005	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.6	136.3	174.6	-51.4	-177.1	0	0	0	109.5	V99 E109 L111	V99-L101 HydrophobicContact CG1-CD2 4.34Å; L101-E109 HydrophobicContact CB-CB 4.19Å; L101-E109 HydrophobicContact CD1-CB 4.29Å; L101-E109 PolarHBondContact N-O 3.38Å; L101-E109 PolarHBondContact O-N 2.94Å; L101-L111 HydrophobicContact CD1-CB 4Å; L101-L111 HydrophobicContact CD1-CD2 4.47Å; L101-L111 HydrophobicContact CD2-CB 4.34Å; L101-L111 HydrophobicContact CG-CB 4.24Å
102	Q	94.6	Very high	94	Very high	159 Å²	159	88 Å²	88	74%	0.743	45%	0.448	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.8	116.6	168.1	-62.8	-180	19.1	0	0	107.7	C48 Q49	C48-Q102 WeakPolarHBondContact CA-O 3.18Å; Q49-Q102 PolarHBondContact N-O 3.15Å; Q49-Q102 PolarHBondContact O-N 2.93Å
103	C	93	Very high	94	Very high	15 Å²	15	86.7 Å²	86.7	10%	0.101	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.6	164.5	178.2	-68.6	0	0	0	0	111.5	T47 C48 G105 R107	T47-C103 CarbonylContact O-C 3.57Å; T47-C103 VanDerWaalsContact O-CA 3.23Å; T47-C103 WeakPolarHBondContact O-CA 3.35Å; C48-C103 HydrophobicContact CB-CB 4.13Å; C48-C103 WeakPolarHBondContact CB-SG 3.49Å; C48-C103 WeakPolarHBondContact SG-CB 3.48Å; C48-C103 CovalentContact SG-SG 2.04Å; C48-C103 PolarHBondContact SG-SG 3.3Å; C103-G105 PolarHBondContact O-N 2.96Å; C103-R107 HydrophobicContact CB-CB 4.03Å; C103-R107 HydrophobicContact CB-CG 4.3Å; C103-R107 WeakPolarHBondContact CB-O 3.5Å; C103-R107 PolarHBondContact N-O 3.01Å
104	V	91	Very high	93.9	Very high	113 Å²	113	92 Å²	92	69%	0.685	45%	0.454	S	S	*	.	S	Bend	trans	-55.4	128.8	165.5	176	0	0	0	0	109.5	T47	T47-V104 HydrophobicContact CG2-CG2 4.16Å; T47-V104 PolarHBondContact O-N 3.35Å
105	G	88.2	Confident	93.9	Very high	63 Å²	63	87.7 Å²	87.7	65%	0.649	43%	0.432	S	S	*	.	S	Bend	trans	86.8	-167.6	-169.9	0	0	0	0	0	112.8	C103 R107	C103-G105 PolarHBondContact O-N 2.96Å; G105-R107 PolarHBondContact O-N 3.5Å
106	S	84.3	Confident	94	Very high	135 Å²	135	82.4 Å²	82.4	94%	0.944	41%	0.41	S	S	*	.	S	Bend	trans	-85.6	18	177.5	-52.1	0	0	0	0	113.1
107	R	89.6	Confident	94	Very high	158 Å²	158	85.2 Å²	85.2	60%	0.596	42%	0.417	S	S	*	.			trans	-79.6	134.1	-178	-178.5	175.4	172.4	161.4	-1.3	109.8	C103 G105 E109	C103-R107 HydrophobicContact CB-CB 4.03Å; C103-R107 HydrophobicContact CB-CG 4.3Å; C103-R107 WeakPolarHBondContact CB-O 3.5Å; C103-R107 PolarHBondContact N-O 3.01Å; G105-R107 PolarHBondContact O-N 3.5Å; R107-E109 HydrophobicContact CG-CG 4.46Å; R107-E109 IonicContact CZ-OE1 3.88Å; R107-E109 IonicContact NE-OE1 2.86Å; R107-E109 PolarHBondContact NE-OE1 3.43Å; R107-E109 IonicContact NH2-OE1 3.52Å; R107-E109 PolarHBondContact NH2-OE1 2.97Å
108	R	91.8	Very high	94.1	Very high	201 Å²	201	86.1 Å²	86.1	76%	0.758	43%	0.427	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.9	135.7	172.9	-66.2	-178.3	178.9	169.6	-0.8	108.6
109	E	93.4	Very high	94.1	Very high	53 Å²	53	81.4 Å²	81.4	25%	0.248	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.4	164.8	172.8	-63.9	-173.5	167.5	0	0	109.7	S42 Q100 L101 R107	S42-E109 PolarHBondContact OG-OE2 3.31Å; Q100-E109 WeakPolarHBondContact CA-O 3.45Å; L101-E109 HydrophobicContact CB-CB 4.19Å; L101-E109 HydrophobicContact CD1-CB 4.29Å; L101-E109 PolarHBondContact N-O 3.38Å; L101-E109 PolarHBondContact O-N 2.94Å; R107-E109 HydrophobicContact CG-CG 4.46Å; R107-E109 IonicContact CZ-OE1 3.88Å; R107-E109 IonicContact NE-OE1 2.86Å; R107-E109 PolarHBondContact NE-OE1 3.43Å; R107-E109 IonicContact NH2-OE1 3.52Å; R107-E109 PolarHBondContact NH2-OE1 2.97Å
110	E	93.6	Very high	94.1	Very high	107 Å²	107	85.5 Å²	85.5	50%	0.5	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	135.2	175.8	-172.3	176.7	90.5	0	0	109	K98 V99	K98-E110 HydrophobicContact CB-CG 3.86Å; K98-E110 WeakPolarHBondContact CD-OE1 3.44Å; K98-E110 VanDerWaalsContact CE-OE1 3.28Å; K98-E110 WeakPolarHBondContact CE-OE1 3.41Å; K98-E110 HydrophobicContact CG-CG 4.12Å; K98-E110 WeakPolarHBondContact CG-OE1 3.44Å; K98-E110 IonicContact NZ-OE1 3.05Å; K98-E110 PolarHBondContact NZ-OE1 2.79Å; V99-E110 WeakPolarHBondContact O-CA 3.28Å
111	L	94.4	Very high	94.1	Very high	56 Å²	56	81.3 Å²	81.3	29%	0.293	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	135.2	176.4	-177.1	65.6	0	0	0	109.7	V40 V99 L101	V40-L111 HydrophobicContact CB-CD2 4.1Å; V40-L111 HydrophobicContact CG1-CD2 3.35Å; V99-L111 PolarHBondContact N-O 3.32Å; V99-L111 PolarHBondContact O-N 3.5Å; L101-L111 HydrophobicContact CD1-CB 4Å; L101-L111 HydrophobicContact CD1-CD2 4.47Å; L101-L111 HydrophobicContact CD2-CB 4.34Å; L101-L111 HydrophobicContact CG-CB 4.24Å
112	E	95.4	Very high	94	Very high	98 Å²	98	83.1 Å²	83.1	46%	0.458	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.9	130.2	174.4	-65.2	-168.8	162.9	0	0	110.7	K96 V97 K98	K96-E112 IonicContact NZ-OE2 3.68Å; V97-E112 WeakPolarHBondContact O-CA 3.27Å; K98-E112 HydrophobicContact CG-CG 4.03Å
113	I	95.4	Very high	93.9	Very high	25 Å²	25	81.9 Å²	81.9	13%	0.128	42%	0.418	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	157.5	170.1	70.6	175.6	0	0	0	110.6	V38 V40 H52 K96 V97 V99	V38-I113 HydrophobicContact CG2-CD1 3.76Å; V40-I113 HydrophobicContact CG1-CG2 3.88Å; V40-I113 HydrophobicContact CG2-CD1 4.23Å; V40-I113 HydrophobicContact CG2-CG2 3.97Å; H52-I113 HydrophobicContact CB-CD1 4.26Å; K96-I113 WeakPolarHBondContact CA-O 3.37Å; V97-I113 HydrophobicContact CG2-CD1 4.41Å; V97-I113 HydrophobicContact CG2-CG1 3.72Å; V97-I113 WeakPolarHBondContact CG2-O 3.14Å; V97-I113 PolarHBondContact N-O 2.96Å; V97-I113 PolarHBondContact O-N 2.92Å; V99-I113 HydrophobicContact CG2-CD1 3.77Å; V99-I113 HydrophobicContact CG2-CG1 3.87Å; V99-I113 HydrophobicContact CG2-CG2 4.36Å
114	F	95.8	Very high	93.9	Very high	131 Å²	131	83.4 Å²	83.4	58%	0.575	43%	0.428	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.1	138.5	171.6	-69.5	-84.6	0	0	0	110.8	L94 K95 K96	L94-F114 HydrophobicContact CB-CD1 4.27Å; L94-F114 HydrophobicContact CD1-CD1 4.45Å; L94-F114 HydrophobicContact CD2-CB 4.39Å; K95-F114 WeakPolarHBondContact O-CA 3.13Å; K96-F114 HydrophobicContact CD-CE1 3.99Å; K96-F114 HydrophobicContact CD-CZ 4.19Å; K96-F114 VanDerWaalsContact CE-CE1 3.44Å; K96-F114 HydrophobicContact CG-CD1 3.7Å; K96-F114 HydrophobicContact CG-CE1 3.33Å; K96-F114 HydrophobicContact CG-CZ 3.93Å
115	T	97.1	Very high	93.8	Very high	11 Å²	11	87 Å²	87	7%	0.067	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.9	154.3	174.1	-176.1	0	0	0	0	109.9	Q55 L94 K95 V97 R117	Q55-T115 WeakPolarHBondContact CA-OG1 3.37Å; Q55-T115 WeakPolarHBondContact CB-OG1 3.46Å; Q55-T115 PolarHBondContact N-OG1 3.37Å; Q55-T115 PolarHBondContact O-OG1 2.94Å; L94-T115 WeakPolarHBondContact CA-O 3.48Å; K95-T115 HydrophobicContact CB-CG2 3.97Å; K95-T115 HydrophobicContact CG-CG2 4.45Å; K95-T115 PolarHBondContact N-O 2.88Å; K95-T115 WeakPolarHBondContact O-CG2 3.21Å; K95-T115 PolarHBondContact O-N 3.28Å; V97-T115 HydrophobicContact CG2-CG2 3.76Å; T115-R117 PolarHBondContact O-N 3.46Å
116	A	97.8	Very high	93.1	Very high	4 Å²	4	92 Å²	92	3%	0.033	44%	0.44	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.8	136.7	171.2	0	0	0	0	0	110.3	L33 Q55 I91	L33-A116 HydrophobicContact CD2-CB 3.73Å; Q55-A116 HydrophobicContact CB-CB 4.19Å; Q55-A116 VanDerWaalsContact CB-O 3.28Å; Q55-A116 WeakPolarHBondContact CB-O 3.46Å; Q55-A116 WeakPolarHBondContact O-CB 3.49Å; Q55-A116 PolarHBondContact O-N 3.38Å; I91-A116 HydrophobicContact CD1-CB 4.24Å; I91-A116 HydrophobicContact CG1-CB 4.07Å; I91-A116 HydrophobicContact CG2-CB 4.14Å
117	R	98.1	Very high	92	Very high	183 Å²	183	89 Å²	89	69%	0.691	42%	0.42	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.8	-32.4	171.3	-177.8	-178.6	174.1	-169.8	-1.5	111.1	G93 K95 T115	G93-R117 PolarHBondContact O-N 2.99Å; K95-R117 HydrophobicContact CB-CB 4.07Å; T115-R117 PolarHBondContact O-N 3.46Å
118	A	98.1	Very high	90.5	Very high	38 Å²	38	93.4 Å²	93.4	31%	0.314	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.7	151.6	-179.7	0	0	0	0	0	109.6	S92 G93	S92-A118 PolarHBondContact N-O 2.91Å; S92-A118 VanDerWaalsContact OG-CB 3.24Å; S92-A118 WeakPolarHBondContact OG-CB 3.35Å; S92-A118 PolarHBondContact OG-O 3.42Å; G93-A118 PolarHBondContact N-O 3.17Å; G93-A118 PolarHBondContact O-N 3.49Å
119	C	96.8	Very high	88.2	Confident	24 Å²	24	97 Å²	97	16%	0.162	45%	0.452	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.3	147	-178.2	-60.8	0	0	0	0	109.1	L33 C57 T90 S92	L33-C119 WeakPolarHBondContact CD2-SG 3.47Å; C57-C119 WeakPolarHBondContact CA-SG 3.2Å; C57-C119 HydrophobicContact CB-CB 3.75Å; C57-C119 WeakPolarHBondContact CB-SG 3.39Å; C57-C119 WeakPolarHBondContact SG-CA 3.31Å; C57-C119 WeakPolarHBondContact SG-CB 3.36Å; C57-C119 CovalentContact SG-SG 2.03Å; C57-C119 PolarHBondContact SG-SG 2.99Å; T90-C119 WeakPolarHBondContact O-CA 3.48Å; S92-C119 PolarHBondContact OG-N 2.98Å
120	Q	95.9	Very high	88	Confident	89 Å²	89	99.3 Å²	99.3	42%	0.416	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.5	157.3	174.8	79.9	-170	4.6	0	0	111.5	C31 T90 D122	C31-Q120 PolarHBondContact SG-O 3.45Å; C31-Q120 VanDerWaalsContact SG-O 3.41Å; T90-Q120 HydrophobicContact CG2-CG 4.27Å; T90-Q120 PolarHBondContact N-O 3.13Å; T90-Q120 PolarHBondContact O-N 3.23Å; Q120-D122 HydrophobicContact CG-CB 4.22Å
121	C	95.4	Very high	87.7	Confident	43 Å²	43	98.8 Å²	98.8	29%	0.291	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.2	120.4	163.8	-67.1	0	0	0	0	109.1	C61	C61-C121 HydrophobicContact CB-CB 3.62Å; C61-C121 WeakPolarHBondContact CB-SG 3.3Å; C61-C121 WeakPolarHBondContact SG-CA 3.43Å; C61-C121 WeakPolarHBondContact SG-CB 3.41Å; C61-C121 CovalentContact SG-SG 2.03Å; C61-C121 PolarHBondContact SG-SG 3.42Å
122	D	94.7	Very high	87.3	Confident	40 Å²	40	101.2 Å²	101.2	21%	0.214	47%	0.469	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.7	170.9	177.2	-167.8	11.2	0	0	0	109.4	Q87 C88 T90 Q120 C124 R125	Q87-D122 CarbonylContact C-O 3.58Å; Q87-D122 VanDerWaalsContact CA-O 3.29Å; Q87-D122 WeakPolarHBondContact CA-O 3.47Å; C88-D122 PolarHBondContact N-O 2.99Å; C88-D122 PolarHBondContact O-N 3.26Å; C88-D122 VanDerWaalsContact O-N 3.11Å; T90-D122 HydrophobicContact CG2-CB 3.76Å; Q120-D122 HydrophobicContact CG-CB 4.22Å; D122-C124 PolarHBondContact O-N 2.77Å; D122-R125 IonicContact OD2-CZ 2.66Å; D122-R125 IonicContact OD2-NH1 2.69Å; D122-R125 IonicContact OD2-NH2 2.87Å; D122-R125 PolarHBondContact OD2-NH2 3.42Å
123	M	93.2	Very high	86.8	Confident	133 Å²	133	101.4 Å²	101.4	66%	0.655	47%	0.47	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-49.7	130.9	174	-69.4	-174.1	69.6	0	0	111.1	S86 R125	S86-M123 WeakPolarHBondContact O-CA 3.31Å; M123-R125 PolarHBondContact O-N 3.08Å
124	C	92.9	Very high	86.3	Confident	46 Å²	46	106.2 Å²	106.2	31%	0.311	49%	0.491	S	S	.	.			trans	-59.8	109.7	173.4	-63.3	0	0	0	0	110.3	S86 C88 D122	S86-C124 PolarHBondContact O-N 3.29Å; C88-C124 HydrophobicContact CB-CB 3.92Å; C88-C124 WeakPolarHBondContact CB-SG 3.35Å; C88-C124 PolarHBondContact N-SG 3.27Å; C88-C124 WeakPolarHBondContact SG-CB 3.42Å; C88-C124 CovalentContact SG-SG 2.03Å; C88-C124 PolarHBondContact SG-SG 2.9Å; D122-C124 PolarHBondContact O-N 2.77Å
125	R	87.1	Confident	85.6	Confident	188 Å²	188	104.5 Å²	104.5	71%	0.709	49%	0.486	S	S	*	.			trans	-97.6	134.4	172.7	-64	-176	-173.4	124.3	19.2	108.8	D122 M123 S127	D122-R125 IonicContact OD2-CZ 2.66Å; D122-R125 IonicContact OD2-NH1 2.69Å; D122-R125 IonicContact OD2-NH2 2.87Å; D122-R125 PolarHBondContact OD2-NH2 3.42Å; M123-R125 PolarHBondContact O-N 3.08Å; R125-S127 PolarHBondContact O-N 3.25Å; R125-S127 VanDerWaalsContact O-N 3.09Å
126	L	74.8	Confident	84.8	Confident	169 Å²	169	111.2 Å²	111.2	89%	0.885	52%	0.516	S	S	*	.			trans	-61.6	114.6	163.3	-72.4	168.2	0	0	0	107.4	R128	L126-R128 PolarHBondContact O-N 3.34Å
127	S	61.4	Low	83.8	Confident	73 Å²	73	119.5 Å²	119.5	51%	0.51	55%	0.553	S	S	.	*			trans	-62.1	104.7	166.8	50.5	0	0	0	0	107.5	R125 Y129	R125-S127 PolarHBondContact O-N 3.25Å; R125-S127 VanDerWaalsContact O-N 3.09Å; S127-Y129 VanDerWaalsContact C-N 3.33Å; S127-Y129 PolarHBondContact O-N 3.16Å; S127-Y129 VanDerWaalsContact O-N 3.1Å; S127-Y129 WeakPolarHBondContact OG-CD2 3.49Å; S127-Y129 WeakPolarHBondContact OG-CE2 3.36Å
128	R	57.6	Low	82.6	Confident	250 Å²	250	114.2 Å²	114.2	94%	0.943	54%	0.541	S	S	*	.			trans	-73.2	94.3	164.1	-71.3	-173.3	178.4	172.4	-0.3	106.5	L126	L126-R128 PolarHBondContact O-N 3.34Å
129	Y	43.5	Very low	81.2	Confident	277 Å²	277	121.1 Å²	121.1	100%	1.086	56%	0.562	S	S	*	*			trans	-81.5	0	165.3	-66.2	-71.4	0	0	0	109.3	S127	S127-Y129 VanDerWaalsContact C-N 3.33Å; S127-Y129 PolarHBondContact O-N 3.16Å; S127-Y129 VanDerWaalsContact O-N 3.1Å; S127-Y129 WeakPolarHBondContact OG-CD2 3.49Å; S127-Y129 WeakPolarHBondContact OG-CE2 3.36Å

Retrieved 129 of 129 residues in 343.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).