Q99NJ3_RAT Loading...

Zinc finger protein ZFX

AlphaFold DB , UniProt , Accession Q99NJ3, Species RAT (Rattus norvegicus, Rat), Gene Zfx, Length 67 aa.

						>Q99NJ3_RAT|Q99NJ3|Zfx
TVYPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYRCTDCDYTTNKKISLHNHLESHKLTSKAEKAIE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	T	81.3	Confident	89.4	Confident	159 Å²	159	96.5 Å²	96.5	98%	0.975	53%	0.525	S	S	*	.				0	117.3	0	-51.1	0	0	0	0	110.3
2	V	88.9	Confident	89.8	Confident	95 Å²	95	92 Å²	92	58%	0.576	50%	0.497	S	S	*	.			trans	-90.4	146.1	173.9	-68.4	0	0	0	0	110	P4 K11	V2-P4 WeakPolarHBondContact O-CD 3.22Å; V2-K11 HydrophobicContact CG2-CD 4.49Å
3	Y	91.9	Very high	90	Very high	83 Å²	83	98.2 Å²	98.2	33%	0.325	52%	0.517	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108	99.2	178.9	-68.8	-88.1	0	0	0	109.3	F12 S14 R15	Y3-F12 PolarHBondContact N-O 3.45Å; Y3-F12 PolarHBondContact O-N 3.32Å; Y3-S14 VanDerWaalsContact CD2-C 3.48Å; Y3-R15 HydrophobicContact CD1-CB 4.05Å; Y3-R15 HydrophobicContact CD1-CG 4.45Å; Y3-R15 HydrophobicContact CE1-CB 3.83Å; Y3-R15 HydrophobicContact CE1-CG 4.33Å; Y3-R15 HydrophobicContact CE2-CB 4.49Å; Y3-R15 HydrophobicContact CG-CB 4.47Å
4	P	92.5	Very high	90.3	Very high	64 Å²	64	94.1 Å²	94.1	42%	0.416	50%	0.5	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.2	144.6	-179.5	31.2	-33.9	0	0	0	111.9	V2 K10	V2-P4 WeakPolarHBondContact O-CD 3.22Å; P4-K10 CarbonylContact C-O 3.58Å
5	C	89.9	Confident	90.3	Very high	3 Å²	3	100.2 Å²	100.2	2%	0.02	51%	0.513	C	S	.	.			trans	-76.3	123.7	165.3	173.8	0	0	0	0	109.5	I7 C8 G9 K10 F12 L18 H21 M22 H25	C5-I7 PolarHBondContact O-N 3.14Å; C5-I7 PolarHBondContact SG-N 3.5Å; C5-C8 PolarHBondContact SG-N 3.42Å; C5-C8 VanDerWaalsContact SG-N 3.36Å; C5-C8 PolarHBondContact SG-SG 2.96Å; C5-G9 WeakPolarHBondContact O-CA 3.33Å; C5-G9 PolarHBondContact O-N 3.13Å; C5-K10 HydrophobicContact CB-CB 4.41Å; C5-K10 WeakPolarHBondContact CB-O 3.37Å; C5-K10 PolarHBondContact N-O 2.81Å; C5-F12 HydrophobicContact CB-CE2 4.21Å; C5-L18 HydrophobicContact CB-CD1 4.05Å; C5-H21 PolarHBondContact SG-NE2 3.41Å; C5-H21 VanDerWaalsContact SG-NE2 3.44Å; C5-M22 HydrophobicContact CB-CE 3.75Å; C5-M22 WeakPolarHBondContact SG-CE 3.34Å; C5-H25 PolarHBondContact SG-NE2 2.82Å; C5-H25 VanDerWaalsContact SG-NE2 3.37Å
6	M	87.1	Confident	90.5	Very high	175 Å²	175	97.1 Å²	97.1	86%	0.862	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.3	-7.9	178.9	-62.2	-59.6	-68	0	0	113.7
7	I	85.1	Confident	90.6	Very high	70 Å²	70	96.1 Å²	96.1	36%	0.359	50%	0.504	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97	-53.4	-177.1	-61.1	158.2	0	0	0	110.9	C5 M22 H25 E27	C5-I7 PolarHBondContact O-N 3.14Å; C5-I7 PolarHBondContact SG-N 3.5Å; I7-M22 HydrophobicContact CD1-SD 4.03Å; I7-H25 HydrophobicContact CD1-CB 3.83Å; I7-H25 WeakPolarHBondContact CG2-CE1 3.41Å; I7-H25 VanDerWaalsContact CG2-ND1 3.33Å; I7-H25 WeakPolarHBondContact CG2-ND1 3.47Å; I7-E27 HydrophobicContact CD1-CG 3.59Å; I7-E27 HydrophobicContact CG1-CG 4.15Å; I7-E27 WeakPolarHBondContact CG1-OE2 3.42Å; I7-E27 WeakPolarHBondContact CG2-OE1 3.47Å; I7-E27 WeakPolarHBondContact CG2-OE2 3.33Å
8	C	89.6	Confident	90.7	Very high	68 Å²	68	92.3 Å²	92.3	46%	0.459	49%	0.485	S	S	.	.	T	Hydrogen-bonded Turn	trans	-115.9	2.9	-175.7	66	0	0	0	0	113.7	C5 K10 H21 H25	C5-C8 PolarHBondContact SG-N 3.42Å; C5-C8 VanDerWaalsContact SG-N 3.36Å; C5-C8 PolarHBondContact SG-SG 2.96Å; C8-K10 PolarHBondContact O-N 3.2Å; C8-K10 VanDerWaalsContact O-N 3.11Å; C8-H21 PolarHBondContact SG-NE2 3.33Å; C8-H21 VanDerWaalsContact SG-NE2 3.38Å; C8-H25 PolarHBondContact SG-NE2 3.34Å
9	G	89.8	Confident	90.6	Very high	48 Å²	48	95.4 Å²	95.4	50%	0.495	49%	0.493	S	S	.	.			trans	74.3	-4.8	177.7	0	0	0	0	0	115.7	C5 K11	C5-G9 WeakPolarHBondContact O-CA 3.33Å; C5-G9 PolarHBondContact O-N 3.13Å; G9-K11 PolarHBondContact O-N 3.47Å
10	K	92.4	Very high	90.5	Very high	137 Å²	137	98.7 Å²	98.7	60%	0.596	50%	0.499	S	S	*	.			trans	-57.4	132.4	178.3	-94.2	-174.6	173.9	177.8	0	111.7	P4 C5 C8 F12	P4-K10 CarbonylContact C-O 3.58Å; C5-K10 HydrophobicContact CB-CB 4.41Å; C5-K10 WeakPolarHBondContact CB-O 3.37Å; C5-K10 PolarHBondContact N-O 2.81Å; C8-K10 PolarHBondContact O-N 3.2Å; C8-K10 VanDerWaalsContact O-N 3.11Å; K10-F12 HydrophobicContact CB-CE2 3.71Å; K10-F12 HydrophobicContact CB-CZ 3.95Å; K10-F12 HydrophobicContact CD-CZ 4.46Å; K10-F12 WeakPolarHBondContact O-CD2 3.38Å; K10-F12 WeakPolarHBondContact O-CE2 3.49Å
11	K	94.4	Very high	90.6	Very high	160 Å²	160	95.6 Å²	95.6	70%	0.696	48%	0.483	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.6	134	-179.2	-61.4	177.8	-176.3	176	0	110.6	V2 G9	V2-K11 HydrophobicContact CG2-CD 4.49Å; G9-K11 PolarHBondContact O-N 3.47Å
12	F	94	Very high	90.8	Very high	42 Å²	42	89.8 Å²	89.8	18%	0.184	45%	0.445	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	148.5	179.1	-62.9	-88.8	0	0	0	111.4	Y3 C5 K10 S14 F17 L18 H21	Y3-F12 PolarHBondContact N-O 3.45Å; Y3-F12 PolarHBondContact O-N 3.32Å; C5-F12 HydrophobicContact CB-CE2 4.21Å; K10-F12 HydrophobicContact CB-CE2 3.71Å; K10-F12 HydrophobicContact CB-CZ 3.95Å; K10-F12 HydrophobicContact CD-CZ 4.46Å; K10-F12 WeakPolarHBondContact O-CD2 3.38Å; K10-F12 WeakPolarHBondContact O-CE2 3.49Å; F12-S14 VanDerWaalsContact C-N 3.29Å; F12-S14 PolarHBondContact O-N 3.16Å; F12-F17 HydrophobicContact CB-CB 4.18Å; F12-F17 HydrophobicContact CD1-CB 3.89Å; F12-F17 HydrophobicContact CG-CB 4.37Å; F12-L18 HydrophobicContact CB-CB 4.28Å; F12-L18 HydrophobicContact CD2-CB 4.21Å; F12-L18 HydrophobicContact CD2-CD1 3.76Å; F12-L18 HydrophobicContact CE2-CD1 4.11Å; F12-L18 HydrophobicContact CG-CB 4.35Å; F12-H21 HydrophobicContact CE1-CB 3.83Å; F12-H21 HydrophobicContact CE2-CB 4.05Å; F12-H21 AromaticContact CE2-CD2 3.13Å; F12-H21 WeakPolarHBondContact CE2-CD2 3.22Å; F12-H21 AromaticContact CE2-CG 3.66Å; F12-H21 AromaticContact CE2-NE2 3.66Å; F12-H21 HydrophobicContact CZ-CB 3.49Å; F12-H21 VanDerWaalsContact CZ-CB 3.49Å; F12-H21 AromaticContact CZ-CD2 3.18Å; F12-H21 WeakPolarHBondContact CZ-CD2 3.33Å; F12-H21 AromaticContact CZ-CE1 3.98Å; F12-H21 AromaticContact CZ-CG 3.19Å; F12-H21 AromaticContact CZ-ND1 3.71Å; F12-H21 AromaticContact CZ-NE2 3.67Å
13	K	92.9	Very high	90.6	Very high	173 Å²	173	91.6 Å²	91.6	75%	0.752	45%	0.445	S	S	*	.	S	Bend	trans	-73.7	-16	178.6	65.6	-178.7	-179.6	-178.3	0	114.4	F17	K13-F17 HydrophobicContact CD-CE2 4.31Å; K13-F17 HydrophobicContact CG-CD2 3.81Å; K13-F17 HydrophobicContact CG-CE2 4.05Å
14	S	94.5	Very high	90.2	Very high	40 Å²	40	93.7 Å²	93.7	28%	0.28	46%	0.462	S	S	.	.	S	Bend	trans	-150.6	157.2	177.2	85.1	0	0	0	0	112.5	Y3 F12 G16 F17 L18	Y3-S14 VanDerWaalsContact CD2-C 3.48Å; F12-S14 VanDerWaalsContact C-N 3.29Å; F12-S14 PolarHBondContact O-N 3.16Å; S14-G16 PolarHBondContact O-N 3.29Å; S14-G16 PolarHBondContact OG-N 3.42Å; S14-F17 PolarHBondContact O-N 3.28Å; S14-F17 WeakPolarHBondContact OG-CD2 3.36Å; S14-F17 PolarHBondContact OG-N 3.15Å; S14-L18 PolarHBondContact O-N 3.42Å; S14-L18 VanDerWaalsContact O-N 3.13Å
15	R	90.3	Very high	89.8	Confident	186 Å²	186	91.5 Å²	91.5	70%	0.702	45%	0.446	S	S	*	.	H	α-helix	trans	-60.6	-31.9	174.7	-167.7	174.3	179.3	146.1	-0.4	112.6	Y3 L18 K19	Y3-R15 HydrophobicContact CD1-CB 4.05Å; Y3-R15 HydrophobicContact CD1-CG 4.45Å; Y3-R15 HydrophobicContact CE1-CB 3.83Å; Y3-R15 HydrophobicContact CE1-CG 4.33Å; Y3-R15 HydrophobicContact CE2-CB 4.49Å; Y3-R15 HydrophobicContact CG-CB 4.47Å; R15-L18 PolarHBondContact O-N 3.14Å; R15-K19 WeakPolarHBondContact O-CB 3.38Å; R15-K19 PolarHBondContact O-N 3.46Å
16	G	92.7	Very high	88.9	Confident	51 Å²	51	95.8 Å²	95.8	53%	0.526	47%	0.474	S	S	.	.	H	α-helix	trans	-64.6	-44.8	176.8	0	0	0	0	0	112.5	S14 K19 R20	S14-G16 PolarHBondContact O-N 3.29Å; S14-G16 PolarHBondContact OG-N 3.42Å; G16-K19 PolarHBondContact O-N 3.35Å; G16-R20 PolarHBondContact O-N 3.45Å
17	F	93.1	Very high	87.9	Confident	79 Å²	79	90.8 Å²	90.8	35%	0.346	45%	0.449	S	S	.	.	H	α-helix	trans	-65.5	-42.4	175.3	-70.7	-65	0	0	0	111.8	F12 K13 S14 K19 R20 H21	F12-F17 HydrophobicContact CB-CB 4.18Å; F12-F17 HydrophobicContact CD1-CB 3.89Å; F12-F17 HydrophobicContact CG-CB 4.37Å; K13-F17 HydrophobicContact CD-CE2 4.31Å; K13-F17 HydrophobicContact CG-CD2 3.81Å; K13-F17 HydrophobicContact CG-CE2 4.05Å; S14-F17 PolarHBondContact O-N 3.28Å; S14-F17 WeakPolarHBondContact OG-CD2 3.36Å; S14-F17 PolarHBondContact OG-N 3.15Å; F17-K19 VanDerWaalsContact C-N 3.35Å; F17-K19 PolarHBondContact O-N 3.31Å; F17-R20 PolarHBondContact O-N 3Å; F17-H21 WeakPolarHBondContact O-CB 3.23Å; F17-H21 PolarHBondContact O-N 3.42Å
18	L	92.9	Very high	86.9	Confident	29 Å²	29	91 Å²	91	15%	0.152	45%	0.448	C	S	.	.	H	α-helix	trans	-57.3	-47.7	173.6	177.2	64.3	0	0	0	111	C5 F12 S14 R15 R20 H21 M22	C5-L18 HydrophobicContact CB-CD1 4.05Å; F12-L18 HydrophobicContact CB-CB 4.28Å; F12-L18 HydrophobicContact CD2-CB 4.21Å; F12-L18 HydrophobicContact CD2-CD1 3.76Å; F12-L18 HydrophobicContact CE2-CD1 4.11Å; F12-L18 HydrophobicContact CG-CB 4.35Å; S14-L18 PolarHBondContact O-N 3.42Å; S14-L18 VanDerWaalsContact O-N 3.13Å; R15-L18 PolarHBondContact O-N 3.14Å; L18-R20 PolarHBondContact O-N 3.13Å; L18-H21 WeakPolarHBondContact O-CB 3.3Å; L18-H21 PolarHBondContact O-N 3.34Å; L18-H21 VanDerWaalsContact O-N 3.15Å; L18-M22 HydrophobicContact CD1-CE 3.56Å; L18-M22 HydrophobicContact CD1-CG 4.46Å; L18-M22 HydrophobicContact CD1-SD 4.39Å; L18-M22 HydrophobicContact CG-CE 4.5Å; L18-M22 HydrophobicContact CG-CG 4.49Å; L18-M22 WeakPolarHBondContact O-CG 3.29Å; L18-M22 PolarHBondContact O-N 2.98Å
19	K	88	Confident	85.5	Confident	150 Å²	150	92.6 Å²	92.6	65%	0.652	45%	0.451	S	S	*	.	H	α-helix	trans	-61.2	-40.3	179.6	-172.7	175.8	-176.5	177.9	0	112.6	R15 G16 F17	R15-K19 WeakPolarHBondContact O-CB 3.38Å; R15-K19 PolarHBondContact O-N 3.46Å; G16-K19 PolarHBondContact O-N 3.35Å; F17-K19 VanDerWaalsContact C-N 3.35Å; F17-K19 PolarHBondContact O-N 3.31Å
20	R	89.5	Confident	84.1	Confident	162 Å²	162	92.9 Å²	92.9	61%	0.611	45%	0.449	S	S	*	.	H	α-helix	trans	-66	-42.4	174.6	-176.5	173.7	66.6	-178.3	4.4	111.3	G16 F17 L18 K23 N24	G16-R20 PolarHBondContact O-N 3.45Å; F17-R20 PolarHBondContact O-N 3Å; L18-R20 PolarHBondContact O-N 3.13Å; R20-K23 WeakPolarHBondContact O-CB 3.46Å; R20-K23 PolarHBondContact O-N 2.88Å; R20-N24 PolarHBondContact O-ND2 3.27Å
21	H	91.1	Very high	82.5	Confident	33 Å²	33	95 Å²	95	15%	0.153	46%	0.458	C	S	.	.	H	α-helix	trans	-61.6	-43.1	176.7	167.1	63.9	0	0	0	112.3	C5 C8 F12 F17 L18 K23 N24 H25	C5-H21 PolarHBondContact SG-NE2 3.41Å; C5-H21 VanDerWaalsContact SG-NE2 3.44Å; C8-H21 PolarHBondContact SG-NE2 3.33Å; C8-H21 VanDerWaalsContact SG-NE2 3.38Å; F12-H21 HydrophobicContact CE1-CB 3.83Å; F12-H21 HydrophobicContact CE2-CB 4.05Å; F12-H21 AromaticContact CE2-CD2 3.13Å; F12-H21 WeakPolarHBondContact CE2-CD2 3.22Å; F12-H21 AromaticContact CE2-CG 3.66Å; F12-H21 AromaticContact CE2-NE2 3.66Å; F12-H21 HydrophobicContact CZ-CB 3.49Å; F12-H21 VanDerWaalsContact CZ-CB 3.49Å; F12-H21 AromaticContact CZ-CD2 3.18Å; F12-H21 WeakPolarHBondContact CZ-CD2 3.33Å; F12-H21 AromaticContact CZ-CE1 3.98Å; F12-H21 AromaticContact CZ-CG 3.19Å; F12-H21 AromaticContact CZ-ND1 3.71Å; F12-H21 AromaticContact CZ-NE2 3.67Å; F17-H21 WeakPolarHBondContact O-CB 3.23Å; F17-H21 PolarHBondContact O-N 3.42Å; L18-H21 WeakPolarHBondContact O-CB 3.3Å; L18-H21 PolarHBondContact O-N 3.34Å; L18-H21 VanDerWaalsContact O-N 3.15Å; H21-K23 PolarHBondContact O-N 3.14Å; H21-K23 VanDerWaalsContact O-N 3.09Å; H21-N24 PolarHBondContact O-N 3.11Å; H21-H25 AromaticContact CD2-NE2 3.88Å; H21-H25 AromaticContact CE1-CD2 3.72Å; H21-H25 AromaticContact CE1-NE2 3.16Å; H21-H25 PolarHBondContact CE1-NE2 3.24Å; H21-H25 AromaticContact NE2-CD2 3.64Å; H21-H25 AromaticContact NE2-NE2 3.02Å; H21-H25 PolarHBondContact NE2-NE2 3.36Å
22	M	86.6	Confident	80.9	Confident	37 Å²	37	92.7 Å²	92.7	18%	0.182	45%	0.448	C	S	.	.	H	α-helix	trans	-55.3	-29.1	176.9	-69.3	-55.7	91.5	0	0	113	C5 I7 L18 N24 H25 H28	C5-M22 HydrophobicContact CB-CE 3.75Å; C5-M22 WeakPolarHBondContact SG-CE 3.34Å; I7-M22 HydrophobicContact CD1-SD 4.03Å; L18-M22 HydrophobicContact CD1-CE 3.56Å; L18-M22 HydrophobicContact CD1-CG 4.46Å; L18-M22 HydrophobicContact CD1-SD 4.39Å; L18-M22 HydrophobicContact CG-CE 4.5Å; L18-M22 HydrophobicContact CG-CG 4.49Å; L18-M22 WeakPolarHBondContact O-CG 3.29Å; L18-M22 PolarHBondContact O-N 2.98Å; M22-N24 VanDerWaalsContact C-N 3.27Å; M22-N24 PolarHBondContact O-N 3.41Å; M22-H25 WeakPolarHBondContact O-CB 3.36Å; M22-H25 PolarHBondContact O-N 3.21Å; M22-H28 WeakPolarHBondContact O-CB 3.36Å; M22-H28 PolarHBondContact O-CD2 3.12Å; M22-H28 VanDerWaalsContact O-CG 3.23Å
23	K	83.9	Confident	79.7	Confident	134 Å²	134	96.5 Å²	96.5	58%	0.583	47%	0.465	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.9	-23.7	177.8	-64.7	-179.5	179.9	-177.4	0	113.8	R20 H21 H25	R20-K23 WeakPolarHBondContact O-CB 3.46Å; R20-K23 PolarHBondContact O-N 2.88Å; H21-K23 PolarHBondContact O-N 3.14Å; H21-K23 VanDerWaalsContact O-N 3.09Å; K23-H25 VanDerWaalsContact C-N 3.31Å
24	N	83.7	Confident	79.1	Confident	126 Å²	126	92.7 Å²	92.7	67%	0.674	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.3	-7.9	178.3	-62	-69.5	0	0	0	112.3	R20 H21 M22	R20-N24 PolarHBondContact O-ND2 3.27Å; H21-N24 PolarHBondContact O-N 3.11Å; M22-N24 VanDerWaalsContact C-N 3.27Å; M22-N24 PolarHBondContact O-N 3.41Å
25	H	84.6	Confident	78.6	Confident	19 Å²	19	99.3 Å²	99.3	9%	0.088	47%	0.465	C	S	.	.			trans	-74.4	129.5	178.3	-93	-73.5	0	0	0	110.8	C5 I7 C8 H21 M22 K23 E27 H28 L29	C5-H25 PolarHBondContact SG-NE2 2.82Å; C5-H25 VanDerWaalsContact SG-NE2 3.37Å; I7-H25 HydrophobicContact CD1-CB 3.83Å; I7-H25 WeakPolarHBondContact CG2-CE1 3.41Å; I7-H25 VanDerWaalsContact CG2-ND1 3.33Å; I7-H25 WeakPolarHBondContact CG2-ND1 3.47Å; C8-H25 PolarHBondContact SG-NE2 3.34Å; H21-H25 AromaticContact CD2-NE2 3.88Å; H21-H25 AromaticContact CE1-CD2 3.72Å; H21-H25 AromaticContact CE1-NE2 3.16Å; H21-H25 PolarHBondContact CE1-NE2 3.24Å; H21-H25 AromaticContact NE2-CD2 3.64Å; H21-H25 AromaticContact NE2-NE2 3.02Å; H21-H25 PolarHBondContact NE2-NE2 3.36Å; M22-H25 WeakPolarHBondContact O-CB 3.36Å; M22-H25 PolarHBondContact O-N 3.21Å; K23-H25 VanDerWaalsContact C-N 3.31Å; H25-E27 HydrophobicContact CB-CG 4.46Å; H25-E27 VanDerWaalsContact CB-OE1 3.28Å; H25-E27 WeakPolarHBondContact CB-OE1 3.35Å; H25-E27 IonicContact CG-OE1 3.49Å; H25-E27 IonicContact ND1-OE1 3.1Å; H25-E27 PolarHBondContact ND1-OE1 3.19Å; H25-E27 VanDerWaalsContact ND1-OE1 3.1Å; H25-E27 PolarHBondContact O-N 2.9Å; H25-H28 HydrophobicContact CB-CB 4.22Å; H25-H28 WeakPolarHBondContact O-CA 3.45Å; H25-H28 WeakPolarHBondContact O-CB 3.28Å; H25-H28 PolarHBondContact O-N 3.38Å; H25-L29 PolarHBondContact O-N 3.39Å; H25-L29 VanDerWaalsContact O-N 3.15Å
26	P	71.2	Confident	78.3	Confident	93 Å²	93	90.5 Å²	90.5	60%	0.604	43%	0.432	S	S	*	.	H	α-helix	trans	-62.5	-29.7	179.9	24.2	-32.1	0	0	0	112.5	H28 L29 A30	P26-H28 VanDerWaalsContact C-N 3.29Å; P26-H28 PolarHBondContact O-N 3.22Å; P26-L29 WeakPolarHBondContact O-CB 2.95Å; P26-L29 PolarHBondContact O-N 2.85Å; P26-A30 PolarHBondContact O-N 3.44Å
27	E	65.3	Low	77.8	Confident	70 Å²	70	94 Å²	94	33%	0.327	44%	0.444	S	S	.	.	H	α-helix	trans	-71.8	-23.8	172.5	66.2	-104.4	89.3	0	0	113.2	I7 H25 L29 A30 K31	I7-E27 HydrophobicContact CD1-CG 3.59Å; I7-E27 HydrophobicContact CG1-CG 4.15Å; I7-E27 WeakPolarHBondContact CG1-OE2 3.42Å; I7-E27 WeakPolarHBondContact CG2-OE1 3.47Å; I7-E27 WeakPolarHBondContact CG2-OE2 3.33Å; H25-E27 HydrophobicContact CB-CG 4.46Å; H25-E27 VanDerWaalsContact CB-OE1 3.28Å; H25-E27 WeakPolarHBondContact CB-OE1 3.35Å; H25-E27 IonicContact CG-OE1 3.49Å; H25-E27 IonicContact ND1-OE1 3.1Å; H25-E27 PolarHBondContact ND1-OE1 3.19Å; H25-E27 VanDerWaalsContact ND1-OE1 3.1Å; H25-E27 PolarHBondContact O-N 2.9Å; E27-L29 VanDerWaalsContact C-N 3.33Å; E27-A30 CarbonylContact O-C 3.58Å; E27-A30 PolarHBondContact O-N 3.41Å; E27-K31 WeakPolarHBondContact O-CB 3.33Å; E27-K31 WeakPolarHBondContact O-CG 3.32Å; E27-K31 PolarHBondContact O-N 2.71Å
28	H	65.1	Low	77.3	Confident	73 Å²	73	95.2 Å²	95.2	34%	0.338	45%	0.453	S	S	.	.	H	α-helix	trans	-76	-29.6	173	-165.6	-64.1	0	0	0	110.1	M22 H25 P26 K32	M22-H28 WeakPolarHBondContact O-CB 3.36Å; M22-H28 PolarHBondContact O-CD2 3.12Å; M22-H28 VanDerWaalsContact O-CG 3.23Å; H25-H28 HydrophobicContact CB-CB 4.22Å; H25-H28 WeakPolarHBondContact O-CA 3.45Å; H25-H28 WeakPolarHBondContact O-CB 3.28Å; H25-H28 PolarHBondContact O-N 3.38Å; P26-H28 VanDerWaalsContact C-N 3.29Å; P26-H28 PolarHBondContact O-N 3.22Å; H28-K32 WeakPolarHBondContact O-CB 3.38Å; H28-K32 PolarHBondContact O-N 3.25Å; H28-K32 VanDerWaalsContact O-N 3.1Å
29	L	60.5	Low	77	Confident	102 Å²	102	96 Å²	96	53%	0.534	46%	0.461	S	S	.	.	H	α-helix	trans	-65.7	-41	165.5	-75.4	156.2	0	0	0	110.6	H25 P26 E27 K32 K33	H25-L29 PolarHBondContact O-N 3.39Å; H25-L29 VanDerWaalsContact O-N 3.15Å; P26-L29 WeakPolarHBondContact O-CB 2.95Å; P26-L29 PolarHBondContact O-N 2.85Å; E27-L29 VanDerWaalsContact C-N 3.33Å; L29-K32 PolarHBondContact O-N 3.39Å; L29-K33 WeakPolarHBondContact O-CG 3.31Å; L29-K33 PolarHBondContact O-N 3.1Å
30	A	59.5	Low	76.8	Confident	54 Å²	54	96 Å²	96	45%	0.446	47%	0.468	S	S	.	.	H	α-helix	trans	-67.4	-40.3	176.2	0	0	0	0	0	113.3	P26 E27 K32 K33	P26-A30 PolarHBondContact O-N 3.44Å; E27-A30 CarbonylContact O-C 3.58Å; E27-A30 PolarHBondContact O-N 3.41Å; A30-K32 VanDerWaalsContact C-N 3.28Å; A30-K32 PolarHBondContact O-N 3.17Å; A30-K33 VanDerWaalsContact O-CB 3.31Å; A30-K33 WeakPolarHBondContact O-CB 3.43Å; A30-K33 PolarHBondContact O-N 3.43Å
31	K	59.1	Low	76.5	Confident	181 Å²	181	92.8 Å²	92.8	79%	0.787	46%	0.457	S	S	*	.	H	α-helix	trans	-72.6	-20.3	176.2	-75.4	-179.8	179.3	-178.4	0	113.4	E27 K33	E27-K31 WeakPolarHBondContact O-CB 3.33Å; E27-K31 WeakPolarHBondContact O-CG 3.32Å; E27-K31 PolarHBondContact O-N 2.71Å; K31-K33 VanDerWaalsContact C-N 3.29Å
32	K	59.8	Low	76.2	Confident	113 Å²	113	94.3 Å²	94.3	49%	0.491	47%	0.468	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91	5.7	175.7	-153	179.1	-175.6	-167.7	0	112.4	H28 L29 A30 Y34 N44	H28-K32 WeakPolarHBondContact O-CB 3.38Å; H28-K32 PolarHBondContact O-N 3.25Å; H28-K32 VanDerWaalsContact O-N 3.1Å; L29-K32 PolarHBondContact O-N 3.39Å; A30-K32 VanDerWaalsContact C-N 3.28Å; A30-K32 PolarHBondContact O-N 3.17Å; K32-Y34 PolarHBondContact O-N 3.23Å; K32-N44 VanDerWaalsContact O-CA 3.29Å; K32-N44 WeakPolarHBondContact O-CA 3.14Å
33	K	70.2	Confident	76	Confident	122 Å²	122	93.3 Å²	93.3	53%	0.53	47%	0.465	S	S	.	.			trans	-81.4	107.3	169.1	-74.1	175.8	-172	-171.9	0	108.8	L29 A30 K31 R35 T42 T43	L29-K33 WeakPolarHBondContact O-CG 3.31Å; L29-K33 PolarHBondContact O-N 3.1Å; A30-K33 VanDerWaalsContact O-CB 3.31Å; A30-K33 WeakPolarHBondContact O-CB 3.43Å; A30-K33 PolarHBondContact O-N 3.43Å; K31-K33 VanDerWaalsContact C-N 3.29Å; K33-R35 PolarHBondContact O-N 3.45Å; K33-T42 HydrophobicContact CB-CG2 3.46Å; K33-T42 VanDerWaalsContact CB-CG2 3.46Å; K33-T42 HydrophobicContact CD-CG2 3.82Å; K33-T42 HydrophobicContact CG-CG2 3.8Å; K33-T43 CarbonylContact C-O 3.45Å; K33-T43 VanDerWaalsContact CA-O 3.32Å; K33-T43 WeakPolarHBondContact CA-O 3.37Å
34	Y	79.9	Confident	75.9	Confident	92 Å²	92	91.5 Å²	91.5	36%	0.361	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.6	112.1	163.4	-65.3	-84.3	0	0	0	107.7	K32 T43 K46 L49	K32-Y34 PolarHBondContact O-N 3.23Å; Y34-T43 PolarHBondContact N-O 2.95Å; Y34-T43 PolarHBondContact O-N 3.25Å; Y34-K46 HydrophobicContact CD2-CB 4.47Å; Y34-K46 HydrophobicContact CE1-CB 3.97Å; Y34-K46 HydrophobicContact CE1-CD 4.49Å; Y34-K46 HydrophobicContact CE1-CG 4Å; Y34-K46 HydrophobicContact CE2-CB 3.93Å; Y34-K46 VanDerWaalsContact CE2-N 3.35Å; Y34-L49 HydrophobicContact CD1-CD2 4.28Å; Y34-L49 HydrophobicContact CG-CD2 4.39Å
35	R	82.9	Confident	75.8	Confident	179 Å²	179	91.5 Å²	91.5	68%	0.675	46%	0.455	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.7	138	177	-162	176.7	85.2	170.3	3.4	109.7	K33	K33-R35 PolarHBondContact O-N 3.45Å
36	C	84.8	Confident	75.7	Confident	2 Å²	2	97.7 Å²	97.7	1%	0.014	48%	0.482	C	S	.	.			trans	-67.1	148.4	167.4	-168.7	0	0	0	0	110.2	D38 Y41 L49 H52	C36-D38 PolarHBondContact SG-N 3.36Å; C36-D38 VanDerWaalsContact SG-N 3.41Å; C36-Y41 WeakPolarHBondContact CB-O 2.99Å; C36-Y41 PolarHBondContact N-O 3.1Å; C36-L49 HydrophobicContact CB-CD1 4.09Å; C36-H52 WeakPolarHBondContact CB-NE2 3.39Å; C36-H52 PolarHBondContact SG-NE2 3.21Å
37	T	83.2	Confident	76.4	Confident	125 Å²	125	99.2 Å²	99.2	77%	0.767	48%	0.484	S	S	*	.	S	Bend	trans	-87.4	-26.4	174.9	38.9	0	0	0	0	112
38	D	82.4	Confident	77.6	Confident	103 Å²	103	97.8 Å²	97.8	55%	0.551	48%	0.481	S	S	*	.	S	Bend	trans	-99.5	-9.5	-171	-55.6	-98.4	0	0	0	112.6	C36	C36-D38 PolarHBondContact SG-N 3.36Å; C36-D38 VanDerWaalsContact SG-N 3.41Å
39	C	85.9	Confident	78.7	Confident	47 Å²	47	95.5 Å²	95.5	32%	0.318	47%	0.472	S	S	.	.	S	Bend	trans	-158.8	177.1	172.6	70.6	0	0	0	0	112.3	Y41 H52 H56	C39-Y41 PolarHBondContact O-N 3Å; C39-Y41 VanDerWaalsContact O-N 3.14Å; C39-Y41 WeakPolarHBondContact SG-CB 3.19Å; C39-Y41 PolarHBondContact SG-N 3.46Å; C39-Y41 VanDerWaalsContact SG-N 3.45Å; C39-H52 PolarHBondContact SG-CE1 3.31Å; C39-H52 PolarHBondContact SG-NE2 2.95Å; C39-H56 PolarHBondContact SG-NE2 3.44Å
40	D	83.4	Confident	80	Confident	150 Å²	150	95.7 Å²	95.7	80%	0.802	47%	0.469	S	S	*	.	S	Bend	trans	-74.9	7.5	178.2	-69.4	-76	0	0	0	115	T42	D40-T42 PolarHBondContact O-N 3.3Å; D40-T42 PolarHBondContact O-OG1 2.76Å
41	Y	83.4	Confident	81.5	Confident	94 Å²	94	97.7 Å²	97.7	37%	0.369	47%	0.472	S	S	.	.			trans	-63.8	131.4	178.3	-177.2	-98.4	0	0	0	111.6	C36 C39 T43 H52	C36-Y41 WeakPolarHBondContact CB-O 2.99Å; C36-Y41 PolarHBondContact N-O 3.1Å; C39-Y41 PolarHBondContact O-N 3Å; C39-Y41 VanDerWaalsContact O-N 3.14Å; C39-Y41 WeakPolarHBondContact SG-CB 3.19Å; C39-Y41 PolarHBondContact SG-N 3.46Å; C39-Y41 VanDerWaalsContact SG-N 3.45Å; Y41-T43 HydrophobicContact CE1-CG2 3.76Å; Y41-H52 WeakPolarHBondContact CB-CE1 3.34Å; Y41-H52 WeakPolarHBondContact CB-NE2 3.42Å; Y41-H52 HydrophobicContact CD1-CB 4.05Å; Y41-H52 AromaticContact CD1-CD2 3.46Å; Y41-H52 VanDerWaalsContact CD1-CD2 3.46Å; Y41-H52 WeakPolarHBondContact CD1-CD2 3.48Å; Y41-H52 AromaticContact CD1-CE1 3.81Å; Y41-H52 AromaticContact CD1-CG 3.45Å; Y41-H52 VanDerWaalsContact CD1-CG 3.45Å; Y41-H52 AromaticContact CD1-ND1 3.69Å; Y41-H52 AromaticContact CD1-NE2 3.65Å; Y41-H52 HydrophobicContact CE1-CB 3.86Å; Y41-H52 AromaticContact CE1-CG 3.77Å; Y41-H52 AromaticContact CG-CE1 3.55Å; Y41-H52 AromaticContact CG-CG 3.96Å; Y41-H52 AromaticContact CG-ND1 3.7Å; Y41-H52 AromaticContact CG-NE2 3.71Å
42	T	84.1	Confident	82.9	Confident	64 Å²	64	90.7 Å²	90.7	39%	0.393	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.1	130.1	-176.8	-55	0	0	0	0	110.6	K33 D40	K33-T42 HydrophobicContact CB-CG2 3.46Å; K33-T42 VanDerWaalsContact CB-CG2 3.46Å; K33-T42 HydrophobicContact CD-CG2 3.82Å; K33-T42 HydrophobicContact CG-CG2 3.8Å; D40-T42 PolarHBondContact O-N 3.3Å; D40-T42 PolarHBondContact O-OG1 2.76Å
43	T	83.8	Confident	84.2	Confident	17 Å²	17	87.9 Å²	87.9	10%	0.104	43%	0.433	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139	152.3	-177.5	-176.6	0	0	0	0	112.9	K33 Y34 Y41 K45 S48 L49	K33-T43 CarbonylContact C-O 3.45Å; K33-T43 VanDerWaalsContact CA-O 3.32Å; K33-T43 WeakPolarHBondContact CA-O 3.37Å; Y34-T43 PolarHBondContact N-O 2.95Å; Y34-T43 PolarHBondContact O-N 3.25Å; Y41-T43 HydrophobicContact CE1-CG2 3.76Å; T43-K45 VanDerWaalsContact C-N 3.33Å; T43-K45 WeakPolarHBondContact CG2-O 3.34Å; T43-K45 PolarHBondContact OG1-N 3.28Å; T43-S48 WeakPolarHBondContact OG1-CB 3.35Å; T43-L49 HydrophobicContact CG2-CB 3.79Å
44	N	80.3	Confident	85.1	Confident	95 Å²	95	86.5 Å²	86.5	51%	0.508	43%	0.428	S	S	.	.	S	Bend	trans	-88	2.1	178.5	62.5	63.6	0	0	0	114.4	K32	K32-N44 VanDerWaalsContact O-CA 3.29Å; K32-N44 WeakPolarHBondContact O-CA 3.14Å
45	K	82.4	Confident	85.4	Confident	127 Å²	127	85.2 Å²	85.2	55%	0.552	43%	0.433	S	S	*	.			trans	-122.8	130.5	-177.7	-60.8	-178.8	-176.1	174.9	0	111.4	T43 I47 S48 L49	T43-K45 VanDerWaalsContact C-N 3.33Å; T43-K45 WeakPolarHBondContact CG2-O 3.34Å; T43-K45 PolarHBondContact OG1-N 3.28Å; K45-I47 VanDerWaalsContact C-N 3.33Å; K45-I47 PolarHBondContact O-N 3.3Å; K45-S48 PolarHBondContact O-N 2.89Å; K45-L49 PolarHBondContact O-N 3.43Å
46	K	82.7	Confident	85.5	Confident	148 Å²	148	78.5 Å²	78.5	64%	0.643	41%	0.409	S	S	*	.	H	α-helix	trans	-59.4	-42.6	176.9	-169.1	178.9	178.3	-176.3	0	112.3	Y34 S48 L49 H50	Y34-K46 HydrophobicContact CD2-CB 4.47Å; Y34-K46 HydrophobicContact CE1-CB 3.97Å; Y34-K46 HydrophobicContact CE1-CD 4.49Å; Y34-K46 HydrophobicContact CE1-CG 4Å; Y34-K46 HydrophobicContact CE2-CB 3.93Å; Y34-K46 VanDerWaalsContact CE2-N 3.35Å; K46-S48 VanDerWaalsContact C-N 3.33Å; K46-S48 PolarHBondContact O-N 3.22Å; K46-L49 PolarHBondContact O-N 2.91Å; K46-H50 PolarHBondContact O-N 3.35Å
47	I	86.4	Confident	85.2	Confident	126 Å²	126	85.7 Å²	85.7	65%	0.646	44%	0.44	S	S	*	.	H	α-helix	trans	-62.5	-41.6	179.8	-65.4	161.3	0	0	0	110.8	K45 L49 H50 N51	K45-I47 VanDerWaalsContact C-N 3.33Å; K45-I47 PolarHBondContact O-N 3.3Å; I47-L49 VanDerWaalsContact C-N 3.33Å; I47-L49 PolarHBondContact O-N 3.28Å; I47-H50 PolarHBondContact O-N 3.44Å; I47-N51 PolarHBondContact O-N 3.47Å; I47-N51 PolarHBondContact O-OD1 3.12Å
48	S	88.6	Confident	84.6	Confident	40 Å²	40	86.6 Å²	86.6	28%	0.28	44%	0.439	S	S	.	.	H	α-helix	trans	-64.7	-37.3	176.9	-59.3	0	0	0	0	112.1	T43 K45 K46 H52	T43-S48 WeakPolarHBondContact OG1-CB 3.35Å; K45-S48 PolarHBondContact O-N 2.89Å; K46-S48 VanDerWaalsContact C-N 3.33Å; K46-S48 PolarHBondContact O-N 3.22Å; S48-H52 VanDerWaalsContact O-CB 3.23Å; S48-H52 WeakPolarHBondContact O-CB 3.17Å; S48-H52 PolarHBondContact O-N 3.38Å; S48-H52 VanDerWaalsContact O-N 3.12Å
49	L	89.1	Confident	83.5	Confident	25 Å²	25	85.5 Å²	85.5	13%	0.131	44%	0.437	C	S	.	.	H	α-helix	trans	-66.3	-43.4	173.6	-179.8	67.5	0	0	0	110.7	Y34 C36 T43 K45 K46 I47 H52 L53	Y34-L49 HydrophobicContact CD1-CD2 4.28Å; Y34-L49 HydrophobicContact CG-CD2 4.39Å; C36-L49 HydrophobicContact CB-CD1 4.09Å; T43-L49 HydrophobicContact CG2-CB 3.79Å; K45-L49 PolarHBondContact O-N 3.43Å; K46-L49 PolarHBondContact O-N 2.91Å; I47-L49 VanDerWaalsContact C-N 3.33Å; I47-L49 PolarHBondContact O-N 3.28Å; L49-H52 WeakPolarHBondContact O-CB 3.43Å; L49-H52 PolarHBondContact O-N 2.78Å; L49-L53 HydrophobicContact CD1-CD1 4.45Å; L49-L53 HydrophobicContact CD1-CG 4.28Å; L49-L53 HydrophobicContact CD2-CD1 4.36Å; L49-L53 HydrophobicContact CG-CD1 4.01Å; L49-L53 HydrophobicContact CG-CG 4.27Å; L49-L53 WeakPolarHBondContact O-CG 3.35Å; L49-L53 PolarHBondContact O-N 3.38Å
50	H	88.8	Confident	82.2	Confident	105 Å²	105	86.3 Å²	86.3	49%	0.486	44%	0.442	S	S	.	.	H	α-helix	trans	-58.6	-52.2	179.7	-172.3	-83.4	0	0	0	111.9	K46 I47 H52 L53 E54	K46-H50 PolarHBondContact O-N 3.35Å; I47-H50 PolarHBondContact O-N 3.44Å; H50-H52 PolarHBondContact O-N 3.37Å; H50-L53 PolarHBondContact O-N 3.27Å; H50-L53 VanDerWaalsContact O-N 3.12Å; H50-E54 IonicContact CE1-OE2 3.38Å; H50-E54 PolarHBondContact CE1-OE2 3.36Å; H50-E54 IonicContact ND1-OE2 3.22Å; H50-E54 PolarHBondContact ND1-OE2 3.45Å; H50-E54 PolarHBondContact O-N 3.38Å
51	N	89.3	Confident	80.7	Confident	96 Å²	96	87.7 Å²	87.7	51%	0.513	44%	0.441	S	S	.	.	H	α-helix	trans	-61.6	-36.3	178.8	-64.5	3.8	0	0	0	111.7	I47 E54 S55	I47-N51 PolarHBondContact O-N 3.47Å; I47-N51 PolarHBondContact O-OD1 3.12Å; N51-E54 PolarHBondContact O-N 3.46Å; N51-S55 PolarHBondContact O-N 3.15Å; N51-S55 VanDerWaalsContact O-N 3.14Å
52	H	89.7	Confident	79.1	Confident	35 Å²	35	86.5 Å²	86.5	16%	0.162	45%	0.451	C	S	.	.	H	α-helix	trans	-64.6	-43.5	174.8	166.9	77.2	0	0	0	112.2	C36 C39 Y41 S48 L49 H50 E54 S55 H56	C36-H52 WeakPolarHBondContact CB-NE2 3.39Å; C36-H52 PolarHBondContact SG-NE2 3.21Å; C39-H52 PolarHBondContact SG-CE1 3.31Å; C39-H52 PolarHBondContact SG-NE2 2.95Å; Y41-H52 WeakPolarHBondContact CB-CE1 3.34Å; Y41-H52 WeakPolarHBondContact CB-NE2 3.42Å; Y41-H52 HydrophobicContact CD1-CB 4.05Å; Y41-H52 AromaticContact CD1-CD2 3.46Å; Y41-H52 VanDerWaalsContact CD1-CD2 3.46Å; Y41-H52 WeakPolarHBondContact CD1-CD2 3.48Å; Y41-H52 AromaticContact CD1-CE1 3.81Å; Y41-H52 AromaticContact CD1-CG 3.45Å; Y41-H52 VanDerWaalsContact CD1-CG 3.45Å; Y41-H52 AromaticContact CD1-ND1 3.69Å; Y41-H52 AromaticContact CD1-NE2 3.65Å; Y41-H52 HydrophobicContact CE1-CB 3.86Å; Y41-H52 AromaticContact CE1-CG 3.77Å; Y41-H52 AromaticContact CG-CE1 3.55Å; Y41-H52 AromaticContact CG-CG 3.96Å; Y41-H52 AromaticContact CG-ND1 3.7Å; Y41-H52 AromaticContact CG-NE2 3.71Å; S48-H52 VanDerWaalsContact O-CB 3.23Å; S48-H52 WeakPolarHBondContact O-CB 3.17Å; S48-H52 PolarHBondContact O-N 3.38Å; S48-H52 VanDerWaalsContact O-N 3.12Å; L49-H52 WeakPolarHBondContact O-CB 3.43Å; L49-H52 PolarHBondContact O-N 2.78Å; H50-H52 PolarHBondContact O-N 3.37Å; H52-E54 VanDerWaalsContact C-N 3.28Å; H52-E54 PolarHBondContact O-N 3.02Å; H52-S55 VanDerWaalsContact O-CB 3.3Å; H52-S55 WeakPolarHBondContact O-CB 3.18Å; H52-S55 PolarHBondContact O-N 2.89Å; H52-S55 VanDerWaalsContact O-N 3.11Å; H52-H56 AromaticContact CD2-CD2 3.84Å; H52-H56 AromaticContact CD2-NE2 3.96Å; H52-H56 AromaticContact CE1-CD2 3.62Å; H52-H56 AromaticContact CE1-NE2 3.13Å; H52-H56 PolarHBondContact CE1-NE2 3.26Å; H52-H56 AromaticContact NE2-CD2 3.35Å; H52-H56 PolarHBondContact NE2-CD2 3.11Å; H52-H56 VanDerWaalsContact NE2-CD2 3.35Å; H52-H56 AromaticContact NE2-NE2 3Å; H52-H56 PolarHBondContact NE2-NE2 3.09Å; H52-H56 PolarHBondContact O-CD2 3.46Å; H52-H56 PolarHBondContact O-N 2.89Å
53	L	87.8	Confident	77.4	Confident	53 Å²	53	91.2 Å²	91.2	28%	0.277	47%	0.468	S	S	.	.	H	α-helix	trans	-64.1	-32.7	174.6	-68.8	171.5	0	0	0	112.1	L49 H50 S55 H56 K57	L49-L53 HydrophobicContact CD1-CD1 4.45Å; L49-L53 HydrophobicContact CD1-CG 4.28Å; L49-L53 HydrophobicContact CD2-CD1 4.36Å; L49-L53 HydrophobicContact CG-CD1 4.01Å; L49-L53 HydrophobicContact CG-CG 4.27Å; L49-L53 WeakPolarHBondContact O-CG 3.35Å; L49-L53 PolarHBondContact O-N 3.38Å; H50-L53 PolarHBondContact O-N 3.27Å; H50-L53 VanDerWaalsContact O-N 3.12Å; L53-S55 VanDerWaalsContact C-N 3.32Å; L53-H56 WeakPolarHBondContact O-CB 3.39Å; L53-H56 PolarHBondContact O-N 3.49Å; L53-K57 PolarHBondContact O-N 2.87Å
54	E	88.8	Confident	75.6	Confident	93 Å²	93	99.6 Å²	99.6	44%	0.435	50%	0.504	S	S	.	.	H	α-helix	trans	-65.3	-36.9	172.4	-68.9	-168.5	101.5	0	0	112.1	H50 N51 H52 H56 K57 L58	H50-E54 IonicContact CE1-OE2 3.38Å; H50-E54 PolarHBondContact CE1-OE2 3.36Å; H50-E54 IonicContact ND1-OE2 3.22Å; H50-E54 PolarHBondContact ND1-OE2 3.45Å; H50-E54 PolarHBondContact O-N 3.38Å; N51-E54 PolarHBondContact O-N 3.46Å; H52-E54 VanDerWaalsContact C-N 3.28Å; H52-E54 PolarHBondContact O-N 3.02Å; E54-H56 VanDerWaalsContact C-N 3.28Å; E54-H56 PolarHBondContact O-N 3.16Å; E54-K57 WeakPolarHBondContact O-CB 3.43Å; E54-K57 PolarHBondContact O-N 3.15Å; E54-K57 VanDerWaalsContact O-N 3.13Å; E54-L58 PolarHBondContact O-N 3.26Å
55	S	85.2	Confident	74.1	Confident	66 Å²	66	99 Å²	99	46%	0.462	51%	0.512	S	S	.	.	H	α-helix	trans	-61.6	-36.5	171.8	-172.2	0	0	0	0	112.3	N51 H52 L53 K57 L58 T59	N51-S55 PolarHBondContact O-N 3.15Å; N51-S55 VanDerWaalsContact O-N 3.14Å; H52-S55 VanDerWaalsContact O-CB 3.3Å; H52-S55 WeakPolarHBondContact O-CB 3.18Å; H52-S55 PolarHBondContact O-N 2.89Å; H52-S55 VanDerWaalsContact O-N 3.11Å; L53-S55 VanDerWaalsContact C-N 3.32Å; S55-K57 VanDerWaalsContact C-N 3.31Å; S55-K57 PolarHBondContact O-N 2.93Å; S55-L58 PolarHBondContact O-N 3.4Å; S55-T59 PolarHBondContact O-N 3.44Å; S55-T59 PolarHBondContact O-OG1 3.34Å
56	H	84.5	Confident	72.7	Confident	37 Å²	37	100 Å²	100	17%	0.171	52%	0.522	C	S	.	.	H	α-helix	trans	-65.1	-32.4	174.3	-81.5	-73.2	0	0	0	113.2	C39 H52 L53 E54 L58 T59 S60	C39-H56 PolarHBondContact SG-NE2 3.44Å; H52-H56 AromaticContact CD2-CD2 3.84Å; H52-H56 AromaticContact CD2-NE2 3.96Å; H52-H56 AromaticContact CE1-CD2 3.62Å; H52-H56 AromaticContact CE1-NE2 3.13Å; H52-H56 PolarHBondContact CE1-NE2 3.26Å; H52-H56 AromaticContact NE2-CD2 3.35Å; H52-H56 PolarHBondContact NE2-CD2 3.11Å; H52-H56 VanDerWaalsContact NE2-CD2 3.35Å; H52-H56 AromaticContact NE2-NE2 3Å; H52-H56 PolarHBondContact NE2-NE2 3.09Å; H52-H56 PolarHBondContact O-CD2 3.46Å; H52-H56 PolarHBondContact O-N 2.89Å; L53-H56 WeakPolarHBondContact O-CB 3.39Å; L53-H56 PolarHBondContact O-N 3.49Å; E54-H56 VanDerWaalsContact C-N 3.28Å; E54-H56 PolarHBondContact O-N 3.16Å; H56-L58 VanDerWaalsContact C-N 3.31Å; H56-L58 PolarHBondContact O-N 2.96Å; H56-T59 WeakPolarHBondContact CA-OG1 3.13Å; H56-T59 PolarHBondContact O-N 3.34Å; H56-T59 PolarHBondContact O-OG1 2.89Å; H56-S60 WeakPolarHBondContact O-CB 3.05Å; H56-S60 PolarHBondContact O-N 3.33Å; H56-S60 PolarHBondContact O-OG 3.13Å
57	K	79.4	Confident	70.9	Confident	153 Å²	153	105.4 Å²	105.4	67%	0.665	55%	0.549	S	S	*	.	H	α-helix	trans	-68.4	-32.5	177.1	-67.1	178.6	-178.3	-176.8	0	112.4	L53 E54 S55	L53-K57 PolarHBondContact O-N 2.87Å; E54-K57 WeakPolarHBondContact O-CB 3.43Å; E54-K57 PolarHBondContact O-N 3.15Å; E54-K57 VanDerWaalsContact O-N 3.13Å; S55-K57 VanDerWaalsContact C-N 3.31Å; S55-K57 PolarHBondContact O-N 2.93Å
58	L	69.6	Low	70.1	Confident	144 Å²	144	104.4 Å²	104.4	75%	0.754	54%	0.544	S	S	*	.	H	α-helix	trans	-73.1	-35.2	177	-62.1	173.9	0	0	0	111.6	E54 S55 H56	E54-L58 PolarHBondContact O-N 3.26Å; S55-L58 PolarHBondContact O-N 3.4Å; H56-L58 VanDerWaalsContact C-N 3.31Å; H56-L58 PolarHBondContact O-N 2.96Å
59	T	61.1	Low	69.1	Low	81 Å²	81	107.8 Å²	107.8	50%	0.497	56%	0.558	S	S	.	*	H	α-helix	trans	-85.3	-34.8	178.9	55.9	0	0	0	0	113.6	S55 H56 K61 A62	S55-T59 PolarHBondContact O-N 3.44Å; S55-T59 PolarHBondContact O-OG1 3.34Å; H56-T59 WeakPolarHBondContact CA-OG1 3.13Å; H56-T59 PolarHBondContact O-N 3.34Å; H56-T59 PolarHBondContact O-OG1 2.89Å; T59-K61 PolarHBondContact O-N 3.05Å; T59-K61 VanDerWaalsContact O-N 3.14Å; T59-A62 WeakPolarHBondContact O-CB 3.49Å; T59-A62 PolarHBondContact O-N 3.28Å
60	S	56.8	Low	68	Low	63 Å²	63	112.4 Å²	112.4	44%	0.441	58%	0.582	S	S	.	*	H	α-helix	trans	-64.3	-18.9	179	-65	0	0	0	0	113.5	H56 A62 K64	H56-S60 WeakPolarHBondContact O-CB 3.05Å; H56-S60 PolarHBondContact O-N 3.33Å; H56-S60 PolarHBondContact O-OG 3.13Å; S60-A62 PolarHBondContact O-N 3.39Å; S60-K64 PolarHBondContact O-N 3.45Å
61	K	53.2	Low	66.8	Low	179 Å²	179	112.8 Å²	112.8	78%	0.778	59%	0.588	S	S	*	*	H	α-helix	trans	-71.4	-18.1	173.5	-155.4	175.1	-178.2	179.5	0	112.6	T59	T59-K61 PolarHBondContact O-N 3.05Å; T59-K61 VanDerWaalsContact O-N 3.14Å
62	A	48.8	Very low	65.4	Low	69 Å²	69	113.9 Å²	113.9	57%	0.57	59%	0.592	S	S	*	*	H	α-helix	trans	-87.2	-32.6	177.5	0	0	0	0	0	113.1	T59 S60	T59-A62 WeakPolarHBondContact O-CB 3.49Å; T59-A62 PolarHBondContact O-N 3.28Å; S60-A62 PolarHBondContact O-N 3.39Å
63	E	48.4	Very low	63.8	Low	163 Å²	163	119.1 Å²	119.1	76%	0.762	62%	0.621	S	S	*	*	H	α-helix	trans	-80.9	-21.8	178.6	-73.8	-127.5	102.7	0	0	113.5	A65	E63-A65 PolarHBondContact O-N 3.32Å
64	K	47.1	Very low	62.1	Low	194 Å²	194	123.9 Å²	123.9	84%	0.843	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82	6.2	176.5	-136.1	-171.7	-174.5	-154.8	0	114.5	S60	S60-K64 PolarHBondContact O-N 3.45Å
65	A	48.9	Very low	60	Low	82 Å²	82	126.2 Å²	126.2	68%	0.678	66%	0.662	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.3	8.7	176.9	0	0	0	0	0	112.8	E63	E63-A65 PolarHBondContact O-N 3.32Å
66	I	53.1	Low	57.9	Low	149 Å²	149	131.3 Å²	131.3	76%	0.764	68%	0.679	S	S	*	*			trans	-117.3	59.7	172	-45.1	177.3	0	0	0	108.3
67	E	44.1	Very low	55.5	Low	261 Å²	261	139.8 Å²	139.8	100%	1.22	73%	0.725	S	S	*	*			trans	-143.6	0	151.2	-166.4	172.7	79.7	0	0	108.2

Retrieved 67 of 67 residues in 190.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).