RETNA_RAT Loading...

Resistin-like alpha

Probable hormone. Plays a role in pulmonary vascular remodeling (By similarity).

AlphaFold DB , UniProt , Accession Q99P85, Species RAT (Rattus norvegicus, Rat), Gene Retnla, Length 111 aa.

						>RETNA_RAT|Q99P85|Retnla
MKTATCSLLICVFLLQLMVPVNTDGTLDIIGKKKVKELLAHQDNYPSAVRKTLSCTNVKSMSKWASCPAGMTATGCSCGFACGSWEIQNENICNCLCLIVDWAYARCCQLS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.5	Low	81	Confident	210 Å²	210	107.4 Å²	107.4	100%	1.034	60%	0.604	S	S	*	*				0	-26.5	0	-62.7	178	73.7	0	0	114.2	T3	M1-T3 PolarHBondContact O-N 2.82Å
2	K	67.7	Low	81.5	Confident	186 Å²	186	104.5 Å²	104.5	81%	0.809	59%	0.591	S	S	*	*	H	α-helix	trans	-71.8	-23.9	-174.2	-152.6	174	174.1	-178.9	0	115.9	T5 C6	K2-T5 WeakPolarHBondContact CA-OG1 3.5Å; K2-T5 PolarHBondContact O-OG1 3.29Å; K2-C6 PolarHBondContact O-N 3.46Å
3	T	74.7	Confident	81.8	Confident	119 Å²	119	107.1 Å²	107.1	73%	0.73	59%	0.592	S	S	*	*	H	α-helix	trans	-77.3	-39.3	176.5	43.6	0	0	0	0	112.3	M1 T5 C6 S7	M1-T3 PolarHBondContact O-N 2.82Å; T3-T5 VanDerWaalsContact C-N 3.34Å; T3-T5 PolarHBondContact O-N 2.92Å; T3-C6 PolarHBondContact O-N 2.99Å; T3-S7 PolarHBondContact O-N 3.42Å
4	A	81	Confident	82	Confident	66 Å²	66	106.5 Å²	106.5	55%	0.545	59%	0.587	S	S	.	*	H	α-helix	trans	-62.8	-40	176.4	0	0	0	0	0	111.8	C6 S7 L8	A4-C6 VanDerWaalsContact C-N 3.34Å; A4-C6 PolarHBondContact O-N 3.42Å; A4-S7 PolarHBondContact O-N 3.47Å; A4-L8 WeakPolarHBondContact O-CB 3.43Å; A4-L8 PolarHBondContact O-N 3.49Å
5	T	84.1	Confident	82	Confident	79 Å²	79	107.1 Å²	107.1	49%	0.485	59%	0.588	S	S	.	*	H	α-helix	trans	-64.7	-37.9	174.8	51.2	0	0	0	0	112.2	K2 T3 L8 L9	K2-T5 WeakPolarHBondContact CA-OG1 3.5Å; K2-T5 PolarHBondContact O-OG1 3.29Å; T3-T5 VanDerWaalsContact C-N 3.34Å; T3-T5 PolarHBondContact O-N 2.92Å; T5-L8 PolarHBondContact O-N 3.32Å; T5-L9 WeakPolarHBondContact O-CG 3.33Å; T5-L9 PolarHBondContact O-N 3.2Å
6	C	85.1	Confident	81.7	Confident	71 Å²	71	109.1 Å²	109.1	48%	0.48	59%	0.592	S	S	.	*	H	α-helix	trans	-66.5	-45.4	178.1	-155.3	0	0	0	0	111.3	K2 T3 A4 L8 L9 I10	K2-C6 PolarHBondContact O-N 3.46Å; T3-C6 PolarHBondContact O-N 2.99Å; A4-C6 VanDerWaalsContact C-N 3.34Å; A4-C6 PolarHBondContact O-N 3.42Å; C6-L8 VanDerWaalsContact C-N 3.32Å; C6-L8 PolarHBondContact O-N 3.04Å; C6-L9 PolarHBondContact O-N 3.31Å; C6-I10 WeakPolarHBondContact O-CG1 3.32Å; C6-I10 PolarHBondContact O-N 3.43Å
7	S	86.3	Confident	81.1	Confident	69 Å²	69	110.9 Å²	110.9	48%	0.483	60%	0.6	S	S	.	*	H	α-helix	trans	-61.8	-40	175.3	-168.1	0	0	0	0	112.1	T3 A4 I10 C11	T3-S7 PolarHBondContact O-N 3.42Å; A4-S7 PolarHBondContact O-N 3.47Å; S7-I10 PolarHBondContact O-N 3.46Å; S7-C11 WeakPolarHBondContact O-CB 3.33Å; S7-C11 PolarHBondContact O-N 2.94Å; S7-C11 PolarHBondContact O-SG 3.21Å
8	L	88.7	Confident	80.6	Confident	119 Å²	119	113.3 Å²	113.3	62%	0.623	61%	0.609	S	S	*	*	H	α-helix	trans	-63.7	-43.5	178.1	-163.2	106.1	0	0	0	111.5	A4 T5 C6 C11 V12	A4-L8 WeakPolarHBondContact O-CB 3.43Å; A4-L8 PolarHBondContact O-N 3.49Å; T5-L8 PolarHBondContact O-N 3.32Å; C6-L8 VanDerWaalsContact C-N 3.32Å; C6-L8 PolarHBondContact O-N 3.04Å; L8-C11 PolarHBondContact O-N 3.02Å; L8-V12 VanDerWaalsContact O-CG2 3.32Å; L8-V12 WeakPolarHBondContact O-CG2 3.11Å; L8-V12 PolarHBondContact O-N 3.06Å
9	L	89.5	Confident	79.9	Confident	102 Å²	102	112.2 Å²	112.2	53%	0.534	61%	0.606	S	S	.	*	H	α-helix	trans	-61.5	-45.2	176.5	-72.4	169	0	0	0	111.5	T5 C6 C11 V12 F13	T5-L9 WeakPolarHBondContact O-CG 3.33Å; T5-L9 PolarHBondContact O-N 3.2Å; C6-L9 PolarHBondContact O-N 3.31Å; L9-C11 VanDerWaalsContact C-N 3.33Å; L9-C11 PolarHBondContact O-N 3.33Å; L9-V12 PolarHBondContact O-N 2.9Å; L9-F13 VanDerWaalsContact O-CD2 3.23Å; L9-F13 WeakPolarHBondContact O-CD2 3.5Å; L9-F13 PolarHBondContact O-N 3.45Å
10	I	89.1	Confident	78.9	Confident	96 Å²	96	111.6 Å²	111.6	49%	0.492	61%	0.608	S	S	.	*	H	α-helix	trans	-60.6	-44.3	176.6	-64.4	165.5	0	0	0	110.5	C6 S7 V12 F13 L14	C6-I10 WeakPolarHBondContact O-CG1 3.32Å; C6-I10 PolarHBondContact O-N 3.43Å; S7-I10 PolarHBondContact O-N 3.46Å; I10-V12 PolarHBondContact O-N 3.39Å; I10-F13 PolarHBondContact O-N 3.39Å; I10-L14 HydrophobicContact CG2-CD1 3.95Å; I10-L14 HydrophobicContact CG2-CG 4.39Å; I10-L14 WeakPolarHBondContact O-CG 3.23Å; I10-L14 PolarHBondContact O-N 3.31Å
11	C	88.1	Confident	78.2	Confident	64 Å²	64	111.9 Å²	111.9	43%	0.432	61%	0.614	S	S	.	*	H	α-helix	trans	-60.1	-42.6	175.6	-72.8	0	0	0	0	112.3	S7 L8 L9 L14 L15	S7-C11 WeakPolarHBondContact O-CB 3.33Å; S7-C11 PolarHBondContact O-N 2.94Å; S7-C11 PolarHBondContact O-SG 3.21Å; L8-C11 PolarHBondContact O-N 3.02Å; L9-C11 VanDerWaalsContact C-N 3.33Å; L9-C11 PolarHBondContact O-N 3.33Å; C11-L14 PolarHBondContact O-N 2.98Å; C11-L15 WeakPolarHBondContact O-CB 3.38Å; C11-L15 WeakPolarHBondContact O-CD1 3.34Å; C11-L15 PolarHBondContact O-N 3.45Å
12	V	87.5	Confident	78.5	Confident	73 Å²	73	107.7 Å²	107.7	44%	0.442	60%	0.595	S	S	.	*	H	α-helix	trans	-63.6	-43.8	177.1	171.7	0	0	0	0	111.2	L8 L9 I10 L15 Q16	L8-V12 VanDerWaalsContact O-CG2 3.32Å; L8-V12 WeakPolarHBondContact O-CG2 3.11Å; L8-V12 PolarHBondContact O-N 3.06Å; L9-V12 PolarHBondContact O-N 2.9Å; I10-V12 PolarHBondContact O-N 3.39Å; V12-L15 PolarHBondContact O-N 3.3Å; V12-Q16 HydrophobicContact CG1-CG 4.44Å; V12-Q16 WeakPolarHBondContact O-CG 3.47Å; V12-Q16 PolarHBondContact O-N 2.95Å
13	F	85.2	Confident	78.2	Confident	138 Å²	138	103.3 Å²	103.3	61%	0.605	58%	0.584	S	S	*	*	H	α-helix	trans	-61.7	-44.6	175.7	-86.3	-71.2	0	0	0	112.2	L9 I10 L15 Q16 L17	L9-F13 VanDerWaalsContact O-CD2 3.23Å; L9-F13 WeakPolarHBondContact O-CD2 3.5Å; L9-F13 PolarHBondContact O-N 3.45Å; I10-F13 PolarHBondContact O-N 3.39Å; F13-L15 PolarHBondContact O-N 3.43Å; F13-Q16 PolarHBondContact O-N 3.22Å; F13-L17 PolarHBondContact O-N 3.08Å
14	L	84.2	Confident	77.7	Confident	99 Å²	99	103.9 Å²	103.9	52%	0.518	58%	0.583	S	S	.	*	H	α-helix	trans	-63.5	-40.1	176.4	-70.9	171.7	0	0	0	112	I10 C11 Q16 L17 M18	I10-L14 HydrophobicContact CG2-CD1 3.95Å; I10-L14 HydrophobicContact CG2-CG 4.39Å; I10-L14 WeakPolarHBondContact O-CG 3.23Å; I10-L14 PolarHBondContact O-N 3.31Å; C11-L14 PolarHBondContact O-N 2.98Å; L14-Q16 VanDerWaalsContact C-N 3.31Å; L14-Q16 PolarHBondContact O-N 3.34Å; L14-L17 PolarHBondContact O-N 2.93Å; L14-M18 WeakPolarHBondContact O-CG 2.97Å; L14-M18 PolarHBondContact O-N 3.02Å; L14-M18 VanDerWaalsContact O-N 3.08Å
15	L	83.1	Confident	77	Confident	116 Å²	116	102.4 Å²	102.4	61%	0.607	57%	0.574	S	S	*	*	H	α-helix	trans	-61.4	-38.3	173.6	-89.2	153.7	0	0	0	112.1	C11 V12 F13 M18 V19	C11-L15 WeakPolarHBondContact O-CB 3.38Å; C11-L15 WeakPolarHBondContact O-CD1 3.34Å; C11-L15 PolarHBondContact O-N 3.45Å; V12-L15 PolarHBondContact O-N 3.3Å; F13-L15 PolarHBondContact O-N 3.43Å; L15-M18 PolarHBondContact O-N 3.46Å; L15-V19 PolarHBondContact O-N 3.09Å
16	Q	75.8	Confident	76.6	Confident	138 Å²	138	102.4 Å²	102.4	65%	0.645	57%	0.574	S	S	*	*	H	α-helix	trans	-69.7	-37.3	176.9	-61.2	-112.3	-72.4	0	0	112	V12 F13 L14 M18 V19	V12-Q16 HydrophobicContact CG1-CG 4.44Å; V12-Q16 WeakPolarHBondContact O-CG 3.47Å; V12-Q16 PolarHBondContact O-N 2.95Å; F13-Q16 PolarHBondContact O-N 3.22Å; L14-Q16 VanDerWaalsContact C-N 3.31Å; L14-Q16 PolarHBondContact O-N 3.34Å; Q16-M18 VanDerWaalsContact C-N 3.26Å; Q16-M18 PolarHBondContact O-N 3.5Å; Q16-V19 WeakPolarHBondContact O-CB 3.48Å; Q16-V19 PolarHBondContact O-N 2.84Å; Q16-V19 VanDerWaalsContact O-N 3.15Å
17	L	72.8	Confident	76.2	Confident	140 Å²	140	105.1 Å²	105.1	73%	0.733	58%	0.583	S	S	*	*	H	α-helix	trans	-65	-28.8	173.2	-89.1	144.7	0	0	0	112.8	F13 L14 V19	F13-L17 PolarHBondContact O-N 3.08Å; L14-L17 PolarHBondContact O-N 2.93Å; L17-V19 VanDerWaalsContact C-N 3.27Å
18	M	71.3	Confident	75.9	Confident	155 Å²	155	105.6 Å²	105.6	76%	0.764	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.5	-8.2	174	-72.9	-170.7	179.2	0	0	113.8	L14 L15 Q16 P20	L14-M18 WeakPolarHBondContact O-CG 2.97Å; L14-M18 PolarHBondContact O-N 3.02Å; L14-M18 VanDerWaalsContact O-N 3.08Å; L15-M18 PolarHBondContact O-N 3.46Å; Q16-M18 VanDerWaalsContact C-N 3.26Å; Q16-M18 PolarHBondContact O-N 3.5Å; M18-P20 WeakPolarHBondContact O-CD 3.47Å
19	V	68.5	Low	75.4	Confident	91 Å²	91	105.5 Å²	105.5	55%	0.552	58%	0.579	S	S	*	*	S	Bend	trans	-79.3	102.8	168.3	-175.3	0	0	0	0	106.1	L15 Q16 L17 V21	L15-V19 PolarHBondContact O-N 3.09Å; Q16-V19 WeakPolarHBondContact O-CB 3.48Å; Q16-V19 PolarHBondContact O-N 2.84Å; Q16-V19 VanDerWaalsContact O-N 3.15Å; L17-V19 VanDerWaalsContact C-N 3.27Å; V19-V21 PolarHBondContact O-N 3.49Å
20	P	59.6	Low	74.9	Confident	101 Å²	101	105.5 Å²	105.5	66%	0.656	58%	0.579	S	S	*	*			trans	-58.7	112.6	173.2	24.8	-32.5	0	0	0	106.7	M18 N22	M18-P20 WeakPolarHBondContact O-CD 3.47Å; P20-N22 VanDerWaalsContact C-N 3.27Å; P20-N22 PolarHBondContact O-N 3.15Å; P20-N22 PolarHBondContact O-OD1 3.33Å; P20-N22 VanDerWaalsContact O-OD1 3.09Å
21	V	63.8	Low	74.5	Confident	118 Å²	118	102.7 Å²	102.7	72%	0.715	57%	0.573	S	S	*	*			trans	-66.2	100.6	170.9	88.5	0	0	0	0	105.3	V19 T23	V19-V21 PolarHBondContact O-N 3.49Å; V21-T23 HydrophobicContact CG1-CG2 4Å; V21-T23 HydrophobicContact CG2-CG2 4.48Å; V21-T23 PolarHBondContact O-N 3.13Å; V21-T23 PolarHBondContact O-OG1 3.46Å
22	N	61.6	Low	74.3	Confident	122 Å²	122	105.4 Å²	105.4	65%	0.652	58%	0.578	S	S	*	*			trans	-75.7	59.2	-175.3	37.8	-39.7	0	0	0	109.4	P20 D24 T26	P20-N22 VanDerWaalsContact C-N 3.27Å; P20-N22 PolarHBondContact O-N 3.15Å; P20-N22 PolarHBondContact O-OD1 3.33Å; P20-N22 VanDerWaalsContact O-OD1 3.09Å; N22-D24 VanDerWaalsContact C-N 3.32Å; N22-T26 PolarHBondContact O-OG1 2.9Å
23	T	62.2	Low	74.2	Confident	93 Å²	93	109 Å²	109	57%	0.571	59%	0.588	S	S	*	*	H	α-helix	trans	-69.6	-32.8	173.9	43.8	0	0	0	0	111.4	V21 G25 T26 L27	V21-T23 HydrophobicContact CG1-CG2 4Å; V21-T23 HydrophobicContact CG2-CG2 4.48Å; V21-T23 PolarHBondContact O-N 3.13Å; V21-T23 PolarHBondContact O-OG1 3.46Å; T23-G25 PolarHBondContact O-N 2.82Å; T23-T26 WeakPolarHBondContact O-CB 3.32Å; T23-T26 PolarHBondContact O-N 3.29Å; T23-T26 VanDerWaalsContact O-N 3.13Å; T23-L27 PolarHBondContact O-N 3.29Å
24	D	63.7	Low	74.1	Confident	132 Å²	132	109.2 Å²	109.2	71%	0.706	59%	0.588	S	S	*	*	H	α-helix	trans	-63.5	-43	-178.6	-157.6	26.6	0	0	0	112.1	N22 T26 L27 D28	N22-D24 VanDerWaalsContact C-N 3.32Å; D24-T26 VanDerWaalsContact C-N 3.28Å; D24-T26 PolarHBondContact O-N 3.04Å; D24-L27 PolarHBondContact O-N 3.19Å; D24-D28 PolarHBondContact O-N 2.97Å; D24-D28 VanDerWaalsContact O-N 3.1Å
25	G	67.4	Low	74.1	Confident	35 Å²	35	108.5 Å²	108.5	36%	0.361	59%	0.587	S	S	.	*	H	α-helix	trans	-64.2	-31.8	174.7	0	0	0	0	0	113.2	T23 I29	T23-G25 PolarHBondContact O-N 2.82Å; G25-I29 WeakPolarHBondContact O-CB 3.48Å; G25-I29 VanDerWaalsContact O-CD1 3.32Å; G25-I29 WeakPolarHBondContact O-CD1 3.11Å; G25-I29 WeakPolarHBondContact O-CG1 3.29Å; G25-I29 PolarHBondContact O-N 3.41Å
26	T	76.1	Confident	74.1	Confident	78 Å²	78	110.2 Å²	110.2	48%	0.479	59%	0.59	S	S	.	*	H	α-helix	trans	-69.3	-42.4	178.8	-55.5	0	0	0	0	111	N22 T23 D24 I29 I30	N22-T26 PolarHBondContact O-OG1 2.9Å; T23-T26 WeakPolarHBondContact O-CB 3.32Å; T23-T26 PolarHBondContact O-N 3.29Å; T23-T26 VanDerWaalsContact O-N 3.13Å; D24-T26 VanDerWaalsContact C-N 3.28Å; D24-T26 PolarHBondContact O-N 3.04Å; T26-I29 PolarHBondContact O-N 2.96Å; T26-I30 HydrophobicContact CG2-CD1 3.84Å; T26-I30 HydrophobicContact CG2-CG1 4.5Å; T26-I30 WeakPolarHBondContact O-CB 3.4Å; T26-I30 VanDerWaalsContact O-CG1 3.23Å; T26-I30 WeakPolarHBondContact O-CG1 3.27Å; T26-I30 PolarHBondContact O-N 2.85Å
27	L	75.8	Confident	74.4	Confident	129 Å²	129	109.4 Å²	109.4	68%	0.675	59%	0.586	S	S	*	*	H	α-helix	trans	-65.1	-43.3	177.1	-165.8	82.4	0	0	0	111.4	T23 D24 I29 I30 G31	T23-L27 PolarHBondContact O-N 3.29Å; D24-L27 PolarHBondContact O-N 3.19Å; L27-I29 PolarHBondContact O-N 3.4Å; L27-I30 PolarHBondContact O-N 3.34Å; L27-G31 PolarHBondContact O-N 2.97Å
28	D	79.5	Confident	74.6	Confident	79 Å²	79	108.4 Å²	108.4	42%	0.422	58%	0.581	S	S	.	*	H	α-helix	trans	-61.4	-42.8	176.4	178.8	68.8	0	0	0	111.9	D24 K32	D24-D28 PolarHBondContact O-N 2.97Å; D24-D28 VanDerWaalsContact O-N 3.1Å; D28-K32 VanDerWaalsContact O-CB 3.28Å; D28-K32 WeakPolarHBondContact O-CB 3.23Å; D28-K32 VanDerWaalsContact O-CG 3.27Å; D28-K32 WeakPolarHBondContact O-CG 3.46Å; D28-K32 PolarHBondContact O-N 3.33Å; D28-K32 WeakPolarHBondContact OD1-CE 3.48Å; D28-K32 IonicContact OD1-NZ 3.01Å; D28-K32 PolarHBondContact OD1-NZ 2.99Å; D28-K32 WeakPolarHBondContact OD2-CD 3.28Å; D28-K32 WeakPolarHBondContact OD2-CE 3.27Å; D28-K32 IonicContact OD2-NZ 2.68Å; D28-K32 PolarHBondContact OD2-NZ 3.49Å
29	I	78.8	Confident	74.9	Confident	116 Å²	116	105.3 Å²	105.3	60%	0.595	57%	0.567	S	S	*	*	H	α-helix	trans	-64	-45.9	176.1	-69.2	164.8	0	0	0	111.1	G25 T26 L27 K33	G25-I29 WeakPolarHBondContact O-CB 3.48Å; G25-I29 VanDerWaalsContact O-CD1 3.32Å; G25-I29 WeakPolarHBondContact O-CD1 3.11Å; G25-I29 WeakPolarHBondContact O-CG1 3.29Å; G25-I29 PolarHBondContact O-N 3.41Å; T26-I29 PolarHBondContact O-N 2.96Å; L27-I29 PolarHBondContact O-N 3.4Å; I29-K33 VanDerWaalsContact O-CB 3.29Å; I29-K33 WeakPolarHBondContact O-CB 3.38Å; I29-K33 PolarHBondContact O-N 3.43Å
30	I	79.8	Confident	75.2	Confident	103 Å²	103	103.9 Å²	103.9	53%	0.528	57%	0.565	S	S	.	*	H	α-helix	trans	-64.2	-45.6	179.5	-68.7	167.8	0	0	0	110.5	T26 L27 K33 K34	T26-I30 HydrophobicContact CG2-CD1 3.84Å; T26-I30 HydrophobicContact CG2-CG1 4.5Å; T26-I30 WeakPolarHBondContact O-CB 3.4Å; T26-I30 VanDerWaalsContact O-CG1 3.23Å; T26-I30 WeakPolarHBondContact O-CG1 3.27Å; T26-I30 PolarHBondContact O-N 2.85Å; L27-I30 PolarHBondContact O-N 3.34Å; I30-K33 PolarHBondContact O-N 2.91Å; I30-K34 PolarHBondContact O-N 3.4Å
31	G	80.4	Confident	75.6	Confident	37 Å²	37	105.5 Å²	105.5	38%	0.381	56%	0.563	S	S	.	*	H	α-helix	trans	-60.7	-50.5	177.8	0	0	0	0	0	112	L27 K33 K34 V35	L27-G31 PolarHBondContact O-N 2.97Å; G31-K33 VanDerWaalsContact C-N 3.33Å; G31-K33 PolarHBondContact O-N 3.1Å; G31-K34 PolarHBondContact O-N 3.35Å; G31-V35 WeakPolarHBondContact O-CG2 3.03Å; G31-V35 PolarHBondContact O-N 2.95Å
32	K	83.1	Confident	75.7	Confident	120 Å²	120	106.5 Å²	106.5	52%	0.522	56%	0.56	S	S	.	*	H	α-helix	trans	-61.3	-39.5	177.9	-76.2	173.5	176.7	161.6	0	112.6	D28 K36	D28-K32 VanDerWaalsContact O-CB 3.28Å; D28-K32 WeakPolarHBondContact O-CB 3.23Å; D28-K32 VanDerWaalsContact O-CG 3.27Å; D28-K32 WeakPolarHBondContact O-CG 3.46Å; D28-K32 PolarHBondContact O-N 3.33Å; D28-K32 WeakPolarHBondContact OD1-CE 3.48Å; D28-K32 IonicContact OD1-NZ 3.01Å; D28-K32 PolarHBondContact OD1-NZ 2.99Å; D28-K32 WeakPolarHBondContact OD2-CD 3.28Å; D28-K32 WeakPolarHBondContact OD2-CE 3.27Å; D28-K32 IonicContact OD2-NZ 2.68Å; D28-K32 PolarHBondContact OD2-NZ 3.49Å; K32-K36 WeakPolarHBondContact O-CB 3.34Å; K32-K36 WeakPolarHBondContact O-CG 3.47Å; K32-K36 PolarHBondContact O-N 3.46Å
33	K	85.4	Confident	75.7	Confident	150 Å²	150	107.7 Å²	107.7	65%	0.652	57%	0.566	S	S	*	*	H	α-helix	trans	-64.1	-45.8	177.7	-171.3	178.9	179.5	-177	0	111.2	I29 I30 G31 K36 E37	I29-K33 VanDerWaalsContact O-CB 3.29Å; I29-K33 WeakPolarHBondContact O-CB 3.38Å; I29-K33 PolarHBondContact O-N 3.43Å; I30-K33 PolarHBondContact O-N 2.91Å; G31-K33 VanDerWaalsContact C-N 3.33Å; G31-K33 PolarHBondContact O-N 3.1Å; K33-K36 PolarHBondContact O-N 3.47Å; K33-E37 WeakPolarHBondContact O-CB 3.49Å; K33-E37 PolarHBondContact O-N 3.33Å
34	K	83.8	Confident	75.7	Confident	142 Å²	142	109.1 Å²	109.1	62%	0.617	57%	0.571	S	S	*	*	H	α-helix	trans	-67.3	-39.2	-179.6	-165.4	162.9	-174.9	175.6	0	112.5	I30 G31 E37 L38	I30-K34 PolarHBondContact O-N 3.4Å; G31-K34 PolarHBondContact O-N 3.35Å; K34-E37 PolarHBondContact O-N 3.01Å; K34-L38 WeakPolarHBondContact O-CG 3.43Å; K34-L38 PolarHBondContact O-N 3.35Å; K34-L38 VanDerWaalsContact O-N 3.08Å
35	V	83.9	Confident	75.7	Confident	83 Å²	83	111 Å²	111	50%	0.503	57%	0.569	S	S	.	*	H	α-helix	trans	-63.3	-45.5	173.5	173.1	0	0	0	0	110.8	G31 E37 L38 L39	G31-V35 WeakPolarHBondContact O-CG2 3.03Å; G31-V35 PolarHBondContact O-N 2.95Å; V35-E37 VanDerWaalsContact C-N 3.32Å; V35-E37 PolarHBondContact O-N 2.68Å; V35-L38 PolarHBondContact O-N 3.08Å; V35-L39 HydrophobicContact CG1-CD1 3.89Å; V35-L39 HydrophobicContact CG1-CG 4.39Å; V35-L39 VanDerWaalsContact O-CG 3.29Å; V35-L39 WeakPolarHBondContact O-CG 3.34Å; V35-L39 PolarHBondContact O-N 2.85Å
36	K	83.2	Confident	75.4	Confident	153 Å²	153	113.8 Å²	113.8	67%	0.665	58%	0.581	S	S	*	*	H	α-helix	trans	-61.3	-38.7	176.5	-79.3	-176	177.9	-173.2	0	113	K32 K33 L39 A40	K32-K36 WeakPolarHBondContact O-CB 3.34Å; K32-K36 WeakPolarHBondContact O-CG 3.47Å; K32-K36 PolarHBondContact O-N 3.46Å; K33-K36 PolarHBondContact O-N 3.47Å; K36-L39 PolarHBondContact O-N 3.45Å; K36-A40 VanDerWaalsContact O-CB 3.27Å; K36-A40 WeakPolarHBondContact O-CB 3.34Å; K36-A40 PolarHBondContact O-N 3.4Å
37	E	81.1	Confident	74.9	Confident	121 Å²	121	115.4 Å²	115.4	57%	0.565	60%	0.596	S	S	*	*	H	α-helix	trans	-68.6	-39.2	179.2	-169.3	168.7	-170.5	0	0	112.2	K33 K34 V35 A40 H41	K33-E37 WeakPolarHBondContact O-CB 3.49Å; K33-E37 PolarHBondContact O-N 3.33Å; K34-E37 PolarHBondContact O-N 3.01Å; V35-E37 VanDerWaalsContact C-N 3.32Å; V35-E37 PolarHBondContact O-N 2.68Å; E37-A40 PolarHBondContact O-N 3Å; E37-H41 WeakPolarHBondContact O-CB 3.48Å; E37-H41 PolarHBondContact O-N 3Å
38	L	77.6	Confident	74.7	Confident	118 Å²	118	112.5 Å²	112.5	62%	0.618	59%	0.59	S	S	*	*	H	α-helix	trans	-65.4	-41.5	173.3	-69.9	171.1	0	0	0	112.1	K34 V35 H41 Q42	K34-L38 WeakPolarHBondContact O-CG 3.43Å; K34-L38 PolarHBondContact O-N 3.35Å; K34-L38 VanDerWaalsContact O-N 3.08Å; V35-L38 PolarHBondContact O-N 3.08Å; L38-H41 PolarHBondContact O-N 2.98Å; L38-Q42 PolarHBondContact O-N 3.41Å; L38-Q42 VanDerWaalsContact O-N 3.08Å
39	L	77.2	Confident	74.5	Confident	91 Å²	91	114.1 Å²	114.1	48%	0.476	60%	0.602	S	S	.	*	H	α-helix	trans	-67.2	-40.9	175.7	-67.3	172.4	0	0	0	111.7	V35 K36 H41 Q42 D43	V35-L39 HydrophobicContact CG1-CD1 3.89Å; V35-L39 HydrophobicContact CG1-CG 4.39Å; V35-L39 VanDerWaalsContact O-CG 3.29Å; V35-L39 WeakPolarHBondContact O-CG 3.34Å; V35-L39 PolarHBondContact O-N 2.85Å; K36-L39 PolarHBondContact O-N 3.45Å; L39-H41 VanDerWaalsContact C-N 3.28Å; L39-H41 PolarHBondContact O-N 2.99Å; L39-Q42 VanDerWaalsContact O-CB 3.3Å; L39-Q42 WeakPolarHBondContact O-CB 3.3Å; L39-Q42 PolarHBondContact O-N 3.41Å; L39-D43 PolarHBondContact O-N 3.21Å
40	A	75.9	Confident	74.7	Confident	60 Å²	60	119.9 Å²	119.9	50%	0.496	62%	0.617	S	S	.	*	H	α-helix	trans	-64.9	-32.2	174.7	0	0	0	0	0	112.4	K36 E37 Q42	K36-A40 VanDerWaalsContact O-CB 3.27Å; K36-A40 WeakPolarHBondContact O-CB 3.34Å; K36-A40 PolarHBondContact O-N 3.4Å; E37-A40 PolarHBondContact O-N 3Å; A40-Q42 VanDerWaalsContact C-N 3.33Å
41	H	67	Low	75.1	Confident	135 Å²	135	121.1 Å²	121.1	63%	0.625	62%	0.618	S	S	*	*	H	α-helix	trans	-69.2	-30.9	171.3	-114.4	76.4	0	0	0	112.6	E37 L38 L39 N44 Y45	E37-H41 WeakPolarHBondContact O-CB 3.48Å; E37-H41 PolarHBondContact O-N 3Å; L38-H41 PolarHBondContact O-N 2.98Å; L39-H41 VanDerWaalsContact C-N 3.28Å; L39-H41 PolarHBondContact O-N 2.99Å; H41-N44 CarbonylContact O-C 3.56Å; H41-N44 WeakPolarHBondContact O-CA 3.29Å; H41-N44 PolarHBondContact O-N 3.29Å; H41-N44 VanDerWaalsContact O-N 3.1Å; H41-Y45 PolarHBondContact O-N 3.27Å
42	Q	65.3	Low	75.8	Confident	139 Å²	139	123.7 Å²	123.7	65%	0.65	63%	0.627	S	S	*	*	H	α-helix	trans	-66.5	-37.9	177.4	-171	173.2	5.1	0	0	111.9	L38 L39 A40 N44 Y45	L38-Q42 PolarHBondContact O-N 3.41Å; L38-Q42 VanDerWaalsContact O-N 3.08Å; L39-Q42 VanDerWaalsContact O-CB 3.3Å; L39-Q42 WeakPolarHBondContact O-CB 3.3Å; L39-Q42 PolarHBondContact O-N 3.41Å; A40-Q42 VanDerWaalsContact C-N 3.33Å; Q42-N44 PolarHBondContact O-N 3.1Å; Q42-Y45 PolarHBondContact O-N 3.06Å
43	D	63.1	Low	76.4	Confident	147 Å²	147	123.3 Å²	123.3	79%	0.786	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.6	-15.7	172.9	-65.3	-33.6	0	0	0	112.8	L39	L39-D43 PolarHBondContact O-N 3.21Å
44	N	62.1	Low	77	Confident	124 Å²	124	118.8 Å²	118.8	66%	0.663	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.6	15.6	176.3	-151.5	-10	0	0	0	112.7	H41 Q42	H41-N44 CarbonylContact O-C 3.56Å; H41-N44 WeakPolarHBondContact O-CA 3.29Å; H41-N44 PolarHBondContact O-N 3.29Å; H41-N44 VanDerWaalsContact O-N 3.1Å; Q42-N44 PolarHBondContact O-N 3.1Å
45	Y	62.6	Low	77.7	Confident	171 Å²	171	113.9 Å²	113.9	67%	0.671	60%	0.6	S	S	*	*	S	Bend	trans	-70.3	122.7	158.3	-165.4	-99.8	0	0	0	106.6	H41 Q42 S47 A48	H41-Y45 PolarHBondContact O-N 3.27Å; Q42-Y45 PolarHBondContact O-N 3.06Å; Y45-S47 PolarHBondContact O-N 3.08Å; Y45-A48 HydrophobicContact CE1-CB 4.46Å
46	P	62.8	Low	78.4	Confident	93 Å²	93	112.8 Å²	112.8	60%	0.604	59%	0.594	S	S	*	*			trans	-51.7	122.4	175.5	20.2	-29.8	0	0	0	107	A48	P46-A48 PolarHBondContact O-N 2.82Å
47	S	64.1	Low	79.1	Confident	113 Å²	113	109.9 Å²	109.9	79%	0.79	59%	0.586	S	S	*	*			trans	-31.7	113.1	-177	-88.7	0	0	0	0	108.5	Y45 V49	Y45-S47 PolarHBondContact O-N 3.08Å; S47-V49 WeakPolarHBondContact O-CA 3.48Å; S47-V49 PolarHBondContact O-N 2.93Å
48	A	71.1	Confident	79.9	Confident	68 Å²	68	106 Å²	106	56%	0.562	57%	0.57	S	S	*	*			trans	-39.8	110.8	-171.3	0	0	0	0	0	107.7	Y45 P46 R50	Y45-A48 HydrophobicContact CE1-CB 4.46Å; P46-A48 PolarHBondContact O-N 2.82Å; A48-R50 VanDerWaalsContact C-N 3.34Å; A48-R50 WeakPolarHBondContact O-CG 3.42Å; A48-R50 PolarHBondContact O-N 2.84Å
49	V	77.1	Confident	80.9	Confident	112 Å²	112	104.7 Å²	104.7	68%	0.679	56%	0.559	S	S	*	*			trans	-58.3	105.4	-170.7	177.2	0	0	0	0	105.7	S47 K51	S47-V49 WeakPolarHBondContact O-CA 3.48Å; S47-V49 PolarHBondContact O-N 2.93Å; V49-K51 HydrophobicContact CG1-CG 3.94Å; V49-K51 PolarHBondContact O-N 2.74Å
50	R	82.6	Confident	81.9	Confident	237 Å²	237	102.1 Å²	102.1	89%	0.894	55%	0.549	S	S	*	.			trans	-75.2	86.2	-176.5	-72	-164.4	-72.5	174.3	-3.9	106.9	A48	A48-R50 VanDerWaalsContact C-N 3.34Å; A48-R50 WeakPolarHBondContact O-CG 3.42Å; A48-R50 PolarHBondContact O-N 2.84Å
51	K	88.3	Confident	83	Confident	129 Å²	129	106.1 Å²	106.1	56%	0.561	56%	0.559	S	S	*	*	P	Polyproline II helix	trans	-79.5	135.8	169.3	-64.7	-170.2	177	168	0	108.9	V49 L110 S111	V49-K51 HydrophobicContact CG1-CG 3.94Å; V49-K51 PolarHBondContact O-N 2.74Å; K51-L110 HydrophobicContact CB-CB 4.39Å; K51-L110 HydrophobicContact CB-CD2 4.3Å; K51-L110 HydrophobicContact CD-CB 4.16Å; K51-L110 HydrophobicContact CD-CD1 4.37Å; K51-S111 CarbonylContact C-O 3.45Å; K51-S111 WeakPolarHBondContact CA-O 3.4Å
52	T	94.4	Very high	84.4	Confident	91 Å²	91	101.7 Å²	101.7	56%	0.558	54%	0.543	S	S	*	.	P	Polyproline II helix	trans	-93.5	131	172.4	-53.9	0	0	0	0	108.4	L110 S111	T52-L110 WeakPolarHBondContact O-CA 3.41Å; T52-S111 PolarHBondContact N-O 3Å; T52-S111 PolarHBondContact O-N 3.15Å; T52-S111 PolarHBondContact O-OG 3.19Å
53	L	96.5	Very high	85.9	Confident	112 Å²	112	98.9 Å²	98.9	59%	0.586	53%	0.529	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89.4	118.1	171.8	-177	70.6	0	0	0	108.7	C108 L110	L53-C108 HydrophobicContact CD1-CB 4.01Å; L53-L110 HydrophobicContact CB-CD2 4.08Å; L53-L110 HydrophobicContact CD1-CD2 3.73Å; L53-L110 HydrophobicContact CD1-CG 4.3Å
54	S	97.7	Very high	87.6	Confident	56 Å²	56	97.4 Å²	97.4	39%	0.392	51%	0.512	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	134.4	173.5	-177.2	0	0	0	0	109.6	C108 Q109	S54-C108 CarbonylContact O-C 3.54Å; S54-C108 VanDerWaalsContact O-CA 3.23Å; S54-C108 WeakPolarHBondContact O-CA 3.45Å; S54-Q109 PolarHBondContact N-O 3.34Å; S54-Q109 PolarHBondContact O-N 2.88Å
55	C	98.3	Very high	89.3	Confident	38 Å²	38	91.6 Å²	91.6	26%	0.257	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.9	144.2	-177.7	-60.4	0	0	0	0	112.7	C107 C108	C55-C107 CarbonylContact C-O 3.57Å; C55-C107 WeakPolarHBondContact CA-O 3.26Å; C55-C108 HydrophobicContact CB-CB 4.1Å; C55-C108 WeakPolarHBondContact CB-SG 3.23Å; C55-C108 WeakPolarHBondContact SG-CB 3.25Å; C55-C108 CovalentContact SG-SG 2.04Å; C55-C108 PolarHBondContact SG-SG 3.19Å
56	T	98.2	Very high	91	Very high	60 Å²	60	86.4 Å²	86.4	37%	0.368	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.4	165.5	175.9	-168	0	0	0	0	111.4	M71 C107	T56-M71 HydrophobicContact CG2-CE 4.35Å; T56-M71 HydrophobicContact CG2-SD 3.69Å; T56-C107 HydrophobicContact CG2-CB 3.98Å; T56-C107 PolarHBondContact N-O 2.97Å; T56-C107 PolarHBondContact O-N 2.93Å
57	N	98.4	Very high	92.7	Very high	93 Å²	93	82.5 Å²	82.5	50%	0.497	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.3	129	173.6	-65.3	-18.2	0	0	0	109.1	Y104 A105 R106	N57-Y104 HydrophobicContact CB-CD1 4.16Å; N57-Y104 HydrophobicContact CB-CE1 4.21Å; N57-A105 WeakPolarHBondContact CA-O 3.23Å; N57-R106 WeakPolarHBondContact OD1-CD 3.02Å; N57-R106 PolarHBondContact OD1-NH1 3.05Å
58	V	98.5	Very high	94.4	Very high	38 Å²	38	80 Å²	80	23%	0.23	43%	0.426	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.4	118.6	171.8	-178.6	0	0	0	0	109	S66 P68 Y104 A105	V58-S66 WeakPolarHBondContact CG1-O 3.4Å; V58-P68 HydrophobicContact CG2-CG 4.43Å; V58-Y104 CarbonylContact O-C 3.52Å; V58-Y104 VanDerWaalsContact O-CA 3.29Å; V58-Y104 WeakPolarHBondContact O-CA 3.5Å; V58-Y104 WeakPolarHBondContact O-CD1 2.96Å; V58-A105 PolarHBondContact N-O 2.74Å; V58-A105 PolarHBondContact O-N 3.43Å
59	K	98.4	Very high	95.6	Very high	92 Å²	92	81.5 Å²	81.5	40%	0.4	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.5	143	170.4	-158.6	-177.2	-178.5	175.4	0	110.1	M61 A103 Y104	K59-M61 HydrophobicContact CD-CE 4.14Å; K59-M61 HydrophobicContact CD-SD 4.36Å; K59-A103 WeakPolarHBondContact CA-O 3.48Å; K59-Y104 HydrophobicContact CB-CD1 3.81Å; K59-Y104 HydrophobicContact CB-CE1 3.31Å; K59-Y104 HydrophobicContact CB-CE2 4.26Å; K59-Y104 HydrophobicContact CB-CG 4.47Å; K59-Y104 HydrophobicContact CD-CE1 4.31Å; K59-Y104 HydrophobicContact CD-CE2 3.82Å; K59-Y104 WeakPolarHBondContact CD-OH 3.06Å; K59-Y104 HydrophobicContact CG-CD1 4.13Å; K59-Y104 HydrophobicContact CG-CD2 4.12Å; K59-Y104 HydrophobicContact CG-CE1 3.73Å; K59-Y104 HydrophobicContact CG-CE2 3.7Å; K59-Y104 HydrophobicContact CG-CG 4.32Å; K59-Y104 VanDerWaalsContact CG-CZ 3.48Å
60	S	98.2	Very high	96.6	Very high	36 Å²	36	79.5 Å²	79.5	25%	0.252	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.3	140	168.3	174.6	0	0	0	0	109.6	S62 W64 W102 A103	S60-S62 PolarHBondContact O-N 3.14Å; S60-S62 PolarHBondContact OG-OG 2.89Å; S60-W64 WeakPolarHBondContact CB-O 3.06Å; S60-W64 PolarHBondContact OG-O 2.9Å; S60-W102 CarbonylContact O-C 3.53Å; S60-W102 VanDerWaalsContact O-CA 3.24Å; S60-W102 WeakPolarHBondContact O-CA 2.98Å; S60-W102 VanDerWaalsContact O-CB 3.28Å; S60-W102 WeakPolarHBondContact O-CB 2.98Å; S60-A103 PolarHBondContact N-O 2.02Å; S60-A103 PolarHBondContact O-N 2.77Å
61	M	97.8	Very high	97.3	Very high	145 Å²	145	69.5 Å²	69.5	71%	0.714	40%	0.404	S	S	*	.	S	Bend	trans	-85.2	47.5	175.6	-58.6	-57.5	-169	0	0	110.7	K59 D101 W102	K59-M61 HydrophobicContact CD-CE 4.14Å; K59-M61 HydrophobicContact CD-SD 4.36Å; M61-D101 CarbonylContact C-O 3.3Å; M61-W102 HydrophobicContact SD-CB 4.11Å
62	S	96.4	Very high	97.8	Very high	41 Å²	41	66.7 Å²	66.7	29%	0.287	40%	0.398	S	S	.	.	S	Bend	trans	-152.6	176.2	176.6	70.9	0	0	0	0	108.8	S60 W64 W102 A103	S60-S62 PolarHBondContact O-N 3.14Å; S60-S62 PolarHBondContact OG-OG 2.89Å; S62-W64 PolarHBondContact O-N 2.04Å; S62-W64 PolarHBondContact OG-N 2.86Å; S62-W64 PolarHBondContact OG-O 2.88Å; S62-W64 VanDerWaalsContact OG-O 3.09Å; S62-W102 CarbonylContact O-C 3.51Å; S62-W102 VanDerWaalsContact O-C 3.3Å; S62-A103 VanDerWaalsContact O-CB 3.26Å; S62-A103 WeakPolarHBondContact O-CB 3.28Å; S62-A103 PolarHBondContact O-N 3.19Å
63	K	97.6	Very high	98	Very high	80 Å²	80	62.7 Å²	62.7	35%	0.348	37%	0.373	S	S	.	.	S	Bend	trans	-71.2	-3	175.4	74	172.4	-165	166.8	0	114.3	C95 V100	K63-C95 HydrophobicContact CB-CB 4.16Å; K63-C95 PolarHBondContact O-N 2.92Å; K63-V100 HydrophobicContact CB-CB 4.3Å
64	W	98.2	Very high	98.1	Very high	117 Å²	117	61.3 Å²	61.3	44%	0.443	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118	138.4	178.7	-59.5	-89.5	0	0	0	112.1	S60 S62 I92 C93 N94	S60-W64 WeakPolarHBondContact CB-O 3.06Å; S60-W64 PolarHBondContact OG-O 2.9Å; S62-W64 PolarHBondContact O-N 2.04Å; S62-W64 PolarHBondContact OG-N 2.86Å; S62-W64 PolarHBondContact OG-O 2.88Å; S62-W64 VanDerWaalsContact OG-O 3.09Å; W64-I92 HydrophobicContact CB-CG2 4.45Å; W64-C93 CarbonylContact C-O 3.51Å; W64-C93 WeakPolarHBondContact CA-O 2.92Å; W64-N94 PolarHBondContact NE1-OD1 3.05Å
65	A	98.6	Very high	98.1	Very high	1 Å²	1	59.4 Å²	59.4	1%	0.008	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.1	125.7	169.4	0	0	0	0	0	109.8	C93 A103 A105	A65-C93 HydrophobicContact CB-CB 4.33Å; A65-C93 PolarHBondContact N-O 2.81Å; A65-C93 PolarHBondContact O-N 2.83Å; A65-A103 HydrophobicContact CB-CB 3.95Å; A65-A105 HydrophobicContact CB-CB 3.82Å
66	S	98.6	Very high	98.1	Very high	63 Å²	63	58.4 Å²	58.4	44%	0.441	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	133.6	-175.3	-58.4	0	0	0	0	111.1	V58	V58-S66 WeakPolarHBondContact CG1-O 3.4Å
67	C	98.6	Very high	98.1	Very high	10 Å²	10	58.4 Å²	58.4	7%	0.068	36%	0.355	C	S	.	.	P	Polyproline II helix	trans	-73.3	152.2	173.9	-65.4	0	0	0	0	111.9	M71 N91 C107	C67-M71 HydrophobicContact CB-CB 4.16Å; C67-N91 HydrophobicContact CB-CB 4.15Å; C67-N91 WeakPolarHBondContact CB-O 3.49Å; C67-N91 PolarHBondContact N-O 2.73Å; C67-C107 WeakPolarHBondContact CA-SG 3.37Å; C67-C107 HydrophobicContact CB-CB 3.6Å; C67-C107 WeakPolarHBondContact CB-SG 3.34Å; C67-C107 WeakPolarHBondContact SG-CA 3.37Å; C67-C107 WeakPolarHBondContact SG-CB 2.99Å; C67-C107 CovalentContact SG-SG 2.02Å; C67-C107 PolarHBondContact SG-SG 2.9Å
68	P	98.1	Very high	98.1	Very high	62 Å²	62	54.2 Å²	54.2	40%	0.403	33%	0.333	S	S	.	.	P	Polyproline II helix	trans	-59.7	158	170.8	-19.5	33.4	0	0	0	111.3	V58 G70 M71	V58-P68 HydrophobicContact CG2-CG 4.43Å; P68-G70 PolarHBondContact O-N 3.4Å; P68-M71 HydrophobicContact CG-SD 4.26Å; P68-M71 PolarHBondContact O-N 2.77Å; P68-M71 VanDerWaalsContact O-N 3.14Å
69	A	97.1	Very high	98.1	Very high	99 Å²	99	52.4 Å²	52.4	82%	0.818	32%	0.322	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.3	137.1	175.7	0	0	0	0	0	111.4	M71	A69-M71 VanDerWaalsContact C-N 3.31Å
70	G	97.2	Very high	98	Very high	69 Å²	69	54.5 Å²	54.5	71%	0.711	33%	0.331	S	S	*	.	T	Hydrogen-bonded Turn	trans	85.5	-5.1	-177.3	0	0	0	0	0	115.1	P68 Q109	P68-G70 PolarHBondContact O-N 3.4Å; G70-Q109 WeakPolarHBondContact O-CB 3.11Å
71	M	98.4	Very high	97.8	Very high	28 Å²	28	57.8 Å²	57.8	14%	0.138	36%	0.36	C	S	.	.			trans	-108.8	142.8	173.7	-65.2	-172.3	164.9	0	0	111.9	T56 C67 P68 A69 C107 C108 Q109	T56-M71 HydrophobicContact CG2-CE 4.35Å; T56-M71 HydrophobicContact CG2-SD 3.69Å; C67-M71 HydrophobicContact CB-CB 4.16Å; P68-M71 HydrophobicContact CG-SD 4.26Å; P68-M71 PolarHBondContact O-N 2.77Å; P68-M71 VanDerWaalsContact O-N 3.14Å; A69-M71 VanDerWaalsContact C-N 3.31Å; M71-C107 HydrophobicContact CB-CB 4.02Å; M71-C107 HydrophobicContact SD-CB 3.94Å; M71-C108 WeakPolarHBondContact CA-O 3.31Å; M71-Q109 HydrophobicContact CE-CG 4.01Å; M71-Q109 HydrophobicContact CG-CB 4.07Å; M71-Q109 HydrophobicContact CG-CG 4.23Å; M71-Q109 VanDerWaalsContact CG-OE1 3.32Å
72	T	98.5	Very high	97.8	Very high	70 Å²	70	51.5 Å²	51.5	43%	0.429	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	138.2	174.9	-55.5	0	0	0	0	109	T74 E90 C107 C108	T72-T74 PolarHBondContact O-N 2.91Å; T72-E90 HydrophobicContact CG2-CB 4.3Å; T72-E90 VanDerWaalsContact CG2-O 3.26Å; T72-E90 WeakPolarHBondContact CG2-O 3.42Å; T72-C107 CarbonylContact O-C 3.58Å; T72-C107 WeakPolarHBondContact O-CA 2.97Å; T72-C108 PolarHBondContact N-O 2.02Å; T72-C108 PolarHBondContact O-N 3.33Å
73	A	98.5	Very high	97.8	Very high	6 Å²	6	52.6 Å²	52.6	5%	0.05	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70	124.7	170.1	0	0	0	0	0	108.6	I87 E90 R106	A73-I87 HydrophobicContact CB-CD1 4.11Å; A73-I87 HydrophobicContact CB-CG1 4.17Å; A73-I87 HydrophobicContact CB-CG2 3.9Å; A73-I87 WeakPolarHBondContact O-CD1 3.48Å; A73-E90 PolarHBondContact N-O 3.21Å; A73-R106 CarbonylContact C-O 3.55Å; A73-R106 WeakPolarHBondContact CA-O 2.96Å
74	T	98	Very high	97.8	Very high	83 Å²	83	52 Å²	52	51%	0.509	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.8	-10.2	177.7	63.8	0	0	0	0	112.4	T72 R106 C108	T72-T74 PolarHBondContact O-N 2.91Å; T74-R106 PolarHBondContact N-O 3.24Å; T74-R106 VanDerWaalsContact OG1-CG 3.32Å; T74-R106 WeakPolarHBondContact OG1-CG 3.49Å; T74-R106 PolarHBondContact OG1-O 3.38Å; T74-C108 HydrophobicContact CG2-CB 3.7Å
75	G	98.1	Very high	97.8	Very high	17 Å²	17	51.4 Å²	51.4	18%	0.175	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	179.2	157.3	177.9	0	0	0	0	0	111.6	R106	G75-R106 PolarHBondContact O-N 2.86Å
76	C	98.6	Very high	97.8	Very high	17 Å²	17	55 Å²	55	12%	0.115	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.9	154.6	-178.4	-46.3	0	0	0	0	110.9	W85 C93 Y104	C76-W85 HydrophobicContact CB-CB 3.82Å; C76-W85 HydrophobicContact CB-CD2 3.52Å; C76-W85 HydrophobicContact CB-CE3 3.7Å; C76-W85 HydrophobicContact CB-CG 3.57Å; C76-W85 HydrophobicContact CB-CZ3 4.45Å; C76-W85 PolarHBondContact O-NE1 3.01Å; C76-C93 WeakPolarHBondContact CA-SG 3.43Å; C76-C93 HydrophobicContact CB-CB 3.61Å; C76-C93 WeakPolarHBondContact CB-SG 3.49Å; C76-C93 WeakPolarHBondContact SG-CA 3.01Å; C76-C93 WeakPolarHBondContact SG-CB 3.5Å; C76-C93 CovalentContact SG-SG 2.02Å; C76-C93 PolarHBondContact SG-SG 2.93Å; C76-Y104 CarbonylContact C-O 3.43Å; C76-Y104 VanDerWaalsContact CA-O 3.26Å; C76-Y104 WeakPolarHBondContact CA-O 3.24Å
77	S	98.3	Very high	97.8	Very high	60 Å²	60	55 Å²	55	42%	0.42	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.2	141.9	168	179.8	0	0	0	0	108.7	W102 A103 Y104	S77-W102 WeakPolarHBondContact O-CZ3 3.48Å; S77-A103 CarbonylContact O-C 3.58Å; S77-A103 WeakPolarHBondContact O-CA 3.43Å; S77-Y104 PolarHBondContact N-O 3.43Å; S77-Y104 PolarHBondContact O-N 2.82Å
78	C	98.4	Very high	97.8	Very high	5 Å²	5	57.8 Å²	57.8	3%	0.034	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.9	147.1	-173.1	-56.6	0	0	0	0	110	C82 C95 V100	C78-C82 HydrophobicContact CB-CB 3.61Å; C78-C82 WeakPolarHBondContact CB-O 3.4Å; C78-C95 HydrophobicContact CB-CB 3.75Å; C78-C95 WeakPolarHBondContact CB-SG 3.39Å; C78-C95 WeakPolarHBondContact SG-CB 2.94Å; C78-C95 CovalentContact SG-SG 2.02Å; C78-C95 PolarHBondContact SG-SG 2.85Å; C78-V100 HydrophobicContact CB-CG1 4.23Å
79	G	97.8	Very high	97.7	Very high	0 Å²	0	61.1 Å²	61.1	0%	0	39%	0.389	C	S	.	.	S	Bend	trans	-59.9	168.5	174.8	0	0	0	0	0	114.5	A81 C82 D101 W102	G79-A81 PolarHBondContact O-N 2.02Å; G79-A81 VanDerWaalsContact O-N 3.15Å; G79-C82 VanDerWaalsContact O-CB 3.23Å; G79-C82 WeakPolarHBondContact O-CB 3.32Å; G79-C82 PolarHBondContact O-N 2.75Å; G79-D101 VanDerWaalsContact CA-OD1 3.25Å; G79-D101 WeakPolarHBondContact CA-OD1 3.26Å; G79-W102 VanDerWaalsContact CA-CE2 3.48Å; G79-W102 PolarHBondContact N-O 2.94Å
80	F	96.7	Very high	97.7	Very high	136 Å²	136	63.3 Å²	63.3	60%	0.596	38%	0.383	S	S	*	.	T	Hydrogen-bonded Turn	trans	51	34.3	-178.8	-56.3	-54.4	0	0	0	115.2	C82 I99 D101	F80-C82 PolarHBondContact O-N 2.84Å; F80-I99 HydrophobicContact CD2-CG2 4.12Å; F80-I99 HydrophobicContact CE2-CG2 3.89Å; F80-D101 HydrophobicContact CD2-CB 4.44Å; F80-D101 HydrophobicContact CE2-CB 3.57Å; F80-D101 HydrophobicContact CZ-CB 3.7Å
81	A	94.4	Very high	97.8	Very high	104 Å²	104	62.4 Å²	62.4	86%	0.86	36%	0.361	S	S	*	.	T	Hydrogen-bonded Turn	trans	57.4	26.1	-176.7	0	0	0	0	0	114	G79 G83	G79-A81 PolarHBondContact O-N 2.02Å; G79-A81 VanDerWaalsContact O-N 3.15Å; A81-G83 PolarHBondContact O-N 2.8Å
82	C	97.3	Very high	97.8	Very high	14 Å²	14	62.8 Å²	62.8	10%	0.095	36%	0.364	C	S	.	.			trans	-66.9	115.1	173.8	174.9	0	0	0	0	110.4	C78 G79 F80 S84 C97 V100	C78-C82 HydrophobicContact CB-CB 3.61Å; C78-C82 WeakPolarHBondContact CB-O 3.4Å; G79-C82 VanDerWaalsContact O-CB 3.23Å; G79-C82 WeakPolarHBondContact O-CB 3.32Å; G79-C82 PolarHBondContact O-N 2.75Å; F80-C82 PolarHBondContact O-N 2.84Å; C82-S84 PolarHBondContact SG-O 2.79Å; C82-S84 VanDerWaalsContact SG-O 3.38Å; C82-C97 HydrophobicContact CB-CB 3.74Å; C82-C97 WeakPolarHBondContact CB-SG 3.26Å; C82-C97 WeakPolarHBondContact SG-CB 2.88Å; C82-C97 CovalentContact SG-SG 2.02Å; C82-C97 PolarHBondContact SG-SG 2.95Å; C82-V100 HydrophobicContact CB-CG2 4.26Å
83	G	96.9	Very high	97.8	Very high	64 Å²	64	59.4 Å²	59.4	66%	0.66	34%	0.343	S	S	*	.			trans	-91.8	-1.6	175.8	0	0	0	0	0	114.4	A81	A81-G83 PolarHBondContact O-N 2.8Å
84	S	98.1	Very high	97.8	Very high	66 Å²	66	59.6 Å²	59.6	46%	0.462	34%	0.343	S	S	.	.			trans	-100.8	112.6	-175.6	-57.4	0	0	0	0	110.7	C82 L96	C82-S84 PolarHBondContact SG-O 2.79Å; C82-S84 VanDerWaalsContact SG-O 3.38Å; S84-L96 PolarHBondContact O-N 3.31Å
85	W	98.3	Very high	97.8	Very high	105 Å²	105	55.6 Å²	55.6	40%	0.398	32%	0.319	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148	161.3	179.4	52.7	-96.4	0	0	0	110.4	C76 I87 N94	C76-W85 HydrophobicContact CB-CB 3.82Å; C76-W85 HydrophobicContact CB-CD2 3.52Å; C76-W85 HydrophobicContact CB-CE3 3.7Å; C76-W85 HydrophobicContact CB-CG 3.57Å; C76-W85 HydrophobicContact CB-CZ3 4.45Å; C76-W85 PolarHBondContact O-NE1 3.01Å; W85-I87 HydrophobicContact CE3-CG1 4.24Å; W85-I87 HydrophobicContact CZ3-CD1 3.85Å; W85-I87 HydrophobicContact CZ3-CG1 3.92Å; W85-N94 CarbonylContact C-O 3.46Å; W85-N94 VanDerWaalsContact CA-O 3.24Å; W85-N94 WeakPolarHBondContact CA-O 3.29Å
86	E	98.4	Very high	97.8	Very high	78 Å²	78	59.1 Å²	59.1	36%	0.364	33%	0.333	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.9	160.7	171.2	65.2	-179.8	-178.9	0	0	110.1	Q88 N94 L96	E86-Q88 HydrophobicContact CG-CG 4.19Å; E86-Q88 PolarHBondContact OE1-NE2 3.19Å; E86-N94 HydrophobicContact CG-CB 3.9Å; E86-N94 PolarHBondContact N-O 3.3Å; E86-N94 PolarHBondContact O-N 2.83Å; E86-N94 PolarHBondContact OE1-ND2 3.09Å; E86-L96 HydrophobicContact CB-CD1 4.4Å; E86-L96 HydrophobicContact CG-CD1 4.4Å; E86-L96 HydrophobicContact CG-CD2 4.03Å; E86-L96 HydrophobicContact CG-CG 4.43Å
87	I	98.6	Very high	97.8	Very high	63 Å²	63	60.3 Å²	60.3	32%	0.323	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	114.5	173	-64.7	167.6	0	0	0	107.8	A73 W85 I92	A73-I87 HydrophobicContact CB-CD1 4.11Å; A73-I87 HydrophobicContact CB-CG1 4.17Å; A73-I87 HydrophobicContact CB-CG2 3.9Å; A73-I87 WeakPolarHBondContact O-CD1 3.48Å; W85-I87 HydrophobicContact CE3-CG1 4.24Å; W85-I87 HydrophobicContact CZ3-CD1 3.85Å; W85-I87 HydrophobicContact CZ3-CG1 3.92Å; I87-I92 CarbonylContact C-O 3.59Å; I87-I92 WeakPolarHBondContact CA-O 3.18Å
88	Q	97.8	Very high	97.7	Very high	68 Å²	68	66.1 Å²	66.1	32%	0.318	37%	0.366	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.2	141.8	175.1	-61.4	-177.2	-15.2	0	0	109.7	E86 E90 N91 I92 N94	E86-Q88 HydrophobicContact CG-CG 4.19Å; E86-Q88 PolarHBondContact OE1-NE2 3.19Å; Q88-E90 PolarHBondContact O-N 2.02Å; Q88-N91 PolarHBondContact O-N 2.84Å; Q88-I92 HydrophobicContact CB-CB 4.3Å; Q88-I92 PolarHBondContact N-O 2.84Å; Q88-I92 WeakPolarHBondContact O-CB 3.47Å; Q88-I92 PolarHBondContact O-N 2.92Å; Q88-N94 HydrophobicContact CG-CB 4.31Å; Q88-N94 PolarHBondContact NE2-ND2 2.7Å
89	N	97	Very high	97.5	Very high	131 Å²	131	72 Å²	72	70%	0.701	40%	0.396	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.7	29.6	176.9	-54.1	-25.6	0	0	0	113.7	N91	N89-N91 PolarHBondContact O-N 2.88Å; N89-N91 PolarHBondContact O-OD1 2.93Å; N89-N91 VanDerWaalsContact O-OD1 3.05Å
90	E	97.6	Very high	97.4	Very high	145 Å²	145	73.2 Å²	73.2	68%	0.678	40%	0.404	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.4	-14.3	-177.8	-51.1	179	173.1	0	0	115.8	T72 A73 Q88	T72-E90 HydrophobicContact CG2-CB 4.3Å; T72-E90 VanDerWaalsContact CG2-O 3.26Å; T72-E90 WeakPolarHBondContact CG2-O 3.42Å; A73-E90 PolarHBondContact N-O 3.21Å; Q88-E90 PolarHBondContact O-N 2.02Å
91	N	98.2	Very high	97.4	Very high	50 Å²	50	70 Å²	70	27%	0.267	39%	0.393	S	S	.	.	T	Hydrogen-bonded Turn	trans	-131.6	-2.4	-170.4	72.3	-18.2	0	0	0	114.9	C67 Q88 N89	C67-N91 HydrophobicContact CB-CB 4.15Å; C67-N91 WeakPolarHBondContact CB-O 3.49Å; C67-N91 PolarHBondContact N-O 2.73Å; Q88-N91 PolarHBondContact O-N 2.84Å; N89-N91 PolarHBondContact O-N 2.88Å; N89-N91 PolarHBondContact O-OD1 2.93Å; N89-N91 VanDerWaalsContact O-OD1 3.05Å
92	I	98.6	Very high	97.6	Very high	36 Å²	36	67.9 Å²	67.9	19%	0.185	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	116.4	179.5	-55.2	177.1	0	0	0	109.7	W64 I87 Q88	W64-I92 HydrophobicContact CB-CG2 4.45Å; I87-I92 CarbonylContact C-O 3.59Å; I87-I92 WeakPolarHBondContact CA-O 3.18Å; Q88-I92 HydrophobicContact CB-CB 4.3Å; Q88-I92 PolarHBondContact N-O 2.84Å; Q88-I92 WeakPolarHBondContact O-CB 3.47Å; Q88-I92 PolarHBondContact O-N 2.92Å
93	C	98.6	Very high	97.7	Very high	0 Å²	0	67.2 Å²	67.2	0%	0	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.8	130.9	165.3	-78.8	0	0	0	0	110.5	W64 A65 C76 A105	W64-C93 CarbonylContact C-O 3.51Å; W64-C93 WeakPolarHBondContact CA-O 2.92Å; A65-C93 HydrophobicContact CB-CB 4.33Å; A65-C93 PolarHBondContact N-O 2.81Å; A65-C93 PolarHBondContact O-N 2.83Å; C76-C93 WeakPolarHBondContact CA-SG 3.43Å; C76-C93 HydrophobicContact CB-CB 3.61Å; C76-C93 WeakPolarHBondContact CB-SG 3.49Å; C76-C93 WeakPolarHBondContact SG-CA 3.01Å; C76-C93 WeakPolarHBondContact SG-CB 3.5Å; C76-C93 CovalentContact SG-SG 2.02Å; C76-C93 PolarHBondContact SG-SG 2.93Å; C93-A105 HydrophobicContact CB-CB 4.04Å; C93-A105 VanDerWaalsContact SG-CB 3.58Å
94	N	98.3	Very high	97.8	Very high	9 Å²	9	68.2 Å²	68.2	5%	0.048	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.4	117.7	173.7	175.9	36.3	0	0	0	109.6	W64 W85 E86 Q88 L96	W64-N94 PolarHBondContact NE1-OD1 3.05Å; W85-N94 CarbonylContact C-O 3.46Å; W85-N94 VanDerWaalsContact CA-O 3.24Å; W85-N94 WeakPolarHBondContact CA-O 3.29Å; E86-N94 HydrophobicContact CG-CB 3.9Å; E86-N94 PolarHBondContact N-O 3.3Å; E86-N94 PolarHBondContact O-N 2.83Å; E86-N94 PolarHBondContact OE1-ND2 3.09Å; Q88-N94 HydrophobicContact CG-CB 4.31Å; Q88-N94 PolarHBondContact NE2-ND2 2.7Å; N94-L96 WeakPolarHBondContact ND2-CD2 3.41Å
95	C	98.5	Very high	97.8	Very high	0 Å²	0	65.1 Å²	65.1	0%	0	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.7	131.3	175.6	-60.8	0	0	0	0	110.5	K63 C78 V100	K63-C95 HydrophobicContact CB-CB 4.16Å; K63-C95 PolarHBondContact O-N 2.92Å; C78-C95 HydrophobicContact CB-CB 3.75Å; C78-C95 WeakPolarHBondContact CB-SG 3.39Å; C78-C95 WeakPolarHBondContact SG-CB 2.94Å; C78-C95 CovalentContact SG-SG 2.02Å; C78-C95 PolarHBondContact SG-SG 2.85Å; C95-V100 HydrophobicContact CB-CB 4.4Å; C95-V100 HydrophobicContact CB-CG1 4.06Å; C95-V100 HydrophobicContact CB-CG2 3.93Å
96	L	98.3	Very high	97.8	Very high	90 Å²	90	65 Å²	65	47%	0.471	32%	0.32	S	S	.	.			trans	-99	-8.5	-169.1	-59	-179.5	0	0	0	114	S84 E86 N94	S84-L96 PolarHBondContact O-N 3.31Å; E86-L96 HydrophobicContact CB-CD1 4.4Å; E86-L96 HydrophobicContact CG-CD1 4.4Å; E86-L96 HydrophobicContact CG-CD2 4.03Å; E86-L96 HydrophobicContact CG-CG 4.43Å; N94-L96 WeakPolarHBondContact ND2-CD2 3.41Å
97	C	98.1	Very high	97.8	Very high	43 Å²	43	61.3 Å²	61.3	29%	0.291	30%	0.303	S	S	.	.	S	Bend	trans	-69.2	152.5	175.7	-55.3	0	0	0	0	111.7	C82 I99 V100	C82-C97 HydrophobicContact CB-CB 3.74Å; C82-C97 WeakPolarHBondContact CB-SG 3.26Å; C82-C97 WeakPolarHBondContact SG-CB 2.88Å; C82-C97 CovalentContact SG-SG 2.02Å; C82-C97 PolarHBondContact SG-SG 2.95Å; C97-I99 VanDerWaalsContact C-N 3.3Å; C97-I99 PolarHBondContact O-N 2.87Å; C97-V100 HydrophobicContact CB-CG2 3.9Å
98	L	95	Very high	97.8	Very high	181 Å²	181	58.9 Å²	58.9	95%	0.948	29%	0.292	S	S	*	.	S	Bend	trans	-60.9	-36.7	-175.8	-66.6	173.4	0	0	0	113.4
99	I	94.6	Very high	97.8	Very high	129 Å²	129	58.9 Å²	58.9	66%	0.662	29%	0.292	S	S	*	.			trans	-129.6	120.4	-178.5	-56.2	176	0	0	0	107.9	F80 C97	F80-I99 HydrophobicContact CD2-CG2 4.12Å; F80-I99 HydrophobicContact CE2-CG2 3.89Å; C97-I99 VanDerWaalsContact C-N 3.3Å; C97-I99 PolarHBondContact O-N 2.87Å
100	V	97.2	Very high	97.7	Very high	25 Å²	25	58 Å²	58	15%	0.152	29%	0.286	C	S	.	.			trans	-144.4	125.8	178.5	-179.9	0	0	0	0	107.6	K63 C78 C82 C95 C97 W102	K63-V100 HydrophobicContact CB-CB 4.3Å; C78-V100 HydrophobicContact CB-CG1 4.23Å; C82-V100 HydrophobicContact CB-CG2 4.26Å; C95-V100 HydrophobicContact CB-CB 4.4Å; C95-V100 HydrophobicContact CB-CG1 4.06Å; C95-V100 HydrophobicContact CB-CG2 3.93Å; C97-V100 HydrophobicContact CB-CG2 3.9Å; V100-W102 WeakPolarHBondContact CG1-O 3.24Å
101	D	96.7	Very high	97.3	Very high	70 Å²	70	55.9 Å²	55.9	37%	0.374	29%	0.288	S	S	.	.	S	Bend	trans	-87.1	-26.5	179.6	59.1	-25.3	0	0	0	113	M61 G79 F80	M61-D101 CarbonylContact C-O 3.3Å; G79-D101 VanDerWaalsContact CA-OD1 3.25Å; G79-D101 WeakPolarHBondContact CA-OD1 3.26Å; F80-D101 HydrophobicContact CD2-CB 4.44Å; F80-D101 HydrophobicContact CE2-CB 3.57Å; F80-D101 HydrophobicContact CZ-CB 3.7Å
102	W	98.3	Very high	97.3	Very high	58 Å²	58	56.2 Å²	56.2	22%	0.22	29%	0.289	C	S	.	.			trans	-153.5	160.1	175.4	58.6	-95.2	0	0	0	113.1	S60 M61 S62 S77 G79 V100 Y104	S60-W102 CarbonylContact O-C 3.53Å; S60-W102 VanDerWaalsContact O-CA 3.24Å; S60-W102 WeakPolarHBondContact O-CA 2.98Å; S60-W102 VanDerWaalsContact O-CB 3.28Å; S60-W102 WeakPolarHBondContact O-CB 2.98Å; M61-W102 HydrophobicContact SD-CB 4.11Å; S62-W102 CarbonylContact O-C 3.51Å; S62-W102 VanDerWaalsContact O-C 3.3Å; S77-W102 WeakPolarHBondContact O-CZ3 3.48Å; G79-W102 VanDerWaalsContact CA-CE2 3.48Å; G79-W102 PolarHBondContact N-O 2.94Å; V100-W102 WeakPolarHBondContact CG1-O 3.24Å; W102-Y104 AromaticContact CE3-CD2 3.59Å; W102-Y104 HydrophobicContact CE3-CD2 3.59Å; W102-Y104 HydrophobicContact CE3-CE2 4.23Å; W102-Y104 HydrophobicContact CE3-CG 4.42Å; W102-Y104 HydrophobicContact CH2-CD2 4.2Å; W102-Y104 AromaticContact CZ3-CD2 3.42Å; W102-Y104 HydrophobicContact CZ3-CD2 3.42Å; W102-Y104 VanDerWaalsContact CZ3-CD2 3.42Å; W102-Y104 HydrophobicContact CZ3-CE2 4.25Å; W102-Y104 HydrophobicContact CZ3-CG 4.29Å
103	A	98.6	Very high	97.2	Very high	0 Å²	0	57.2 Å²	57.2	0%	0	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.4	147.9	171	0	0	0	0	0	110.3	K59 S60 S62 A65 S77	K59-A103 WeakPolarHBondContact CA-O 3.48Å; S60-A103 PolarHBondContact N-O 2.02Å; S60-A103 PolarHBondContact O-N 2.77Å; S62-A103 VanDerWaalsContact O-CB 3.26Å; S62-A103 WeakPolarHBondContact O-CB 3.28Å; S62-A103 PolarHBondContact O-N 3.19Å; A65-A103 HydrophobicContact CB-CB 3.95Å; S77-A103 CarbonylContact O-C 3.58Å; S77-A103 WeakPolarHBondContact O-CA 3.43Å
104	Y	98.3	Very high	97.2	Very high	86 Å²	86	60.4 Å²	60.4	34%	0.337	31%	0.31	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.6	136.4	170.2	-95.4	-69.6	0	0	0	109.5	N57 V58 K59 C76 S77 W102	N57-Y104 HydrophobicContact CB-CD1 4.16Å; N57-Y104 HydrophobicContact CB-CE1 4.21Å; V58-Y104 CarbonylContact O-C 3.52Å; V58-Y104 VanDerWaalsContact O-CA 3.29Å; V58-Y104 WeakPolarHBondContact O-CA 3.5Å; V58-Y104 WeakPolarHBondContact O-CD1 2.96Å; K59-Y104 HydrophobicContact CB-CD1 3.81Å; K59-Y104 HydrophobicContact CB-CE1 3.31Å; K59-Y104 HydrophobicContact CB-CE2 4.26Å; K59-Y104 HydrophobicContact CB-CG 4.47Å; K59-Y104 HydrophobicContact CD-CE1 4.31Å; K59-Y104 HydrophobicContact CD-CE2 3.82Å; K59-Y104 WeakPolarHBondContact CD-OH 3.06Å; K59-Y104 HydrophobicContact CG-CD1 4.13Å; K59-Y104 HydrophobicContact CG-CD2 4.12Å; K59-Y104 HydrophobicContact CG-CE1 3.73Å; K59-Y104 HydrophobicContact CG-CE2 3.7Å; K59-Y104 HydrophobicContact CG-CG 4.32Å; K59-Y104 VanDerWaalsContact CG-CZ 3.48Å; C76-Y104 CarbonylContact C-O 3.43Å; C76-Y104 VanDerWaalsContact CA-O 3.26Å; C76-Y104 WeakPolarHBondContact CA-O 3.24Å; S77-Y104 PolarHBondContact N-O 3.43Å; S77-Y104 PolarHBondContact O-N 2.82Å; W102-Y104 AromaticContact CE3-CD2 3.59Å; W102-Y104 HydrophobicContact CE3-CD2 3.59Å; W102-Y104 HydrophobicContact CE3-CE2 4.23Å; W102-Y104 HydrophobicContact CE3-CG 4.42Å; W102-Y104 HydrophobicContact CH2-CD2 4.2Å; W102-Y104 AromaticContact CZ3-CD2 3.42Å; W102-Y104 HydrophobicContact CZ3-CD2 3.42Å; W102-Y104 VanDerWaalsContact CZ3-CD2 3.42Å; W102-Y104 HydrophobicContact CZ3-CE2 4.25Å; W102-Y104 HydrophobicContact CZ3-CG 4.29Å
105	A	98.8	Very high	97.1	Very high	1 Å²	1	63.4 Å²	63.4	1%	0.008	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	127.4	166.3	0	0	0	0	0	109.7	N57 V58 A65 C93	N57-A105 WeakPolarHBondContact CA-O 3.23Å; V58-A105 PolarHBondContact N-O 2.74Å; V58-A105 PolarHBondContact O-N 3.43Å; A65-A105 HydrophobicContact CB-CB 3.82Å; C93-A105 HydrophobicContact CB-CB 4.04Å; C93-A105 VanDerWaalsContact SG-CB 3.58Å
106	R	98.7	Very high	97	Very high	102 Å²	102	67.4 Å²	67.4	39%	0.385	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.3	113.1	163.8	-177.5	63.7	174	171.7	-1.7	107.4	N57 A73 T74 G75	N57-R106 WeakPolarHBondContact OD1-CD 3.02Å; N57-R106 PolarHBondContact OD1-NH1 3.05Å; A73-R106 CarbonylContact C-O 3.55Å; A73-R106 WeakPolarHBondContact CA-O 2.96Å; T74-R106 PolarHBondContact N-O 3.24Å; T74-R106 VanDerWaalsContact OG1-CG 3.32Å; T74-R106 WeakPolarHBondContact OG1-CG 3.49Å; T74-R106 PolarHBondContact OG1-O 3.38Å; G75-R106 PolarHBondContact O-N 2.86Å
107	C	98.7	Very high	96.9	Very high	0 Å²	0	65.9 Å²	65.9	0%	0	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.6	127.5	-173.3	-56.5	0	0	0	0	109.2	C55 T56 C67 M71 T72	C55-C107 CarbonylContact C-O 3.57Å; C55-C107 WeakPolarHBondContact CA-O 3.26Å; T56-C107 HydrophobicContact CG2-CB 3.98Å; T56-C107 PolarHBondContact N-O 2.97Å; T56-C107 PolarHBondContact O-N 2.93Å; C67-C107 WeakPolarHBondContact CA-SG 3.37Å; C67-C107 HydrophobicContact CB-CB 3.6Å; C67-C107 WeakPolarHBondContact CB-SG 3.34Å; C67-C107 WeakPolarHBondContact SG-CA 3.37Å; C67-C107 WeakPolarHBondContact SG-CB 2.99Å; C67-C107 CovalentContact SG-SG 2.02Å; C67-C107 PolarHBondContact SG-SG 2.9Å; M71-C107 HydrophobicContact CB-CB 4.02Å; M71-C107 HydrophobicContact SD-CB 3.94Å; T72-C107 CarbonylContact O-C 3.58Å; T72-C107 WeakPolarHBondContact O-CA 2.97Å
108	C	98.5	Very high	96.8	Very high	12 Å²	12	67.5 Å²	67.5	8%	0.081	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.5	153.5	-179.6	-63.3	0	0	0	0	112	L53 S54 C55 M71 T72 T74	L53-C108 HydrophobicContact CD1-CB 4.01Å; S54-C108 CarbonylContact O-C 3.54Å; S54-C108 VanDerWaalsContact O-CA 3.23Å; S54-C108 WeakPolarHBondContact O-CA 3.45Å; C55-C108 HydrophobicContact CB-CB 4.1Å; C55-C108 WeakPolarHBondContact CB-SG 3.23Å; C55-C108 WeakPolarHBondContact SG-CB 3.25Å; C55-C108 CovalentContact SG-SG 2.04Å; C55-C108 PolarHBondContact SG-SG 3.19Å; M71-C108 WeakPolarHBondContact CA-O 3.31Å; T72-C108 PolarHBondContact N-O 2.02Å; T72-C108 PolarHBondContact O-N 3.33Å; T74-C108 HydrophobicContact CG2-CB 3.7Å
109	Q	97.5	Very high	97	Very high	68 Å²	68	58.8 Å²	58.8	32%	0.318	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.5	152.4	170.3	67.8	-178.9	50.9	0	0	110.6	S54 G70 M71	S54-Q109 PolarHBondContact N-O 3.34Å; S54-Q109 PolarHBondContact O-N 2.88Å; G70-Q109 WeakPolarHBondContact O-CB 3.11Å; M71-Q109 HydrophobicContact CE-CG 4.01Å; M71-Q109 HydrophobicContact CG-CB 4.07Å; M71-Q109 HydrophobicContact CG-CG 4.23Å; M71-Q109 VanDerWaalsContact CG-OE1 3.32Å
110	L	95.7	Very high	97.2	Very high	112 Å²	112	52.9 Å²	52.9	59%	0.586	26%	0.264	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.7	128.7	168.2	-67.3	172	0	0	0	109	K51 T52 L53	K51-L110 HydrophobicContact CB-CB 4.39Å; K51-L110 HydrophobicContact CB-CD2 4.3Å; K51-L110 HydrophobicContact CD-CB 4.16Å; K51-L110 HydrophobicContact CD-CD1 4.37Å; T52-L110 WeakPolarHBondContact O-CA 3.41Å; L53-L110 HydrophobicContact CB-CD2 4.08Å; L53-L110 HydrophobicContact CD1-CD2 3.73Å; L53-L110 HydrophobicContact CD1-CG 4.3Å
111	S	89	Confident	97.2	Very high	101 Å²	101	55.5 Å²	55.5	71%	0.706	27%	0.274	S	S	*	.			trans	-119.2	0	174.7	62.8	0	0	0	0	111.6	K51 T52	K51-S111 CarbonylContact C-O 3.45Å; K51-S111 WeakPolarHBondContact CA-O 3.4Å; T52-S111 PolarHBondContact N-O 3Å; T52-S111 PolarHBondContact O-N 3.15Å; T52-S111 PolarHBondContact O-OG 3.19Å

Retrieved 111 of 111 residues in 223 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).