SMIM3_MOUSE Loading...

Small integral membrane protein 3

AlphaFold DB , UniProt , Accession Q99PE5, Species MOUSE (Mus musculus, Mouse), Gene Smim3, Length 60 aa.

						>SMIM3_MOUSE|Q99PE5|Smim3
MDAITQSPVDAVLPKHILDIWAIVLIILATIVIMTSLFLCPATAVIIYRMRTHPVLNGAA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.3	Very low	55.3	Low	226 Å²	226	118.2 Å²	118.2	100%	1.113	68%	0.68	S	S	*	*				0	82.9	0	-126.8	86.9	169.6	0	0	105.8	A3	M1-A3 PolarHBondContact O-N 2.85Å
2	D	53.5	Low	55.4	Low	180 Å²	180	117.2 Å²	117.2	96%	0.963	68%	0.676	S	S	*	*			trans	-76	71.3	179	-60.9	-74.4	0	0	0	108.9
3	A	57.4	Low	55.6	Low	67 Å²	67	115.4 Å²	115.4	55%	0.554	66%	0.662	S	S	*	*			trans	-114.8	132.5	177.4	0	0	0	0	0	107.4	M1	M1-A3 PolarHBondContact O-N 2.85Å
4	I	58.3	Low	56.1	Low	158 Å²	158	111.9 Å²	111.9	81%	0.81	65%	0.646	S	S	*	*			trans	84.4	46.4	168.8	-34.1	155	0	0	0	114.9
5	T	57.9	Low	57.5	Low	130 Å²	130	115.7 Å²	115.7	80%	0.798	65%	0.652	S	S	*	*			trans	-119.4	43.8	141.7	-40.5	0	0	0	0	109.6	S7	T5-S7 PolarHBondContact O-N 2.87Å
6	Q	54.6	Low	58.8	Low	164 Å²	164	115.8 Å²	115.8	77%	0.766	65%	0.645	S	S	*	*			trans	-73	71.2	155.2	-69.7	-174.4	-91.7	0	0	106.7	D10	Q6-D10 VanDerWaalsContact CA-OD2 3.29Å; Q6-D10 WeakPolarHBondContact CA-OD2 3.22Å; Q6-D10 WeakPolarHBondContact CB-OD2 3.43Å
7	S	55.8	Low	60.3	Low	44 Å²	44	114.2 Å²	114.2	31%	0.308	63%	0.634	S	S	.	*			trans	-57.7	151.1	176.3	58.8	0	0	0	0	108.6	T5 V9 D10	T5-S7 PolarHBondContact O-N 2.87Å; S7-V9 PolarHBondContact O-N 3.08Å; S7-V9 WeakPolarHBondContact OG-CG2 3.29Å; S7-D10 PolarHBondContact O-N 3.29Å
8	P	53.7	Low	61.8	Low	111 Å²	111	115.2 Å²	115.2	72%	0.721	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.7	-5.3	180	22.2	-34.1	0	0	0	114.3	D10 A11 V12	P8-D10 PolarHBondContact O-N 2.72Å; P8-A11 PolarHBondContact O-N 3.15Å; P8-A11 VanDerWaalsContact O-N 3.08Å; P8-V12 PolarHBondContact O-N 3.43Å
9	V	55.7	Low	63.2	Low	79 Å²	79	114.1 Å²	114.1	48%	0.479	63%	0.63	S	S	.	*	H	α-helix	trans	-52.5	-35	163.5	-49.7	0	0	0	0	111.3	S7 A11 V12 L13	S7-V9 PolarHBondContact O-N 3.08Å; S7-V9 WeakPolarHBondContact OG-CG2 3.29Å; V9-A11 PolarHBondContact O-N 2.76Å; V9-V12 CarbonylContact O-C 3.57Å; V9-V12 PolarHBondContact O-N 3.22Å; V9-V12 VanDerWaalsContact O-N 3.15Å; V9-L13 VanDerWaalsContact O-CB 3.25Å; V9-L13 WeakPolarHBondContact O-CB 3.35Å; V9-L13 PolarHBondContact O-N 2.88Å
10	D	55.8	Low	64.5	Low	69 Å²	69	112.2 Å²	112.2	37%	0.369	62%	0.618	S	S	.	*	H	α-helix	trans	-68	-12.7	178.3	-75.1	-28.3	0	0	0	113.9	Q6 S7 P8 P14	Q6-D10 VanDerWaalsContact CA-OD2 3.29Å; Q6-D10 WeakPolarHBondContact CA-OD2 3.22Å; Q6-D10 WeakPolarHBondContact CB-OD2 3.43Å; S7-D10 PolarHBondContact O-N 3.29Å; P8-D10 PolarHBondContact O-N 2.72Å; D10-P14 VanDerWaalsContact C-CD 3.45Å; D10-P14 WeakPolarHBondContact O-CD 3.34Å; D10-P14 VanDerWaalsContact O-CG 3.22Å; D10-P14 WeakPolarHBondContact O-CG 3.25Å
11	A	56.8	Low	65.9	Low	72 Å²	72	114.5 Å²	114.5	60%	0.595	62%	0.617	S	S	*	*	H	α-helix	trans	-95.5	-28.5	172.3	0	0	0	0	0	111.8	P8 V9 P14	P8-A11 PolarHBondContact O-N 3.15Å; P8-A11 VanDerWaalsContact O-N 3.08Å; V9-A11 PolarHBondContact O-N 2.76Å; A11-P14 WeakPolarHBondContact O-CD 2.73Å; A11-P14 WeakPolarHBondContact O-CG 3.43Å
12	V	55.9	Low	68	Low	106 Å²	106	105.8 Å²	105.8	64%	0.642	58%	0.581	S	S	*	*	H	α-helix	trans	-77.3	-33.5	170.5	177.4	0	0	0	0	111.1	P8 V9 K15 H16	P8-V12 PolarHBondContact O-N 3.43Å; V9-V12 CarbonylContact O-C 3.57Å; V9-V12 PolarHBondContact O-N 3.22Å; V9-V12 VanDerWaalsContact O-N 3.15Å; V12-K15 PolarHBondContact O-N 2.93Å; V12-H16 PolarHBondContact O-N 3.19Å; V12-H16 VanDerWaalsContact O-N 3.14Å
13	L	57.7	Low	70	Confident	94 Å²	94	101.1 Å²	101.1	49%	0.492	56%	0.555	S	S	.	*	H	α-helix	trans	-57	-48.6	176.9	-125.8	63.8	0	0	0	114.2	V9 K15 H16 I17	V9-L13 VanDerWaalsContact O-CB 3.25Å; V9-L13 WeakPolarHBondContact O-CB 3.35Å; V9-L13 PolarHBondContact O-N 2.88Å; L13-K15 PolarHBondContact O-N 3.14Å; L13-H16 PolarHBondContact O-N 3.35Å; L13-H16 VanDerWaalsContact O-N 3.14Å; L13-I17 PolarHBondContact O-N 3.32Å
14	P	62.9	Low	71.9	Confident	66 Å²	66	101.4 Å²	101.4	43%	0.429	55%	0.55	S	S	.	*	H	α-helix	trans	-66.4	-29.4	-177.5	20.4	-31.8	0	0	0	111.3	D10 A11 I17 L18	D10-P14 VanDerWaalsContact C-CD 3.45Å; D10-P14 WeakPolarHBondContact O-CD 3.34Å; D10-P14 VanDerWaalsContact O-CG 3.22Å; D10-P14 WeakPolarHBondContact O-CG 3.25Å; A11-P14 WeakPolarHBondContact O-CD 2.73Å; A11-P14 WeakPolarHBondContact O-CG 3.43Å; P14-I17 WeakPolarHBondContact O-CG2 3.01Å; P14-L18 WeakPolarHBondContact O-CB 3.39Å; P14-L18 PolarHBondContact O-N 3.27Å
15	K	77.3	Confident	73.6	Confident	169 Å²	169	98.8 Å²	98.8	74%	0.735	54%	0.537	S	S	*	.	H	α-helix	trans	-72.1	-40.9	173.6	-171.5	158.1	-177.6	168.5	0	111.6	V12 L13 D19	V12-K15 PolarHBondContact O-N 2.93Å; L13-K15 PolarHBondContact O-N 3.14Å; K15-D19 WeakPolarHBondContact O-CB 3.34Å; K15-D19 PolarHBondContact O-N 3.14Å
16	H	78	Confident	75.5	Confident	117 Å²	117	97.7 Å²	97.7	54%	0.542	53%	0.525	S	S	.	.	H	α-helix	trans	-66.3	-44.1	179.2	-169.9	45.9	0	0	0	112.3	V12 L13 L18 D19 I20	V12-H16 PolarHBondContact O-N 3.19Å; V12-H16 VanDerWaalsContact O-N 3.14Å; L13-H16 PolarHBondContact O-N 3.35Å; L13-H16 VanDerWaalsContact O-N 3.14Å; H16-L18 PolarHBondContact O-N 3.44Å; H16-D19 PolarHBondContact O-N 2.92Å; H16-I20 WeakPolarHBondContact O-CD1 3.46Å; H16-I20 VanDerWaalsContact O-CG1 3.25Å; H16-I20 WeakPolarHBondContact O-CG1 3.25Å; H16-I20 PolarHBondContact O-N 3.46Å
17	I	85.2	Confident	77.5	Confident	90 Å²	90	94.1 Å²	94.1	46%	0.462	51%	0.511	S	S	.	.	H	α-helix	trans	-65	-41.6	179.4	-164.2	163.9	0	0	0	111.7	L13 P14 D19 I20 W21	L13-I17 PolarHBondContact O-N 3.32Å; P14-I17 WeakPolarHBondContact O-CG2 3.01Å; I17-D19 VanDerWaalsContact C-N 3.32Å; I17-D19 PolarHBondContact O-N 3.5Å; I17-I20 PolarHBondContact O-N 2.99Å; I17-W21 PolarHBondContact O-N 3.35Å
18	L	86	Confident	79.5	Confident	132 Å²	132	96.8 Å²	96.8	69%	0.691	52%	0.521	S	S	*	.	H	α-helix	trans	-63.3	-40.5	179.1	-140.2	86	0	0	0	111.7	P14 H16 W21 A22	P14-L18 WeakPolarHBondContact O-CB 3.39Å; P14-L18 PolarHBondContact O-N 3.27Å; H16-L18 PolarHBondContact O-N 3.44Å; L18-W21 PolarHBondContact O-N 3.26Å; L18-A22 WeakPolarHBondContact O-CB 3.42Å; L18-A22 PolarHBondContact O-N 3.38Å
19	D	89	Confident	81.6	Confident	93 Å²	93	93.9 Å²	93.9	50%	0.497	51%	0.506	S	S	.	.	H	α-helix	trans	-65.7	-43.7	178.3	-165.7	37.4	0	0	0	111.3	K15 H16 I17 W21 A22 I23	K15-D19 WeakPolarHBondContact O-CB 3.34Å; K15-D19 PolarHBondContact O-N 3.14Å; H16-D19 PolarHBondContact O-N 2.92Å; I17-D19 VanDerWaalsContact C-N 3.32Å; I17-D19 PolarHBondContact O-N 3.5Å; D19-W21 PolarHBondContact O-N 3.42Å; D19-A22 PolarHBondContact O-N 2.88Å; D19-I23 WeakPolarHBondContact O-CD1 3.45Å; D19-I23 VanDerWaalsContact O-CG1 3.25Å; D19-I23 WeakPolarHBondContact O-CG1 3.25Å; D19-I23 PolarHBondContact O-N 2.95Å
20	I	90.2	Very high	83.5	Confident	76 Å²	76	93.3 Å²	93.3	39%	0.39	50%	0.503	S	S	.	.	H	α-helix	trans	-58.2	-49.9	173.9	-66.5	160.5	0	0	0	110.8	H16 I17 A22 I23 V24	H16-I20 WeakPolarHBondContact O-CD1 3.46Å; H16-I20 VanDerWaalsContact O-CG1 3.25Å; H16-I20 WeakPolarHBondContact O-CG1 3.25Å; H16-I20 PolarHBondContact O-N 3.46Å; I17-I20 PolarHBondContact O-N 2.99Å; I20-A22 VanDerWaalsContact C-N 3.32Å; I20-A22 PolarHBondContact O-N 3.37Å; I20-I23 PolarHBondContact O-N 3.49Å; I20-V24 HydrophobicContact CG2-CG2 4.33Å; I20-V24 VanDerWaalsContact O-CG2 3.29Å; I20-V24 WeakPolarHBondContact O-CG2 3.27Å; I20-V24 PolarHBondContact O-N 2.96Å
21	W	93.7	Very high	85.4	Confident	161 Å²	161	94.5 Å²	94.5	61%	0.61	51%	0.509	S	S	*	.	H	α-helix	trans	-61.6	-40.5	178.9	-81	108.1	0	0	0	112.1	I17 L18 D19 V24 L25	I17-W21 PolarHBondContact O-N 3.35Å; L18-W21 PolarHBondContact O-N 3.26Å; D19-W21 PolarHBondContact O-N 3.42Å; W21-V24 PolarHBondContact O-N 3.42Å; W21-L25 WeakPolarHBondContact O-CB 3.46Å; W21-L25 VanDerWaalsContact O-CG 3.27Å; W21-L25 WeakPolarHBondContact O-CG 3.23Å; W21-L25 PolarHBondContact O-N 3.05Å
22	A	93.3	Very high	87.2	Confident	43 Å²	43	95.3 Å²	95.3	36%	0.355	51%	0.506	S	S	.	.	H	α-helix	trans	-60.5	-46.9	176.1	0	0	0	0	0	111.4	L18 D19 I20 V24 L25 I26	L18-A22 WeakPolarHBondContact O-CB 3.42Å; L18-A22 PolarHBondContact O-N 3.38Å; D19-A22 PolarHBondContact O-N 2.88Å; I20-A22 VanDerWaalsContact C-N 3.32Å; I20-A22 PolarHBondContact O-N 3.37Å; A22-V24 PolarHBondContact O-N 3.46Å; A22-L25 PolarHBondContact O-N 3.34Å; A22-I26 WeakPolarHBondContact O-CD1 3.48Å; A22-I26 VanDerWaalsContact O-CG1 3.23Å; A22-I26 WeakPolarHBondContact O-CG1 3.29Å; A22-I26 PolarHBondContact O-N 2.92Å
23	I	95.2	Very high	89	Confident	82 Å²	82	94.7 Å²	94.7	42%	0.421	50%	0.498	S	S	.	.	H	α-helix	trans	-61.4	-46.2	177.4	-65.2	161.3	0	0	0	110.7	D19 I20 L25 I26 I27	D19-I23 WeakPolarHBondContact O-CD1 3.45Å; D19-I23 VanDerWaalsContact O-CG1 3.25Å; D19-I23 WeakPolarHBondContact O-CG1 3.25Å; D19-I23 PolarHBondContact O-N 2.95Å; I20-I23 PolarHBondContact O-N 3.49Å; I23-L25 PolarHBondContact O-N 3.49Å; I23-I26 PolarHBondContact O-N 2.94Å; I23-I27 HydrophobicContact CG2-CD1 3.78Å; I23-I27 HydrophobicContact CG2-CG1 4.46Å; I23-I27 VanDerWaalsContact O-CG1 3.32Å; I23-I27 WeakPolarHBondContact O-CG1 3.4Å; I23-I27 PolarHBondContact O-N 3.26Å
24	V	96.3	Very high	90.7	Very high	73 Å²	73	96.1 Å²	96.1	44%	0.442	50%	0.504	S	S	.	.	H	α-helix	trans	-61.1	-44	178.3	172	0	0	0	0	111.2	I20 W21 A22 I26 I27 L28	I20-V24 HydrophobicContact CG2-CG2 4.33Å; I20-V24 VanDerWaalsContact O-CG2 3.29Å; I20-V24 WeakPolarHBondContact O-CG2 3.27Å; I20-V24 PolarHBondContact O-N 2.96Å; W21-V24 PolarHBondContact O-N 3.42Å; A22-V24 PolarHBondContact O-N 3.46Å; V24-I26 PolarHBondContact O-N 3.28Å; V24-I27 PolarHBondContact O-N 2.89Å; V24-L28 VanDerWaalsContact O-CB 3.29Å; V24-L28 WeakPolarHBondContact O-CB 3.33Å; V24-L28 PolarHBondContact O-N 2.85Å
25	L	95.7	Very high	92	Very high	103 Å²	103	96.3 Å²	96.3	54%	0.539	50%	0.504	S	S	.	.	H	α-helix	trans	-63.6	-39.8	177	-73.7	174.8	0	0	0	112.1	W21 A22 I23 L28 A29	W21-L25 WeakPolarHBondContact O-CB 3.46Å; W21-L25 VanDerWaalsContact O-CG 3.27Å; W21-L25 WeakPolarHBondContact O-CG 3.23Å; W21-L25 PolarHBondContact O-N 3.05Å; A22-L25 PolarHBondContact O-N 3.34Å; I23-L25 PolarHBondContact O-N 3.49Å; L25-L28 PolarHBondContact O-N 3.44Å; L25-A29 VanDerWaalsContact O-CB 3.22Å; L25-A29 WeakPolarHBondContact O-CB 3.29Å; L25-A29 PolarHBondContact O-N 2.84Å
26	I	96.9	Very high	92.4	Very high	107 Å²	107	91.6 Å²	91.6	55%	0.549	49%	0.492	S	S	.	.	H	α-helix	trans	-63.8	-46.2	176	-69	163.5	0	0	0	110.5	A22 I23 V24 A29 T30	A22-I26 WeakPolarHBondContact O-CD1 3.48Å; A22-I26 VanDerWaalsContact O-CG1 3.23Å; A22-I26 WeakPolarHBondContact O-CG1 3.29Å; A22-I26 PolarHBondContact O-N 2.92Å; I23-I26 PolarHBondContact O-N 2.94Å; V24-I26 PolarHBondContact O-N 3.28Å; I26-A29 PolarHBondContact O-N 2.97Å; I26-T30 HydrophobicContact CG2-CG2 4.49Å; I26-T30 WeakPolarHBondContact O-CG2 3.32Å; I26-T30 PolarHBondContact O-N 3.05Å; I26-T30 PolarHBondContact O-OG1 3.32Å; I26-T30 VanDerWaalsContact O-OG1 3.05Å
27	I	97.2	Very high	92.5	Very high	89 Å²	89	91.1 Å²	91.1	46%	0.456	49%	0.493	S	S	.	.	H	α-helix	trans	-63.2	-45.2	177.8	-65.8	167.6	0	0	0	110.2	I23 V24 A29 T30 I31	I23-I27 HydrophobicContact CG2-CD1 3.78Å; I23-I27 HydrophobicContact CG2-CG1 4.46Å; I23-I27 VanDerWaalsContact O-CG1 3.32Å; I23-I27 WeakPolarHBondContact O-CG1 3.4Å; I23-I27 PolarHBondContact O-N 3.26Å; V24-I27 PolarHBondContact O-N 2.89Å; I27-A29 VanDerWaalsContact C-N 3.35Å; I27-A29 PolarHBondContact O-N 2.82Å; I27-T30 WeakPolarHBondContact CA-OG1 3.22Å; I27-T30 PolarHBondContact O-N 2.9Å; I27-T30 PolarHBondContact O-OG1 3.44Å; I27-I31 HydrophobicContact CG2-CD1 3.82Å; I27-I31 HydrophobicContact CG2-CG1 4.45Å; I27-I31 VanDerWaalsContact O-CG1 3.27Å; I27-I31 WeakPolarHBondContact O-CG1 3.27Å; I27-I31 PolarHBondContact O-N 3.37Å
28	L	97.5	Very high	92.4	Very high	101 Å²	101	95.1 Å²	95.1	53%	0.529	51%	0.507	S	S	.	.	H	α-helix	trans	-60.7	-45.3	177.7	-172.1	70.8	0	0	0	111.3	V24 L25 I31 V32	V24-L28 VanDerWaalsContact O-CB 3.29Å; V24-L28 WeakPolarHBondContact O-CB 3.33Å; V24-L28 PolarHBondContact O-N 2.85Å; L25-L28 PolarHBondContact O-N 3.44Å; L28-I31 PolarHBondContact O-N 3.21Å; L28-V32 VanDerWaalsContact O-CG2 3.29Å; L28-V32 WeakPolarHBondContact O-CG2 3.23Å; L28-V32 PolarHBondContact O-N 2.81Å
29	A	96.9	Very high	92.2	Very high	49 Å²	49	93.4 Å²	93.4	41%	0.405	50%	0.498	S	S	.	.	H	α-helix	trans	-63	-43.9	178	0	0	0	0	0	111.9	L25 I26 I27 V32 I33	L25-A29 VanDerWaalsContact O-CB 3.22Å; L25-A29 WeakPolarHBondContact O-CB 3.29Å; L25-A29 PolarHBondContact O-N 2.84Å; I26-A29 PolarHBondContact O-N 2.97Å; I27-A29 VanDerWaalsContact C-N 3.35Å; I27-A29 PolarHBondContact O-N 2.82Å; A29-V32 PolarHBondContact O-N 3.35Å; A29-I33 WeakPolarHBondContact O-CD1 3.36Å; A29-I33 VanDerWaalsContact O-CG1 3.23Å; A29-I33 WeakPolarHBondContact O-CG1 3.15Å; A29-I33 PolarHBondContact O-N 3.33Å
30	T	96.9	Very high	91.7	Very high	68 Å²	68	92.4 Å²	92.4	42%	0.417	50%	0.498	S	S	.	.	H	α-helix	trans	-64	-41.6	177.9	51.7	0	0	0	0	111.8	I26 I27 I33 M34	I26-T30 HydrophobicContact CG2-CG2 4.49Å; I26-T30 WeakPolarHBondContact O-CG2 3.32Å; I26-T30 PolarHBondContact O-N 3.05Å; I26-T30 PolarHBondContact O-OG1 3.32Å; I26-T30 VanDerWaalsContact O-OG1 3.05Å; I27-T30 WeakPolarHBondContact CA-OG1 3.22Å; I27-T30 PolarHBondContact O-N 2.9Å; I27-T30 PolarHBondContact O-OG1 3.44Å; T30-I33 PolarHBondContact O-N 3.31Å; T30-M34 WeakPolarHBondContact O-CB 3.29Å; T30-M34 VanDerWaalsContact O-CG 3.29Å; T30-M34 WeakPolarHBondContact O-CG 3.13Å; T30-M34 PolarHBondContact O-N 2.82Å
31	I	95.8	Very high	90.9	Very high	94 Å²	94	92.2 Å²	92.2	48%	0.482	50%	0.502	S	S	.	.	H	α-helix	trans	-59.5	-50.7	174	-68.2	167.7	0	0	0	110.2	I27 L28 I33 M34 T35	I27-I31 HydrophobicContact CG2-CD1 3.82Å; I27-I31 HydrophobicContact CG2-CG1 4.45Å; I27-I31 VanDerWaalsContact O-CG1 3.27Å; I27-I31 WeakPolarHBondContact O-CG1 3.27Å; I27-I31 PolarHBondContact O-N 3.37Å; L28-I31 PolarHBondContact O-N 3.21Å; I31-I33 VanDerWaalsContact C-N 3.28Å; I31-I33 PolarHBondContact O-N 2.81Å; I31-M34 PolarHBondContact O-N 3.4Å; I31-T35 WeakPolarHBondContact O-CB 3.39Å; I31-T35 PolarHBondContact O-N 3.29Å; I31-T35 PolarHBondContact O-OG1 3.49Å
32	V	93.7	Very high	90.3	Very high	89 Å²	89	86.8 Å²	86.8	54%	0.539	49%	0.491	S	S	.	.	H	α-helix	trans	-58.3	-41.4	179.3	170.6	0	0	0	0	111.4	L28 A29 S36	L28-V32 VanDerWaalsContact O-CG2 3.29Å; L28-V32 WeakPolarHBondContact O-CG2 3.23Å; L28-V32 PolarHBondContact O-N 2.81Å; A29-V32 PolarHBondContact O-N 3.35Å; V32-S36 WeakPolarHBondContact O-CB 3.29Å; V32-S36 PolarHBondContact O-N 2.92Å
33	I	93.3	Very high	89.6	Confident	93 Å²	93	88.2 Å²	88.2	48%	0.477	50%	0.495	S	S	.	.	H	α-helix	trans	-65.6	-48	177.5	-68.5	164.2	0	0	0	110.8	A29 T30 I31 T35 S36 L37	A29-I33 WeakPolarHBondContact O-CD1 3.36Å; A29-I33 VanDerWaalsContact O-CG1 3.23Å; A29-I33 WeakPolarHBondContact O-CG1 3.15Å; A29-I33 PolarHBondContact O-N 3.33Å; T30-I33 PolarHBondContact O-N 3.31Å; I31-I33 VanDerWaalsContact C-N 3.28Å; I31-I33 PolarHBondContact O-N 2.81Å; I33-T35 PolarHBondContact O-N 3.33Å; I33-S36 PolarHBondContact O-N 2.98Å; I33-L37 HydrophobicContact CG2-CD1 3.84Å; I33-L37 HydrophobicContact CG2-CG 4.31Å; I33-L37 WeakPolarHBondContact O-CB 3.26Å; I33-L37 VanDerWaalsContact O-CG 3.26Å; I33-L37 WeakPolarHBondContact O-CG 3.38Å; I33-L37 PolarHBondContact O-N 2.94Å
34	M	93.4	Very high	89	Confident	124 Å²	124	86.9 Å²	86.9	61%	0.611	50%	0.497	S	S	*	.	H	α-helix	trans	-63.3	-43.6	179.6	-69.9	-63.6	136.9	0	0	111.6	T30 I31 L37 F38	T30-M34 WeakPolarHBondContact O-CB 3.29Å; T30-M34 VanDerWaalsContact O-CG 3.29Å; T30-M34 WeakPolarHBondContact O-CG 3.13Å; T30-M34 PolarHBondContact O-N 2.82Å; I31-M34 PolarHBondContact O-N 3.4Å; M34-L37 HydrophobicContact CE-CD1 4.36Å; M34-L37 PolarHBondContact O-N 3.25Å; M34-F38 WeakPolarHBondContact O-CB 3.49Å; M34-F38 PolarHBondContact O-N 3Å
35	T	90	Very high	88.1	Confident	70 Å²	70	87 Å²	87	43%	0.429	50%	0.497	S	S	.	.	H	α-helix	trans	-64.5	-42.6	175.6	-54.8	0	0	0	0	111.2	I31 I33 F38 L39	I31-T35 WeakPolarHBondContact O-CB 3.39Å; I31-T35 PolarHBondContact O-N 3.29Å; I31-T35 PolarHBondContact O-OG1 3.49Å; I33-T35 PolarHBondContact O-N 3.33Å; T35-F38 PolarHBondContact O-N 3.42Å; T35-L39 HydrophobicContact CG2-CD1 3.76Å; T35-L39 HydrophobicContact CG2-CG 4.28Å; T35-L39 WeakPolarHBondContact O-CB 3.46Å; T35-L39 VanDerWaalsContact O-CG 3.26Å; T35-L39 WeakPolarHBondContact O-CG 3.26Å; T35-L39 PolarHBondContact O-N 2.69Å
36	S	86.4	Confident	87.5	Confident	70 Å²	70	87.3 Å²	87.3	49%	0.49	50%	0.498	S	S	.	.	H	α-helix	trans	-63.8	-45	176.1	-177.9	0	0	0	0	111.4	V32 I33 F38 L39 C40	V32-S36 WeakPolarHBondContact O-CB 3.29Å; V32-S36 PolarHBondContact O-N 2.92Å; I33-S36 PolarHBondContact O-N 2.98Å; S36-F38 PolarHBondContact O-N 3.28Å; S36-L39 CarbonylContact O-C 3.56Å; S36-L39 PolarHBondContact O-N 3.2Å; S36-C40 WeakPolarHBondContact O-CA 3.37Å; S36-C40 WeakPolarHBondContact O-CB 2.87Å; S36-C40 PolarHBondContact O-N 2.84Å
37	L	81.2	Confident	86.8	Confident	107 Å²	107	86.7 Å²	86.7	56%	0.56	50%	0.495	S	S	*	.	H	α-helix	trans	-61.8	-30.4	176	-73.8	171.2	0	0	0	112.6	I33 M34 P41	I33-L37 HydrophobicContact CG2-CD1 3.84Å; I33-L37 HydrophobicContact CG2-CG 4.31Å; I33-L37 WeakPolarHBondContact O-CB 3.26Å; I33-L37 VanDerWaalsContact O-CG 3.26Å; I33-L37 WeakPolarHBondContact O-CG 3.38Å; I33-L37 PolarHBondContact O-N 2.94Å; M34-L37 HydrophobicContact CE-CD1 4.36Å; M34-L37 PolarHBondContact O-N 3.25Å; L37-P41 WeakPolarHBondContact O-CD 3.28Å
38	F	82.7	Confident	85.9	Confident	173 Å²	173	89.9 Å²	89.9	76%	0.759	50%	0.503	S	S	*	.	H	α-helix	trans	-79.5	-37.2	175.8	-159.3	-105.3	0	0	0	112.5	M34 T35 S36 P41	M34-F38 WeakPolarHBondContact O-CB 3.49Å; M34-F38 PolarHBondContact O-N 3Å; T35-F38 PolarHBondContact O-N 3.42Å; S36-F38 PolarHBondContact O-N 3.28Å; F38-P41 WeakPolarHBondContact O-CD 3.37Å; F38-P41 WeakPolarHBondContact O-CG 3.41Å
39	L	81	Confident	84.6	Confident	97 Å²	97	92.8 Å²	92.8	51%	0.508	51%	0.507	S	S	.	.	H	α-helix	trans	-76.4	-29.7	175.8	-69.5	171.8	0	0	0	112.4	T35 S36 A42 T43	T35-L39 HydrophobicContact CG2-CD1 3.76Å; T35-L39 HydrophobicContact CG2-CG 4.28Å; T35-L39 WeakPolarHBondContact O-CB 3.46Å; T35-L39 VanDerWaalsContact O-CG 3.26Å; T35-L39 WeakPolarHBondContact O-CG 3.26Å; T35-L39 PolarHBondContact O-N 2.69Å; S36-L39 CarbonylContact O-C 3.56Å; S36-L39 PolarHBondContact O-N 3.2Å; L39-A42 CarbonylContact O-C 3.5Å; L39-A42 WeakPolarHBondContact O-CA 3.22Å; L39-A42 VanDerWaalsContact O-CB 3.28Å; L39-A42 WeakPolarHBondContact O-CB 3.37Å; L39-A42 PolarHBondContact O-N 3.47Å; L39-T43 PolarHBondContact O-N 3.28Å; L39-T43 PolarHBondContact O-OG1 2.77Å
40	C	79.6	Confident	83.4	Confident	71 Å²	71	97.2 Å²	97.2	48%	0.48	52%	0.52	S	S	.	.	H	α-helix	trans	-58.6	-45.9	-177.3	-160.3	0	0	0	0	113.2	S36 A42 T43 A44	S36-C40 WeakPolarHBondContact O-CA 3.37Å; S36-C40 WeakPolarHBondContact O-CB 2.87Å; S36-C40 PolarHBondContact O-N 2.84Å; C40-A42 VanDerWaalsContact C-N 3.28Å; C40-A42 PolarHBondContact O-N 3Å; C40-T43 PolarHBondContact O-N 2.75Å; C40-A44 VanDerWaalsContact O-CB 3.22Å; C40-A44 WeakPolarHBondContact O-CB 3.32Å; C40-A44 PolarHBondContact O-N 2.99Å
41	P	73.4	Confident	82.2	Confident	73 Å²	73	104.1 Å²	104.1	47%	0.474	54%	0.539	S	S	.	.	H	α-helix	trans	-63.7	-34.8	172.1	23	-31.4	0	0	0	111.5	L37 F38 A44 V45	L37-P41 WeakPolarHBondContact O-CD 3.28Å; F38-P41 WeakPolarHBondContact O-CD 3.37Å; F38-P41 WeakPolarHBondContact O-CG 3.41Å; P41-A44 PolarHBondContact O-N 3.42Å; P41-V45 WeakPolarHBondContact O-CB 3.3Å; P41-V45 WeakPolarHBondContact O-CG2 3.2Å; P41-V45 PolarHBondContact O-N 3.37Å
42	A	79.6	Confident	81.1	Confident	47 Å²	47	102.7 Å²	102.7	39%	0.388	53%	0.534	S	S	.	.	H	α-helix	trans	-64.7	-46	173.9	0	0	0	0	0	111.4	L39 C40 V45 I46	L39-A42 CarbonylContact O-C 3.5Å; L39-A42 WeakPolarHBondContact O-CA 3.22Å; L39-A42 VanDerWaalsContact O-CB 3.28Å; L39-A42 WeakPolarHBondContact O-CB 3.37Å; L39-A42 PolarHBondContact O-N 3.47Å; C40-A42 VanDerWaalsContact C-N 3.28Å; C40-A42 PolarHBondContact O-N 3Å; A42-V45 PolarHBondContact O-N 2.8Å; A42-I46 WeakPolarHBondContact O-CD1 3.13Å; A42-I46 WeakPolarHBondContact O-CG1 3.13Å; A42-I46 PolarHBondContact O-N 2.92Å
43	T	80.2	Confident	79.4	Confident	73 Å²	73	104.3 Å²	104.3	45%	0.448	54%	0.536	S	S	.	.	H	α-helix	trans	-63	-43.5	175.6	-47.9	0	0	0	0	111.5	L39 C40 I46 I47	L39-T43 PolarHBondContact O-N 3.28Å; L39-T43 PolarHBondContact O-OG1 2.77Å; C40-T43 PolarHBondContact O-N 2.75Å; T43-I46 PolarHBondContact O-N 3.42Å; T43-I47 HydrophobicContact CG2-CD1 3.96Å; T43-I47 VanDerWaalsContact O-CG1 3.3Å; T43-I47 WeakPolarHBondContact O-CG1 3.07Å; T43-I47 PolarHBondContact O-N 3.33Å
44	A	80.7	Confident	77.8	Confident	54 Å²	54	103.9 Å²	103.9	45%	0.446	54%	0.539	S	S	.	.	H	α-helix	trans	-62.9	-42.2	177.1	0	0	0	0	0	111.4	C40 P41 I47 Y48	C40-A44 VanDerWaalsContact O-CB 3.22Å; C40-A44 WeakPolarHBondContact O-CB 3.32Å; C40-A44 PolarHBondContact O-N 2.99Å; P41-A44 PolarHBondContact O-N 3.42Å; A44-I47 PolarHBondContact O-N 2.9Å; A44-Y48 WeakPolarHBondContact O-CB 3.32Å; A44-Y48 PolarHBondContact O-N 2.93Å
45	V	78.9	Confident	76.2	Confident	76 Å²	76	104 Å²	104	46%	0.461	55%	0.547	S	S	.	.	H	α-helix	trans	-65	-41.2	175.2	170.6	0	0	0	0	111.1	P41 A42 Y48 R49	P41-V45 WeakPolarHBondContact O-CB 3.3Å; P41-V45 WeakPolarHBondContact O-CG2 3.2Å; P41-V45 PolarHBondContact O-N 3.37Å; A42-V45 PolarHBondContact O-N 2.8Å; V45-Y48 PolarHBondContact O-N 2.86Å; V45-R49 HydrophobicContact CG1-CG 4.17Å; V45-R49 WeakPolarHBondContact O-CB 3.48Å; V45-R49 WeakPolarHBondContact O-CG 3.41Å; V45-R49 PolarHBondContact O-N 2.81Å
46	I	82.1	Confident	74.8	Confident	109 Å²	109	108.3 Å²	108.3	56%	0.559	57%	0.566	S	S	*	*	H	α-helix	trans	-62.7	-49.3	176.5	-67.6	161.2	0	0	0	110.4	A42 T43 Y48 R49 M50	A42-I46 WeakPolarHBondContact O-CD1 3.13Å; A42-I46 WeakPolarHBondContact O-CG1 3.13Å; A42-I46 PolarHBondContact O-N 2.92Å; T43-I46 PolarHBondContact O-N 3.42Å; I46-Y48 VanDerWaalsContact C-N 3.3Å; I46-Y48 PolarHBondContact O-N 3.36Å; I46-R49 PolarHBondContact O-N 2.82Å; I46-M50 VanDerWaalsContact O-CG 3.24Å; I46-M50 WeakPolarHBondContact O-CG 3.34Å; I46-M50 PolarHBondContact O-N 3.48Å
47	I	82.5	Confident	73.4	Confident	93 Å²	93	112.3 Å²	112.3	48%	0.477	58%	0.582	S	S	.	*	H	α-helix	trans	-61.9	-41.4	177.4	-66.7	167.7	0	0	0	110.6	T43 A44 M50 R51	T43-I47 HydrophobicContact CG2-CD1 3.96Å; T43-I47 VanDerWaalsContact O-CG1 3.3Å; T43-I47 WeakPolarHBondContact O-CG1 3.07Å; T43-I47 PolarHBondContact O-N 3.33Å; A44-I47 PolarHBondContact O-N 2.9Å; I47-M50 PolarHBondContact O-N 3.47Å; I47-R51 PolarHBondContact O-N 3.27Å
48	Y	78.7	Confident	72.2	Confident	157 Å²	157	110.5 Å²	110.5	62%	0.616	59%	0.589	S	S	*	*	H	α-helix	trans	-63.9	-44.6	177.7	-178.5	-99.8	0	0	0	111.5	A44 V45 I46 M50 R51 T52	A44-Y48 WeakPolarHBondContact O-CB 3.32Å; A44-Y48 PolarHBondContact O-N 2.93Å; V45-Y48 PolarHBondContact O-N 2.86Å; I46-Y48 VanDerWaalsContact C-N 3.3Å; I46-Y48 PolarHBondContact O-N 3.36Å; Y48-M50 VanDerWaalsContact C-N 3.32Å; Y48-M50 PolarHBondContact O-N 3.23Å; Y48-R51 PolarHBondContact O-N 3.45Å; Y48-T52 HydrophobicContact CD1-CG2 4.14Å; Y48-T52 HydrophobicContact CD2-CG2 4.03Å; Y48-T52 HydrophobicContact CE1-CG2 3.69Å; Y48-T52 HydrophobicContact CE2-CG2 3.57Å; Y48-T52 HydrophobicContact CG-CG2 4.3Å; Y48-T52 WeakPolarHBondContact O-CB 3.24Å; Y48-T52 WeakPolarHBondContact O-CG2 3.43Å; Y48-T52 PolarHBondContact O-N 2.81Å; Y48-T52 PolarHBondContact O-OG1 3.46Å
49	R	70.1	Confident	70.8	Confident	162 Å²	162	107 Å²	107	61%	0.611	59%	0.593	S	S	*	*	H	α-helix	trans	-59.2	-43.7	174.6	-71	-97.9	-169.9	-141.1	0.5	111	V45 I46 R51 T52 H53	V45-R49 HydrophobicContact CG1-CG 4.17Å; V45-R49 WeakPolarHBondContact O-CB 3.48Å; V45-R49 WeakPolarHBondContact O-CG 3.41Å; V45-R49 PolarHBondContact O-N 2.81Å; I46-R49 PolarHBondContact O-N 2.82Å; R49-R51 PolarHBondContact O-N 2.95Å; R49-T52 PolarHBondContact O-N 3.29Å; R49-H53 CarbonylContact O-C 3.49Å; R49-H53 WeakPolarHBondContact O-CA 3.39Å; R49-H53 PolarHBondContact O-N 2.66Å
50	M	72	Confident	69	Low	141 Å²	141	110.8 Å²	110.8	70%	0.695	64%	0.638	S	S	*	*	H	α-helix	trans	-65	-36.9	177.4	-68.1	-74.6	-83.5	0	0	112.5	I46 I47 Y48	I46-M50 VanDerWaalsContact O-CG 3.24Å; I46-M50 WeakPolarHBondContact O-CG 3.34Å; I46-M50 PolarHBondContact O-N 3.48Å; I47-M50 PolarHBondContact O-N 3.47Å; Y48-M50 VanDerWaalsContact C-N 3.32Å; Y48-M50 PolarHBondContact O-N 3.23Å
51	R	71.6	Confident	68.4	Low	213 Å²	213	112.8 Å²	112.8	80%	0.804	65%	0.646	S	S	*	*	H	α-helix	trans	-75.6	-37.4	176.1	-80.4	-164.3	177.4	176.7	1	113.7	I47 Y48 R49	I47-R51 PolarHBondContact O-N 3.27Å; Y48-R51 PolarHBondContact O-N 3.45Å; R49-R51 PolarHBondContact O-N 2.95Å
52	T	71.6	Confident	68.2	Low	64 Å²	64	114.9 Å²	114.9	39%	0.393	66%	0.655	S	S	.	*	H	α-helix	trans	-86.3	-34	-175.8	49	0	0	0	0	113.2	Y48 R49 P54	Y48-T52 HydrophobicContact CD1-CG2 4.14Å; Y48-T52 HydrophobicContact CD2-CG2 4.03Å; Y48-T52 HydrophobicContact CE1-CG2 3.69Å; Y48-T52 HydrophobicContact CE2-CG2 3.57Å; Y48-T52 HydrophobicContact CG-CG2 4.3Å; Y48-T52 WeakPolarHBondContact O-CB 3.24Å; Y48-T52 WeakPolarHBondContact O-CG2 3.43Å; Y48-T52 PolarHBondContact O-N 2.81Å; Y48-T52 PolarHBondContact O-OG1 3.46Å; R49-T52 PolarHBondContact O-N 3.29Å; T52-P54 VanDerWaalsContact C-CD 3.43Å; T52-P54 WeakPolarHBondContact O-CD 3.4Å
53	H	59.5	Low	67.5	Low	123 Å²	123	118.7 Å²	118.7	57%	0.569	67%	0.67	S	S	*	*			trans	-118.4	80.2	168	-68.4	-85.3	0	0	0	108.3	R49 V55	R49-H53 CarbonylContact O-C 3.49Å; R49-H53 WeakPolarHBondContact O-CA 3.39Å; R49-H53 PolarHBondContact O-N 2.66Å; H53-V55 HydrophobicContact CB-CG2 4.08Å; H53-V55 PolarHBondContact O-N 2.96Å
54	P	59	Low	66.8	Low	85 Å²	85	121.4 Å²	121.4	55%	0.552	68%	0.683	S	S	*	*			trans	-65	84.4	161.4	29.7	-32.5	0	0	0	106.9	T52 L56	T52-P54 VanDerWaalsContact C-CD 3.43Å; T52-P54 WeakPolarHBondContact O-CD 3.4Å; P54-L56 PolarHBondContact O-N 2.76Å
55	V	59.7	Low	65.9	Low	126 Å²	126	125.6 Å²	125.6	76%	0.764	70%	0.698	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.3	-7.9	-178.4	170.9	0	0	0	0	111.9	H53	H53-V55 HydrophobicContact CB-CG2 4.08Å; H53-V55 PolarHBondContact O-N 2.96Å
56	L	59.9	Low	65	Low	161 Å²	161	128.9 Å²	128.9	84%	0.843	71%	0.713	S	S	*	*	T	Hydrogen-bonded Turn	trans	-135.5	14.1	-167.3	-89.6	131.9	0	0	0	117.2	P54	P54-L56 PolarHBondContact O-N 2.76Å
57	N	58.3	Low	63.8	Low	153 Å²	153	130.3 Å²	130.3	82%	0.818	72%	0.724	S	S	*	*	S	Bend	trans	-125.4	21.2	-178.3	-136.7	91.5	0	0	0	117.4
58	G	56.1	Low	62.4	Low	69 Å²	69	133.2 Å²	133.2	71%	0.711	74%	0.743	S	S	*	*	S	Bend	trans	-139.5	110.5	173.5	0	0	0	0	0	113.2
59	A	52.2	Low	61	Low	100 Å²	100	131.2 Å²	131.2	83%	0.826	75%	0.754	S	S	*	*			trans	66.5	100.3	166.6	0	0	0	0	0	115.3
60	A	42.6	Very low	60.2	Low	177 Å²	177	128.4 Å²	128.4	100%	1.463	77%	0.767	S	S	*	*				64.2	0	79.7	0	0	0	0	0	111.9

Retrieved 60 of 60 residues in 11.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).