SMIM3_RAT Loading...

Small integral membrane protein 3

AlphaFold DB , UniProt , Accession Q99PE6, Species RAT (Rattus norvegicus, Rat), Gene Smim3, Length 60 aa.

						>SMIM3_RAT|Q99PE6|Smim3
MDAISQSPVDVLLPKHILDIWAIVLIILATVVIMTSLFLCPATAVIIYRMRTHPVLNGAV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.1	Very low	53.7	Low	228 Å²	228	128.5 Å²	128.5	100%	1.123	73%	0.732	S	S	*	*				0	108	0	-77.7	117.9	134.6	0	0	106.2
2	D	50.6	Low	53.9	Low	147 Å²	147	130.3 Å²	130.3	79%	0.786	74%	0.737	S	S	*	*			cis	-163.8	167.9	14.7	-92.3	-69.9	0	0	0	109.1
3	A	56.1	Low	54.3	Low	81 Å²	81	129 Å²	129	67%	0.669	73%	0.726	S	S	*	*			trans	67.4	106.8	158.4	0	0	0	0	0	116.2
4	I	58.1	Low	54.9	Low	159 Å²	159	124.7 Å²	124.7	82%	0.815	71%	0.706	S	S	*	*				-140.4	97.9	64.7	-64.3	122.2	0	0	0	106.9	Q6	I4-Q6 VanDerWaalsContact C-N 3.3Å; I4-Q6 PolarHBondContact O-N 2.96Å
5	S	56.8	Low	55.9	Low	97 Å²	97	128.7 Å²	128.7	68%	0.678	71%	0.712	S	S	*	*				26.8	72.5	110.1	-73	0	0	0	0	112.9	S7	S5-S7 PolarHBondContact O-N 2.74Å
6	Q	50.4	Low	57.2	Low	196 Å²	196	128.9 Å²	128.9	92%	0.916	71%	0.706	S	S	*	*			trans	-62.5	67	138.4	-68.7	-179.3	-96.4	0	0	106.7	I4 P8	I4-Q6 VanDerWaalsContact C-N 3.3Å; I4-Q6 PolarHBondContact O-N 2.96Å; Q6-P8 WeakPolarHBondContact O-CD 3.36Å
7	S	52.1	Low	58.9	Low	54 Å²	54	126.4 Å²	126.4	38%	0.378	69%	0.69	S	S	.	*			trans	-65	123.3	174.2	58.3	0	0	0	0	104.9	S5 V9	S5-S7 PolarHBondContact O-N 2.74Å; S7-V9 PolarHBondContact O-N 3.3Å; S7-V9 WeakPolarHBondContact OG-CG1 3.44Å; S7-V9 WeakPolarHBondContact OG-CG2 3.4Å
8	P	54.5	Low	60.4	Low	100 Å²	100	126.2 Å²	126.2	65%	0.649	69%	0.688	S	S	*	*	G	3₁₀ helix	trans	-72	41.5	176.9	31.9	-34.9	0	0	0	111.1	Q6 D10 V11 L12	Q6-P8 WeakPolarHBondContact O-CD 3.36Å; P8-D10 PolarHBondContact O-N 2.8Å; P8-V11 PolarHBondContact O-N 3.41Å; P8-L12 PolarHBondContact O-N 3.32Å
9	V	56	Low	62	Low	92 Å²	92	124.5 Å²	124.5	56%	0.558	68%	0.678	S	S	*	*	G	3₁₀ helix	trans	-66.7	-22.5	-178.5	-68.4	0	0	0	0	111.9	S7	S7-V9 PolarHBondContact O-N 3.3Å; S7-V9 WeakPolarHBondContact OG-CG1 3.44Å; S7-V9 WeakPolarHBondContact OG-CG2 3.4Å
10	D	54.1	Low	63.5	Low	129 Å²	129	121.9 Å²	121.9	69%	0.69	66%	0.663	S	S	*	*	G	3₁₀ helix	trans	-88	-21.1	177.5	-59.6	-55.2	0	0	0	113.7	P8	P8-D10 PolarHBondContact O-N 2.8Å
11	V	55.3	Low	64.9	Low	130 Å²	130	123.7 Å²	123.7	79%	0.788	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.7	-24.4	-177.5	-177.2	0	0	0	0	111.8	P8 L13	P8-V11 PolarHBondContact O-N 3.41Å; V11-L13 VanDerWaalsContact C-N 3.34Å
12	L	55.6	Low	67.1	Low	151 Å²	151	114.8 Å²	114.8	79%	0.791	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.7	28.2	167.7	-150.4	91.8	0	0	0	111.3	P8 P14	P8-L12 PolarHBondContact O-N 3.32Å; L12-P14 WeakPolarHBondContact O-CD 3.46Å
13	L	59.4	Low	69.2	Low	113 Å²	113	111.7 Å²	111.7	59%	0.592	61%	0.605	S	S	*	*	S	Bend	trans	-49.9	121.2	163	-157.2	86.9	0	0	0	105.7	V11 K15	V11-L13 VanDerWaalsContact C-N 3.34Å; L13-K15 VanDerWaalsContact C-N 3.32Å; L13-K15 PolarHBondContact O-N 2.94Å
14	P	61.9	Low	71.1	Confident	69 Å²	69	111.1 Å²	111.1	45%	0.448	59%	0.593	S	S	.	*			trans	-66.1	95.5	-163.1	-21	33.5	0	0	0	108.7	L12 H16 I17 L18	L12-P14 WeakPolarHBondContact O-CD 3.46Å; P14-H16 PolarHBondContact O-N 2.95Å; P14-I17 HydrophobicContact CB-CB 4.21Å; P14-I17 HydrophobicContact CB-CD1 3.58Å; P14-I17 HydrophobicContact CB-CG1 3.74Å; P14-I17 HydrophobicContact CG-CD1 3.64Å; P14-I17 HydrophobicContact CG-CG1 4.36Å; P14-I17 PolarHBondContact O-N 3.46Å; P14-L18 PolarHBondContact O-N 3.3Å
15	K	70.9	Confident	72.9	Confident	184 Å²	184	108.5 Å²	108.5	80%	0.8	58%	0.58	S	S	*	*	H	α-helix	trans	-50.2	-30.1	179.5	175.7	166.5	167.3	174.3	0	111.2	L13 D19	L13-K15 VanDerWaalsContact C-N 3.32Å; L13-K15 PolarHBondContact O-N 2.94Å; K15-D19 WeakPolarHBondContact O-CB 3.39Å; K15-D19 PolarHBondContact O-N 3.4Å; K15-D19 VanDerWaalsContact O-N 3.11Å
16	H	77.1	Confident	74.8	Confident	133 Å²	133	109 Å²	109	62%	0.616	57%	0.574	S	S	*	*	H	α-helix	trans	-61.9	-43.4	172.8	-169.5	53.2	0	0	0	114.3	P14 D19 I20	P14-H16 PolarHBondContact O-N 2.95Å; H16-D19 PolarHBondContact O-N 2.94Å; H16-I20 VanDerWaalsContact NE2-CD1 3.35Å; H16-I20 WeakPolarHBondContact NE2-CD1 3.29Å; H16-I20 WeakPolarHBondContact O-CD1 3.32Å; H16-I20 WeakPolarHBondContact O-CG1 3.49Å; H16-I20 PolarHBondContact O-N 3.42Å
17	I	84.6	Confident	77	Confident	85 Å²	85	104.5 Å²	104.5	44%	0.436	56%	0.555	S	S	.	*	H	α-helix	trans	-65.6	-46.3	-179.2	-65.5	172.9	0	0	0	110	P14 D19 I20 W21	P14-I17 HydrophobicContact CB-CB 4.21Å; P14-I17 HydrophobicContact CB-CD1 3.58Å; P14-I17 HydrophobicContact CB-CG1 3.74Å; P14-I17 HydrophobicContact CG-CD1 3.64Å; P14-I17 HydrophobicContact CG-CG1 4.36Å; P14-I17 PolarHBondContact O-N 3.46Å; I17-D19 VanDerWaalsContact C-N 3.3Å; I17-D19 PolarHBondContact O-N 2.78Å; I17-I20 PolarHBondContact O-N 3.11Å; I17-W21 VanDerWaalsContact CG2-CD1 3.46Å; I17-W21 PolarHBondContact O-N 2.67Å
18	L	87.2	Confident	79.1	Confident	124 Å²	124	106.7 Å²	106.7	65%	0.649	56%	0.562	S	S	*	*	H	α-helix	trans	-63.4	-38.9	179.3	-166.9	67	0	0	0	111.7	P14 W21 A22	P14-L18 PolarHBondContact O-N 3.3Å; L18-W21 PolarHBondContact O-N 2.83Å; L18-A22 VanDerWaalsContact O-CB 3.31Å; L18-A22 WeakPolarHBondContact O-CB 3.35Å; L18-A22 PolarHBondContact O-N 3.26Å
19	D	89.9	Confident	81.1	Confident	93 Å²	93	104.2 Å²	104.2	50%	0.497	55%	0.55	S	S	.	*	H	α-helix	trans	-64.1	-45.4	175.7	-167.9	30.9	0	0	0	111.8	K15 H16 I17 W21 A22 I23	K15-D19 WeakPolarHBondContact O-CB 3.39Å; K15-D19 PolarHBondContact O-N 3.4Å; K15-D19 VanDerWaalsContact O-N 3.11Å; H16-D19 PolarHBondContact O-N 2.94Å; I17-D19 VanDerWaalsContact C-N 3.3Å; I17-D19 PolarHBondContact O-N 2.78Å; D19-W21 PolarHBondContact O-N 2.93Å; D19-A22 WeakPolarHBondContact O-CB 3.2Å; D19-A22 PolarHBondContact O-N 3.23Å; D19-I23 VanDerWaalsContact O-CG1 3.27Å; D19-I23 WeakPolarHBondContact O-CG1 3.27Å; D19-I23 PolarHBondContact O-N 3.45Å
20	I	91.7	Very high	83	Confident	73 Å²	73	103.3 Å²	103.3	37%	0.374	55%	0.545	S	S	.	.	H	α-helix	trans	-58.4	-49.5	174.2	-67.4	159.6	0	0	0	110.8	H16 I17 A22 I23 V24	H16-I20 VanDerWaalsContact NE2-CD1 3.35Å; H16-I20 WeakPolarHBondContact NE2-CD1 3.29Å; H16-I20 WeakPolarHBondContact O-CD1 3.32Å; H16-I20 WeakPolarHBondContact O-CG1 3.49Å; H16-I20 PolarHBondContact O-N 3.42Å; I17-I20 PolarHBondContact O-N 3.11Å; I20-A22 VanDerWaalsContact C-N 3.31Å; I20-A22 PolarHBondContact O-N 2.91Å; I20-I23 PolarHBondContact O-N 3.42Å; I20-V24 HydrophobicContact CG2-CG2 4.33Å; I20-V24 VanDerWaalsContact O-CG2 3.29Å; I20-V24 WeakPolarHBondContact O-CG2 3.18Å; I20-V24 PolarHBondContact O-N 2.86Å
21	W	94	Very high	85	Confident	159 Å²	159	101 Å²	101	60%	0.602	54%	0.535	S	S	*	.	H	α-helix	trans	-62.4	-38.9	178.6	-79.1	109.1	0	0	0	111.9	I17 L18 D19 V24 L25	I17-W21 VanDerWaalsContact CG2-CD1 3.46Å; I17-W21 PolarHBondContact O-N 2.67Å; L18-W21 PolarHBondContact O-N 2.83Å; D19-W21 PolarHBondContact O-N 2.93Å; W21-V24 PolarHBondContact O-N 3.35Å; W21-L25 WeakPolarHBondContact O-CB 3.35Å; W21-L25 VanDerWaalsContact O-CG 3.22Å; W21-L25 WeakPolarHBondContact O-CG 3.22Å; W21-L25 PolarHBondContact O-N 3.43Å
22	A	93.2	Very high	86.9	Confident	41 Å²	41	98.5 Å²	98.5	34%	0.339	52%	0.52	S	S	.	.	H	α-helix	trans	-61.1	-46.2	175.5	0	0	0	0	0	111.3	L18 D19 I20 V24 L25 I26	L18-A22 VanDerWaalsContact O-CB 3.31Å; L18-A22 WeakPolarHBondContact O-CB 3.35Å; L18-A22 PolarHBondContact O-N 3.26Å; D19-A22 WeakPolarHBondContact O-CB 3.2Å; D19-A22 PolarHBondContact O-N 3.23Å; I20-A22 VanDerWaalsContact C-N 3.31Å; I20-A22 PolarHBondContact O-N 2.91Å; A22-V24 PolarHBondContact O-N 3.48Å; A22-L25 PolarHBondContact O-N 2.83Å; A22-I26 WeakPolarHBondContact O-CD1 3.31Å; A22-I26 VanDerWaalsContact O-CG1 3.23Å; A22-I26 WeakPolarHBondContact O-CG1 3.31Å; A22-I26 PolarHBondContact O-N 2.9Å
23	I	93.9	Very high	88.7	Confident	83 Å²	83	96 Å²	96	43%	0.426	51%	0.506	S	S	.	.	H	α-helix	trans	-61.4	-45.9	176.6	-64.9	161.7	0	0	0	110.6	D19 I20 L25 I26 I27	D19-I23 VanDerWaalsContact O-CG1 3.27Å; D19-I23 WeakPolarHBondContact O-CG1 3.27Å; D19-I23 PolarHBondContact O-N 3.45Å; I20-I23 PolarHBondContact O-N 3.42Å; I23-L25 VanDerWaalsContact C-N 3.35Å; I23-L25 PolarHBondContact O-N 2.94Å; I23-I26 PolarHBondContact O-N 3.26Å; I23-I27 HydrophobicContact CG2-CD1 3.79Å; I23-I27 HydrophobicContact CG2-CG1 4.47Å; I23-I27 VanDerWaalsContact O-CG1 3.31Å; I23-I27 WeakPolarHBondContact O-CG1 3.47Å; I23-I27 PolarHBondContact O-N 3.46Å
24	V	96.4	Very high	90.3	Very high	69 Å²	69	96.6 Å²	96.6	42%	0.418	51%	0.508	S	S	.	.	H	α-helix	trans	-60.9	-43.7	177.2	172.4	0	0	0	0	111.1	I20 W21 A22 I27 L28	I20-V24 HydrophobicContact CG2-CG2 4.33Å; I20-V24 VanDerWaalsContact O-CG2 3.29Å; I20-V24 WeakPolarHBondContact O-CG2 3.18Å; I20-V24 PolarHBondContact O-N 2.86Å; W21-V24 PolarHBondContact O-N 3.35Å; A22-V24 PolarHBondContact O-N 3.48Å; V24-I27 PolarHBondContact O-N 2.81Å; V24-L28 WeakPolarHBondContact O-CB 3.23Å; V24-L28 PolarHBondContact O-N 3.49Å
25	L	95.4	Very high	91.7	Very high	104 Å²	104	96.6 Å²	96.6	55%	0.545	51%	0.507	S	S	.	.	H	α-helix	trans	-63.6	-40.1	176.6	-74.2	173.5	0	0	0	112.1	W21 A22 I23 L28 A29	W21-L25 WeakPolarHBondContact O-CB 3.35Å; W21-L25 VanDerWaalsContact O-CG 3.22Å; W21-L25 WeakPolarHBondContact O-CG 3.22Å; W21-L25 PolarHBondContact O-N 3.43Å; A22-L25 PolarHBondContact O-N 2.83Å; I23-L25 VanDerWaalsContact C-N 3.35Å; I23-L25 PolarHBondContact O-N 2.94Å; L25-L28 PolarHBondContact O-N 2.66Å; L25-A29 WeakPolarHBondContact O-CB 3.18Å; L25-A29 PolarHBondContact O-N 3.4Å
26	I	96.3	Very high	92.5	Very high	108 Å²	108	90.3 Å²	90.3	55%	0.554	49%	0.486	S	S	*	.	H	α-helix	trans	-64.2	-46.6	176.5	-69.3	162.2	0	0	0	110.4	A22 I23 A29 T30	A22-I26 WeakPolarHBondContact O-CD1 3.31Å; A22-I26 VanDerWaalsContact O-CG1 3.23Å; A22-I26 WeakPolarHBondContact O-CG1 3.31Å; A22-I26 PolarHBondContact O-N 2.9Å; I23-I26 PolarHBondContact O-N 3.26Å; I26-A29 PolarHBondContact O-N 2.82Å; I26-T30 WeakPolarHBondContact O-CB 3.2Å; I26-T30 PolarHBondContact O-N 3.47Å; I26-T30 PolarHBondContact O-OG1 3.31Å
27	I	96.9	Very high	92.9	Very high	100 Å²	100	89.4 Å²	89.4	51%	0.513	49%	0.485	S	S	.	.	H	α-helix	trans	-63.7	-46.6	178	-65.2	166.3	0	0	0	109.9	I23 V24 A29 T30 V31	I23-I27 HydrophobicContact CG2-CD1 3.79Å; I23-I27 HydrophobicContact CG2-CG1 4.47Å; I23-I27 VanDerWaalsContact O-CG1 3.31Å; I23-I27 WeakPolarHBondContact O-CG1 3.47Å; I23-I27 PolarHBondContact O-N 3.46Å; V24-I27 PolarHBondContact O-N 2.81Å; I27-A29 PolarHBondContact O-N 3.3Å; I27-T30 WeakPolarHBondContact O-CB 3.47Å; I27-T30 PolarHBondContact O-N 3.32Å; I27-V31 HydrophobicContact CG2-CG2 4.37Å; I27-V31 WeakPolarHBondContact O-CG2 3.46Å; I27-V31 PolarHBondContact O-N 2.85Å
28	L	97	Very high	92.9	Very high	101 Å²	101	93.5 Å²	93.5	53%	0.529	50%	0.5	S	S	.	.	H	α-helix	trans	-59.1	-47.3	177.9	-176.1	66.8	0	0	0	111	V24 L25 T30 V31 V32	V24-L28 WeakPolarHBondContact O-CB 3.23Å; V24-L28 PolarHBondContact O-N 3.49Å; L25-L28 PolarHBondContact O-N 2.66Å; L28-T30 VanDerWaalsContact C-N 3.32Å; L28-T30 PolarHBondContact O-N 2.88Å; L28-V31 PolarHBondContact O-N 3.44Å; L28-V32 WeakPolarHBondContact O-CB 3.2Å; L28-V32 VanDerWaalsContact O-CG2 3.26Å; L28-V32 WeakPolarHBondContact O-CG2 3.34Å; L28-V32 PolarHBondContact O-N 3.46Å
29	A	96.1	Very high	92.7	Very high	47 Å²	47	92 Å²	92	39%	0.388	49%	0.492	S	S	.	.	H	α-helix	trans	-60	-43.4	175.9	0	0	0	0	0	111.4	L25 I26 I27 V32 I33	L25-A29 WeakPolarHBondContact O-CB 3.18Å; L25-A29 PolarHBondContact O-N 3.4Å; I26-A29 PolarHBondContact O-N 2.82Å; I27-A29 PolarHBondContact O-N 3.3Å; A29-V32 PolarHBondContact O-N 2.69Å; A29-I33 WeakPolarHBondContact O-CB 3.48Å; A29-I33 WeakPolarHBondContact O-CD1 3.44Å; A29-I33 WeakPolarHBondContact O-CG1 3.38Å; A29-I33 PolarHBondContact O-N 3.39Å
30	T	96.1	Very high	92.5	Very high	74 Å²	74	91.2 Å²	91.2	45%	0.454	49%	0.493	S	S	.	.	H	α-helix	trans	-62.4	-45.4	177.6	-53.5	0	0	0	0	111.2	I26 I27 L28 I33 M34	I26-T30 WeakPolarHBondContact O-CB 3.2Å; I26-T30 PolarHBondContact O-N 3.47Å; I26-T30 PolarHBondContact O-OG1 3.31Å; I27-T30 WeakPolarHBondContact O-CB 3.47Å; I27-T30 PolarHBondContact O-N 3.32Å; L28-T30 VanDerWaalsContact C-N 3.32Å; L28-T30 PolarHBondContact O-N 2.88Å; T30-I33 PolarHBondContact O-N 3.43Å; T30-M34 HydrophobicContact CG2-CG 4.4Å; T30-M34 WeakPolarHBondContact O-CB 3.45Å; T30-M34 VanDerWaalsContact O-CG 3.23Å; T30-M34 WeakPolarHBondContact O-CG 3.28Å; T30-M34 PolarHBondContact O-N 3.41Å
31	V	95.8	Very high	91.9	Very high	79 Å²	79	91 Å²	91	48%	0.479	50%	0.496	S	S	.	.	H	α-helix	trans	-62.9	-43.7	176.5	172	0	0	0	0	110.9	I27 L28 I33 M34 T35	I27-V31 HydrophobicContact CG2-CG2 4.37Å; I27-V31 WeakPolarHBondContact O-CG2 3.46Å; I27-V31 PolarHBondContact O-N 2.85Å; L28-V31 PolarHBondContact O-N 3.44Å; V31-I33 VanDerWaalsContact C-N 3.33Å; V31-I33 PolarHBondContact O-N 3.18Å; V31-M34 PolarHBondContact O-N 2.87Å; V31-T35 WeakPolarHBondContact O-CB 3.26Å; V31-T35 PolarHBondContact O-N 2.85Å; V31-T35 PolarHBondContact O-OG1 2.71Å
32	V	94.9	Very high	91.4	Very high	78 Å²	78	85.6 Å²	85.6	47%	0.473	49%	0.486	S	S	.	.	H	α-helix	trans	-61.9	-41.9	176.1	170	0	0	0	0	110.9	L28 A29 S36	L28-V32 WeakPolarHBondContact O-CB 3.2Å; L28-V32 VanDerWaalsContact O-CG2 3.26Å; L28-V32 WeakPolarHBondContact O-CG2 3.34Å; L28-V32 PolarHBondContact O-N 3.46Å; A29-V32 PolarHBondContact O-N 2.69Å; V32-S36 WeakPolarHBondContact O-CB 3.32Å; V32-S36 PolarHBondContact O-N 2.79Å; V32-S36 PolarHBondContact O-OG 2.82Å
33	I	94.4	Very high	90.9	Very high	98 Å²	98	86.9 Å²	86.9	50%	0.503	49%	0.49	S	S	.	.	H	α-helix	trans	-65.6	-47.9	177	-69.3	163.6	0	0	0	110.6	A29 T30 V31 T35 S36 L37	A29-I33 WeakPolarHBondContact O-CB 3.48Å; A29-I33 WeakPolarHBondContact O-CD1 3.44Å; A29-I33 WeakPolarHBondContact O-CG1 3.38Å; A29-I33 PolarHBondContact O-N 3.39Å; T30-I33 PolarHBondContact O-N 3.43Å; V31-I33 VanDerWaalsContact C-N 3.33Å; V31-I33 PolarHBondContact O-N 3.18Å; I33-T35 VanDerWaalsContact C-N 3.34Å; I33-T35 PolarHBondContact O-N 3.28Å; I33-S36 PolarHBondContact O-N 3.45Å; I33-L37 HydrophobicContact CG2-CD1 3.8Å; I33-L37 HydrophobicContact CG2-CG 4.26Å; I33-L37 WeakPolarHBondContact O-CB 3.23Å; I33-L37 VanDerWaalsContact O-CG 3.28Å; I33-L37 WeakPolarHBondContact O-CG 3.42Å; I33-L37 PolarHBondContact O-N 3Å
34	M	93.5	Very high	90.3	Very high	126 Å²	126	85.6 Å²	85.6	62%	0.621	49%	0.491	S	S	*	.	H	α-helix	trans	-61.8	-42.9	178	-69.1	-70.7	-84.3	0	0	111.5	T30 V31 L37 F38	T30-M34 HydrophobicContact CG2-CG 4.4Å; T30-M34 WeakPolarHBondContact O-CB 3.45Å; T30-M34 VanDerWaalsContact O-CG 3.23Å; T30-M34 WeakPolarHBondContact O-CG 3.28Å; T30-M34 PolarHBondContact O-N 3.41Å; V31-M34 PolarHBondContact O-N 2.87Å; M34-L37 PolarHBondContact O-N 2.85Å; M34-F38 WeakPolarHBondContact O-CB 3.18Å; M34-F38 PolarHBondContact O-N 2.75Å
35	T	90.6	Very high	89.7	Confident	69 Å²	69	85.8 Å²	85.8	42%	0.423	49%	0.492	S	S	.	.	H	α-helix	trans	-66.3	-41.6	177.3	-53.7	0	0	0	0	110.9	V31 I33 F38 L39	V31-T35 WeakPolarHBondContact O-CB 3.26Å; V31-T35 PolarHBondContact O-N 2.85Å; V31-T35 PolarHBondContact O-OG1 2.71Å; I33-T35 VanDerWaalsContact C-N 3.34Å; I33-T35 PolarHBondContact O-N 3.28Å; T35-F38 PolarHBondContact O-N 3.3Å; T35-L39 HydrophobicContact CG2-CD1 3.72Å; T35-L39 HydrophobicContact CG2-CG 4.41Å; T35-L39 WeakPolarHBondContact O-CB 3.27Å; T35-L39 VanDerWaalsContact O-CG 3.31Å; T35-L39 WeakPolarHBondContact O-CG 3.39Å; T35-L39 PolarHBondContact O-N 3.28Å
36	S	87.9	Confident	89.1	Confident	53 Å²	53	85.3 Å²	85.3	37%	0.371	49%	0.489	S	S	.	.	H	α-helix	trans	-67.6	-41.4	175.7	-60	0	0	0	0	111.4	V32 I33 F38 L39 C40	V32-S36 WeakPolarHBondContact O-CB 3.32Å; V32-S36 PolarHBondContact O-N 2.79Å; V32-S36 PolarHBondContact O-OG 2.82Å; I33-S36 PolarHBondContact O-N 3.45Å; S36-F38 PolarHBondContact O-N 3.27Å; S36-L39 CarbonylContact O-C 3.56Å; S36-L39 PolarHBondContact O-N 2.85Å; S36-C40 WeakPolarHBondContact O-CA 3.15Å; S36-C40 WeakPolarHBondContact O-CB 3.48Å; S36-C40 PolarHBondContact O-N 2.71Å; S36-C40 PolarHBondContact O-SG 3.26Å
37	L	84.7	Confident	88.5	Confident	114 Å²	114	84 Å²	84	60%	0.597	48%	0.483	S	S	*	.	H	α-helix	trans	-65.2	-23.8	174.5	-75.9	171.8	0	0	0	112.7	I33 M34 P41	I33-L37 HydrophobicContact CG2-CD1 3.8Å; I33-L37 HydrophobicContact CG2-CG 4.26Å; I33-L37 WeakPolarHBondContact O-CB 3.23Å; I33-L37 VanDerWaalsContact O-CG 3.28Å; I33-L37 WeakPolarHBondContact O-CG 3.42Å; I33-L37 PolarHBondContact O-N 3Å; M34-L37 PolarHBondContact O-N 2.85Å; L37-P41 WeakPolarHBondContact O-CD 3.33Å; L37-P41 VanDerWaalsContact O-CG 3.27Å; L37-P41 WeakPolarHBondContact O-CG 3.31Å
38	F	84.2	Confident	87.7	Confident	170 Å²	170	86.8 Å²	86.8	75%	0.746	49%	0.488	S	S	*	.	H	α-helix	trans	-85.7	-38.7	173.8	-163.9	-107.9	0	0	0	112.2	M34 T35 S36 P41	M34-F38 WeakPolarHBondContact O-CB 3.18Å; M34-F38 PolarHBondContact O-N 2.75Å; T35-F38 PolarHBondContact O-N 3.3Å; S36-F38 PolarHBondContact O-N 3.27Å; F38-P41 WeakPolarHBondContact O-CD 3.36Å; F38-P41 VanDerWaalsContact O-CG 3.31Å; F38-P41 WeakPolarHBondContact O-CG 3.31Å
39	L	84.6	Confident	86.7	Confident	94 Å²	94	90 Å²	90	49%	0.492	49%	0.493	S	S	.	.	H	α-helix	trans	-75.5	-28.2	175.3	-73.3	165.4	0	0	0	112.8	T35 S36 A42 T43	T35-L39 HydrophobicContact CG2-CD1 3.72Å; T35-L39 HydrophobicContact CG2-CG 4.41Å; T35-L39 WeakPolarHBondContact O-CB 3.27Å; T35-L39 VanDerWaalsContact O-CG 3.31Å; T35-L39 WeakPolarHBondContact O-CG 3.39Å; T35-L39 PolarHBondContact O-N 3.28Å; S36-L39 CarbonylContact O-C 3.56Å; S36-L39 PolarHBondContact O-N 2.85Å; L39-A42 CarbonylContact O-C 3.57Å; L39-A42 WeakPolarHBondContact O-CB 3.05Å; L39-A42 PolarHBondContact O-N 3.47Å; L39-T43 VanDerWaalsContact O-CB 3.25Å; L39-T43 WeakPolarHBondContact O-CB 2.79Å; L39-T43 PolarHBondContact O-N 3.15Å; L39-T43 PolarHBondContact O-OG1 3.35Å
40	C	84	Confident	85.7	Confident	75 Å²	75	94 Å²	94	51%	0.507	51%	0.505	S	S	.	.	H	α-helix	trans	-61.2	-50.7	178.9	-88.7	0	0	0	0	112.2	S36 A42 T43 A44	S36-C40 WeakPolarHBondContact O-CA 3.15Å; S36-C40 WeakPolarHBondContact O-CB 3.48Å; S36-C40 PolarHBondContact O-N 2.71Å; S36-C40 PolarHBondContact O-SG 3.26Å; C40-A42 VanDerWaalsContact C-N 3.31Å; C40-A42 PolarHBondContact O-N 2.66Å; C40-T43 PolarHBondContact O-N 2.79Å; C40-A44 WeakPolarHBondContact O-CA 3.49Å; C40-A44 WeakPolarHBondContact O-CB 3.25Å; C40-A44 PolarHBondContact O-N 3.38Å
41	P	79.6	Confident	84.7	Confident	68 Å²	68	100.1 Å²	100.1	44%	0.442	52%	0.52	S	S	.	.	H	α-helix	trans	-64.6	-36.4	173.5	23.4	-31	0	0	0	111	L37 F38 V45	L37-P41 WeakPolarHBondContact O-CD 3.33Å; L37-P41 VanDerWaalsContact O-CG 3.27Å; L37-P41 WeakPolarHBondContact O-CG 3.31Å; F38-P41 WeakPolarHBondContact O-CD 3.36Å; F38-P41 VanDerWaalsContact O-CG 3.31Å; F38-P41 WeakPolarHBondContact O-CG 3.31Å; P41-V45 WeakPolarHBondContact O-CB 3.37Å; P41-V45 WeakPolarHBondContact O-CG2 3.04Å; P41-V45 PolarHBondContact O-N 3.5Å
42	A	84.4	Confident	83.8	Confident	46 Å²	46	99.4 Å²	99.4	38%	0.38	52%	0.515	S	S	.	.	H	α-helix	trans	-62.4	-47.6	174.7	0	0	0	0	0	111.8	L39 C40 V45 I46	L39-A42 CarbonylContact O-C 3.57Å; L39-A42 WeakPolarHBondContact O-CB 3.05Å; L39-A42 PolarHBondContact O-N 3.47Å; C40-A42 VanDerWaalsContact C-N 3.31Å; C40-A42 PolarHBondContact O-N 2.66Å; A42-V45 PolarHBondContact O-N 2.71Å; A42-I46 WeakPolarHBondContact O-CB 3.38Å; A42-I46 WeakPolarHBondContact O-CD1 3.2Å; A42-I46 WeakPolarHBondContact O-CG1 3.07Å; A42-I46 PolarHBondContact O-N 3.31Å
43	T	81.4	Confident	82.3	Confident	69 Å²	69	102 Å²	102	42%	0.423	52%	0.523	S	S	.	.	H	α-helix	trans	-66.5	-43.8	178.6	-53.9	0	0	0	0	110.8	L39 C40 V45 I46 I47	L39-T43 VanDerWaalsContact O-CB 3.25Å; L39-T43 WeakPolarHBondContact O-CB 2.79Å; L39-T43 PolarHBondContact O-N 3.15Å; L39-T43 PolarHBondContact O-OG1 3.35Å; C40-T43 PolarHBondContact O-N 2.79Å; T43-V45 PolarHBondContact O-N 2.73Å; T43-I46 PolarHBondContact O-N 3.49Å; T43-I47 HydrophobicContact CG2-CD1 3.85Å; T43-I47 HydrophobicContact CG2-CG1 4.42Å; T43-I47 WeakPolarHBondContact O-CB 3.09Å; T43-I47 VanDerWaalsContact O-CG1 3.26Å; T43-I47 WeakPolarHBondContact O-CG1 3.49Å; T43-I47 PolarHBondContact O-N 3.33Å
44	A	82.5	Confident	80.6	Confident	55 Å²	55	101.4 Å²	101.4	46%	0.455	53%	0.525	S	S	.	.	H	α-helix	trans	-63.4	-40.5	175.6	0	0	0	0	0	111.2	C40 Y48	C40-A44 WeakPolarHBondContact O-CA 3.49Å; C40-A44 WeakPolarHBondContact O-CB 3.25Å; C40-A44 PolarHBondContact O-N 3.38Å; A44-Y48 WeakPolarHBondContact O-CA 3.28Å; A44-Y48 WeakPolarHBondContact O-CB 3.47Å; A44-Y48 PolarHBondContact O-N 3.25Å
45	V	82.6	Confident	79	Confident	73 Å²	73	101.1 Å²	101.1	44%	0.442	53%	0.53	S	S	.	.	H	α-helix	trans	-67.3	-39	174.3	170	0	0	0	0	111.1	P41 A42 T43 Y48 R49	P41-V45 WeakPolarHBondContact O-CB 3.37Å; P41-V45 WeakPolarHBondContact O-CG2 3.04Å; P41-V45 PolarHBondContact O-N 3.5Å; A42-V45 PolarHBondContact O-N 2.71Å; T43-V45 PolarHBondContact O-N 2.73Å; V45-Y48 PolarHBondContact O-N 2.8Å; V45-R49 HydrophobicContact CG1-CG 4.38Å; V45-R49 VanDerWaalsContact O-CB 3.28Å; V45-R49 WeakPolarHBondContact O-CB 3.49Å; V45-R49 VanDerWaalsContact O-CG 3.28Å; V45-R49 WeakPolarHBondContact O-CG 3.28Å; V45-R49 PolarHBondContact O-N 3.46Å
46	I	83.4	Confident	77.5	Confident	94 Å²	94	105.3 Å²	105.3	48%	0.482	55%	0.549	S	S	.	.	H	α-helix	trans	-63.8	-50	174.9	-68.9	160.2	0	0	0	110.3	A42 T43 Y48 R49 M50	A42-I46 WeakPolarHBondContact O-CB 3.38Å; A42-I46 WeakPolarHBondContact O-CD1 3.2Å; A42-I46 WeakPolarHBondContact O-CG1 3.07Å; A42-I46 PolarHBondContact O-N 3.31Å; T43-I46 PolarHBondContact O-N 3.49Å; I46-Y48 VanDerWaalsContact C-N 3.33Å; I46-Y48 PolarHBondContact O-N 3.31Å; I46-R49 PolarHBondContact O-N 2.75Å; I46-M50 HydrophobicContact CG2-CE 4Å; I46-M50 HydrophobicContact CG2-SD 4.33Å; I46-M50 WeakPolarHBondContact O-CB 3.46Å; I46-M50 WeakPolarHBondContact O-CG 3.26Å; I46-M50 PolarHBondContact O-N 2.81Å
47	I	83.8	Confident	76.1	Confident	82 Å²	82	110.1 Å²	110.1	42%	0.421	57%	0.57	S	S	.	*	H	α-helix	trans	-62.5	-42	177.2	-66.9	168.1	0	0	0	110.5	T43 M50 R51	T43-I47 HydrophobicContact CG2-CD1 3.85Å; T43-I47 HydrophobicContact CG2-CG1 4.42Å; T43-I47 WeakPolarHBondContact O-CB 3.09Å; T43-I47 VanDerWaalsContact O-CG1 3.26Å; T43-I47 WeakPolarHBondContact O-CG1 3.49Å; T43-I47 PolarHBondContact O-N 3.33Å; I47-M50 PolarHBondContact O-N 3.08Å; I47-R51 WeakPolarHBondContact O-CG 3.44Å; I47-R51 PolarHBondContact O-N 2.83Å
48	Y	80.8	Confident	74.7	Confident	157 Å²	157	108.1 Å²	108.1	62%	0.616	58%	0.578	S	S	*	*	H	α-helix	trans	-62	-48.9	177.1	-179.6	-100.3	0	0	0	110.5	A44 V45 I46 M50 R51 T52	A44-Y48 WeakPolarHBondContact O-CA 3.28Å; A44-Y48 WeakPolarHBondContact O-CB 3.47Å; A44-Y48 PolarHBondContact O-N 3.25Å; V45-Y48 PolarHBondContact O-N 2.8Å; I46-Y48 VanDerWaalsContact C-N 3.33Å; I46-Y48 PolarHBondContact O-N 3.31Å; Y48-M50 VanDerWaalsContact C-N 3.33Å; Y48-M50 PolarHBondContact O-N 2.9Å; Y48-R51 CarbonylContact O-C 3.58Å; Y48-R51 PolarHBondContact O-N 3.21Å; Y48-R51 VanDerWaalsContact O-N 3.08Å; Y48-T52 HydrophobicContact CD1-CG2 4.02Å; Y48-T52 HydrophobicContact CD2-CG2 4.1Å; Y48-T52 HydrophobicContact CE1-CG2 3.61Å; Y48-T52 HydrophobicContact CE2-CG2 3.7Å; Y48-T52 HydrophobicContact CG-CG2 4.25Å; Y48-T52 VanDerWaalsContact CZ-CG2 3.44Å; Y48-T52 WeakPolarHBondContact O-CG2 3.49Å; Y48-T52 PolarHBondContact O-N 3.48Å; Y48-T52 PolarHBondContact O-OG1 3.41Å; Y48-T52 VanDerWaalsContact O-OG1 3.1Å
49	R	75.5	Confident	73.2	Confident	170 Å²	170	104 Å²	104	64%	0.642	58%	0.575	S	S	*	*	H	α-helix	trans	-60.3	-40.1	174.6	-77.3	-178	-177.4	-118.6	3.1	112.3	V45 I46 R51 T52 H53	V45-R49 HydrophobicContact CG1-CG 4.38Å; V45-R49 VanDerWaalsContact O-CB 3.28Å; V45-R49 WeakPolarHBondContact O-CB 3.49Å; V45-R49 VanDerWaalsContact O-CG 3.28Å; V45-R49 WeakPolarHBondContact O-CG 3.28Å; V45-R49 PolarHBondContact O-N 3.46Å; I46-R49 PolarHBondContact O-N 2.75Å; R49-R51 VanDerWaalsContact C-N 3.3Å; R49-R51 PolarHBondContact O-N 3.1Å; R49-T52 WeakPolarHBondContact CA-OG1 3.47Å; R49-T52 PolarHBondContact O-N 2.77Å; R49-T52 PolarHBondContact O-OG1 2.79Å; R49-H53 WeakPolarHBondContact O-CA 3.41Å; R49-H53 WeakPolarHBondContact O-CB 3.4Å; R49-H53 PolarHBondContact O-N 2.79Å
50	M	74.7	Confident	71.4	Confident	129 Å²	129	109.9 Å²	109.9	64%	0.635	61%	0.614	S	S	*	*	H	α-helix	trans	-62.8	-36.9	174.3	-77.5	-179.1	175.8	0	0	112	I46 I47 Y48 H53 P54	I46-M50 HydrophobicContact CG2-CE 4Å; I46-M50 HydrophobicContact CG2-SD 4.33Å; I46-M50 WeakPolarHBondContact O-CB 3.46Å; I46-M50 WeakPolarHBondContact O-CG 3.26Å; I46-M50 PolarHBondContact O-N 2.81Å; I47-M50 PolarHBondContact O-N 3.08Å; Y48-M50 VanDerWaalsContact C-N 3.33Å; Y48-M50 PolarHBondContact O-N 2.9Å; M50-H53 CarbonylContact O-C 3.43Å; M50-P54 WeakPolarHBondContact O-CA 3.42Å
51	R	75.6	Confident	70.7	Confident	204 Å²	204	111.7 Å²	111.7	77%	0.77	62%	0.62	S	S	*	*	H	α-helix	trans	-77.8	-36	176.8	-74.9	-163.2	177.8	152.8	1.4	113.8	I47 Y48 R49	I47-R51 WeakPolarHBondContact O-CG 3.44Å; I47-R51 PolarHBondContact O-N 2.83Å; Y48-R51 CarbonylContact O-C 3.58Å; Y48-R51 PolarHBondContact O-N 3.21Å; Y48-R51 VanDerWaalsContact O-N 3.08Å; R49-R51 VanDerWaalsContact C-N 3.3Å; R49-R51 PolarHBondContact O-N 3.1Å
52	T	75.8	Confident	70.3	Confident	63 Å²	63	113.9 Å²	113.9	39%	0.387	63%	0.629	S	S	.	*	H	α-helix	trans	-82.5	-29.5	179.5	59.5	0	0	0	0	112.6	Y48 R49 P54	Y48-T52 HydrophobicContact CD1-CG2 4.02Å; Y48-T52 HydrophobicContact CD2-CG2 4.1Å; Y48-T52 HydrophobicContact CE1-CG2 3.61Å; Y48-T52 HydrophobicContact CE2-CG2 3.7Å; Y48-T52 HydrophobicContact CG-CG2 4.25Å; Y48-T52 VanDerWaalsContact CZ-CG2 3.44Å; Y48-T52 WeakPolarHBondContact O-CG2 3.49Å; Y48-T52 PolarHBondContact O-N 3.48Å; Y48-T52 PolarHBondContact O-OG1 3.41Å; Y48-T52 VanDerWaalsContact O-OG1 3.1Å; R49-T52 WeakPolarHBondContact CA-OG1 3.47Å; R49-T52 PolarHBondContact O-N 2.77Å; R49-T52 PolarHBondContact O-OG1 2.79Å; T52-P54 VanDerWaalsContact C-CD 3.43Å; T52-P54 WeakPolarHBondContact O-CD 3.44Å
53	H	63.4	Low	69.5	Low	134 Å²	134	117.7 Å²	117.7	62%	0.62	64%	0.643	S	S	*	*			trans	-121.4	74.9	170.9	-71.8	-82.3	0	0	0	109.6	R49 M50 V55	R49-H53 WeakPolarHBondContact O-CA 3.41Å; R49-H53 WeakPolarHBondContact O-CB 3.4Å; R49-H53 PolarHBondContact O-N 2.79Å; M50-H53 CarbonylContact O-C 3.43Å; H53-V55 HydrophobicContact CB-CG2 4.11Å; H53-V55 PolarHBondContact O-N 3.48Å
54	P	60.3	Low	68.8	Low	85 Å²	85	120.6 Å²	120.6	55%	0.552	66%	0.656	S	S	*	*			trans	-73.3	66	168.1	33.6	-33.5	0	0	0	108.5	M50 T52 L56	M50-P54 WeakPolarHBondContact O-CA 3.42Å; T52-P54 VanDerWaalsContact C-CD 3.43Å; T52-P54 WeakPolarHBondContact O-CD 3.44Å; P54-L56 PolarHBondContact O-N 3.46Å
55	V	59.4	Low	67.9	Low	119 Å²	119	124.7 Å²	124.7	72%	0.721	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.3	-6	178.7	176.6	0	0	0	0	111.4	H53	H53-V55 HydrophobicContact CB-CG2 4.11Å; H53-V55 PolarHBondContact O-N 3.48Å
56	L	58.9	Low	66.9	Low	158 Å²	158	128.1 Å²	128.1	83%	0.827	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-117.1	6.6	-176.7	-88.8	126.3	0	0	0	116.1	P54	P54-L56 PolarHBondContact O-N 3.46Å
57	N	57.7	Low	65.8	Low	153 Å²	153	130.6 Å²	130.6	82%	0.818	70%	0.698	S	S	*	*	S	Bend	trans	-102.1	16.3	170.4	-142.9	90.9	0	0	0	113.9
58	G	56.4	Low	64.4	Low	73 Å²	73	134.3 Å²	134.3	75%	0.753	72%	0.719	S	S	*	*			trans	-96.9	8.9	168	0	0	0	0	0	114	V60	G58-V60 PolarHBondContact O-N 3.47Å
59	A	53.2	Low	63	Low	83 Å²	83	132.4 Å²	132.4	69%	0.686	73%	0.728	S	S	*	*			trans	-91.9	102	175.4	0	0	0	0	0	109.7
60	V	45.4	Very low	61.9	Low	218 Å²	218	129 Å²	129	100%	1.321	74%	0.735	S	S	*	*			trans	92.4	0	172.7	-174.8	0	0	0	0	115.2	G58	G58-V60 PolarHBondContact O-N 3.47Å

Retrieved 60 of 60 residues in 29 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).