Q99PI1_MOUSE Loading...

Downstream regulatory element antagonist T+ variant

AlphaFold DB , UniProt , Accession Q99PI1, Species MOUSE (Mus musculus, Mouse), Gene DREAM, Length 92 aa.

						>Q99PI1_MOUSE|Q99PI1|DREAM
MRQLPAGPSSLACSGCKAGRLVTVPFSSRDAEDQGSREGIGWQPPGRSWAHTTEQEGKHQVAKATVHPPGPDALLLNQVDPVQCCPTRLRQQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.8	Very low	43	Very low	246 Å²	246	149 Å²	149	100%	1.212	85%	0.849	S	S	*	*				0	123.1	0	-83.1	178.4	-85.8	0	0	108.5
2	R	43	Very low	43.2	Very low	258 Å²	258	142.9 Å²	142.9	97%	0.974	83%	0.83	S	S	*	*			trans	-126.7	120.6	169	-81	-176.4	167.8	175.9	-3.6	107
3	Q	48.3	Very low	43.8	Very low	186 Å²	186	141.9 Å²	141.9	87%	0.869	83%	0.834	S	S	*	*			trans	-96	134.6	-178.1	-168.9	178.5	-5.1	0	0	108.2
4	L	39.2	Very low	43.5	Very low	167 Å²	167	140.7 Å²	140.7	87%	0.874	84%	0.837	S	S	*	*			trans	-135.6	155.7	159.5	-85.6	176.7	0	0	0	108.3
5	P	38.4	Very low	43.4	Very low	110 Å²	110	135.6 Å²	135.6	71%	0.714	83%	0.825	S	S	*	*	P	Polyproline II helix		-96.2	168.9	-129.4	35.6	-37.2	0	0	0	115.1	G7	P5-G7 PolarHBondContact O-N 3.36Å
6	A	55.3	Low	43	Very low	104 Å²	104	135.6 Å²	135.6	86%	0.86	83%	0.831	S	S	*	*	P	Polyproline II helix	trans	-54.2	123.5	175.1	0	0	0	0	0	112.2
7	G	36.6	Very low	43.1	Very low	65 Å²	65	139.6 Å²	139.6	67%	0.67	83%	0.834	S	S	*	*	P	Polyproline II helix	trans	-91.8	144.9	168	0	0	0	0	0	111.1	P5	P5-G7 PolarHBondContact O-N 3.36Å
8	P	40.1	Very low	43.5	Very low	118 Å²	118	137.1 Å²	137.1	77%	0.766	83%	0.831	S	S	*	*	P	Polyproline II helix	trans	-74.2	148.4	-163.8	31.3	-36.4	0	0	0	113.7
9	S	39.9	Very low	43.6	Very low	100 Å²	100	133.3 Å²	133.3	70%	0.699	82%	0.822	S	S	*	*	S	Bend	trans	-7.9	139.6	147.4	51.4	0	0	0	0	117.8
10	S	51.8	Low	43.4	Very low	118 Å²	118	138 Å²	138	83%	0.825	82%	0.824	S	S	*	*			trans	18.1	110.7	145.5	-180	0	0	0	0	116.4
11	L	41	Very low	43.4	Very low	167 Å²	167	139 Å²	139	87%	0.874	83%	0.825	S	S	*	*			trans	-131.5	107.5	157.3	-109.2	146.3	0	0	0	109
12	A	45.2	Very low	43.4	Very low	76 Å²	76	132.2 Å²	132.2	63%	0.628	80%	0.797	S	S	*	*			trans	-60.1	145.7	163.6	0	0	0	0	0	110.5
13	C	50.3	Low	43.3	Very low	130 Å²	130	125.8 Å²	125.8	88%	0.878	79%	0.786	S	S	*	*			trans	54.7	123.4	154.8	-60.4	0	0	0	0	118.8
14	S	39.8	Very low	43.1	Very low	125 Å²	125	122.6 Å²	122.6	87%	0.874	78%	0.779	S	S	*	*			trans	-146.4	115	143.5	-164.5	0	0	0	0	109.8
15	G	41.9	Very low	43.2	Very low	64 Å²	64	120.4 Å²	120.4	66%	0.66	78%	0.775	S	S	*	*			trans	-51.1	141.1	-171.5	0	0	0	0	0	113.5	K17	G15-K17 PolarHBondContact O-N 3.48Å
16	C	37	Very low	43.4	Very low	135 Å²	135	124.2 Å²	124.2	91%	0.912	78%	0.781	S	S	*	*			trans	-51.1	112.5	159	-59.8	0	0	0	0	107	A18	C16-A18 PolarHBondContact O-N 3.31Å
17	K	45.2	Very low	42.6	Very low	204 Å²	204	123.9 Å²	123.9	89%	0.887	77%	0.772	S	S	*	*			trans	-54.5	107.6	179.3	-71.9	-169	175.9	-172.3	0	108.4	G15 G19	G15-K17 PolarHBondContact O-N 3.48Å; K17-G19 PolarHBondContact O-N 3.41Å
18	A	50	Low	43	Very low	95 Å²	95	124.8 Å²	124.8	79%	0.785	77%	0.768	S	S	*	*			trans	-55	131	161.9	0	0	0	0	0	107.1	C16 R20	C16-A18 PolarHBondContact O-N 3.31Å; A18-R20 PolarHBondContact O-N 3.39Å
19	G	45.4	Very low	43.1	Very low	64 Å²	64	129.5 Å²	129.5	66%	0.66	77%	0.771	S	S	*	*			trans	-47.7	134.4	-179.1	0	0	0	0	0	111.2	K17 L21	K17-G19 PolarHBondContact O-N 3.41Å; G19-L21 PolarHBondContact O-N 3.49Å
20	R	40.8	Very low	43.2	Very low	227 Å²	227	132.4 Å²	132.4	86%	0.857	78%	0.778	S	S	*	*			trans	-36.5	110.2	173.2	176.5	179.5	165.1	-157.6	-3.4	111.4	A18 V22	A18-R20 PolarHBondContact O-N 3.39Å; R20-V22 HydrophobicContact CG-CG2 4.4Å; R20-V22 PolarHBondContact O-N 3.27Å
21	L	42.7	Very low	42.9	Very low	160 Å²	160	131.1 Å²	131.1	84%	0.838	78%	0.775	S	S	*	*			trans	-70.3	112.5	164.4	-107.7	119.2	0	0	0	107.8	G19 T23	G19-L21 PolarHBondContact O-N 3.49Å; L21-T23 PolarHBondContact O-N 3.37Å
22	V	40.2	Very low	42.9	Very low	103 Å²	103	132 Å²	132	62%	0.624	78%	0.775	S	S	*	*			trans	-80.5	106.1	168.5	176.8	0	0	0	0	106.8	R20 V24	R20-V22 HydrophobicContact CG-CG2 4.4Å; R20-V22 PolarHBondContact O-N 3.27Å; V22-V24 PolarHBondContact O-N 3.07Å
23	T	40.5	Very low	42.9	Very low	123 Å²	123	135.6 Å²	135.6	76%	0.755	78%	0.783	S	S	*	*			trans	-80.6	114.9	172.7	-38.9	0	0	0	0	108.5	L21	L21-T23 PolarHBondContact O-N 3.37Å
24	V	44.3	Very low	42.4	Very low	119 Å²	119	136.2 Å²	136.2	72%	0.721	77%	0.773	S	S	*	*	P	Polyproline II helix	trans	-76.2	133.4	172.1	-172.1	0	0	0	0	107.9	V22 F26	V22-V24 PolarHBondContact O-N 3.07Å; V24-F26 PolarHBondContact O-N 3.34Å
25	P	40.6	Very low	42.6	Very low	121 Å²	121	134.6 Å²	134.6	79%	0.786	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-67.1	131	-178.7	26.1	-32.1	0	0	0	110.8	S27	P25-S27 PolarHBondContact O-N 2.96Å
26	F	43.9	Very low	42.6	Very low	190 Å²	190	135.2 Å²	135.2	83%	0.833	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-72	118.8	177.7	-177.9	-100.3	0	0	0	110.1	V24	V24-F26 PolarHBondContact O-N 3.34Å
27	S	37.7	Very low	43.1	Very low	97 Å²	97	140.7 Å²	140.7	68%	0.678	77%	0.772	S	S	*	*			trans	-95.1	114.4	166.7	-179.1	0	0	0	0	108.2	P25 R29	P25-S27 PolarHBondContact O-N 2.96Å; S27-R29 VanDerWaalsContact C-N 3.25Å; S27-R29 PolarHBondContact O-N 2.91Å
28	S	45.6	Very low	43	Very low	85 Å²	85	138 Å²	138	59%	0.594	76%	0.762	S	S	*	*			trans	-85.6	17.2	-175	65.7	0	0	0	0	114
29	R	40.3	Very low	42.6	Very low	216 Å²	216	137.4 Å²	137.4	82%	0.815	77%	0.766	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.4	-6.5	-160.4	-144.7	170.8	-172.9	172	1.5	116.6	S27	S27-R29 VanDerWaalsContact C-N 3.25Å; S27-R29 PolarHBondContact O-N 2.91Å
30	D	43.6	Very low	42.5	Very low	161 Å²	161	140.1 Å²	140.1	86%	0.861	76%	0.764	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.7	8.2	178.3	-63.5	-37.8	0	0	0	113.4
31	A	44.3	Very low	42.6	Very low	91 Å²	91	132.8 Å²	132.8	75%	0.752	76%	0.759	S	S	*	*	S	Bend	trans	-89.9	2.3	-174.7	0	0	0	0	0	114.8
32	E	42.7	Very low	42.5	Very low	187 Å²	187	136.2 Å²	136.2	87%	0.874	76%	0.761	S	S	*	*	S	Bend	trans	-108.4	-2.2	-171.7	-68.1	-138.8	111.3	0	0	115.9
33	D	43.6	Very low	42.9	Very low	150 Å²	150	138.3 Å²	138.3	80%	0.802	76%	0.764	S	S	*	*	S	Bend	trans	-139.8	58.5	-177.2	-154.9	35	0	0	0	114.4
34	Q	41.3	Very low	42.9	Very low	144 Å²	144	137 Å²	137	67%	0.673	76%	0.758	S	S	*	*			trans	-155.9	85.6	151.4	-115.2	178.6	71.5	0	0	112	S36	Q34-S36 PolarHBondContact O-N 2.69Å
35	G	42.8	Very low	42.8	Very low	90 Å²	90	138 Å²	138	93%	0.928	77%	0.767	S	S	*	*			trans	-66.2	79.3	157.6	0	0	0	0	0	110.3
36	S	43	Very low	43.1	Very low	78 Å²	78	136 Å²	136	55%	0.545	77%	0.768	S	S	.	*	S	Bend	trans	-176.2	96.2	159.5	173.5	0	0	0	0	108.9	Q34 E38	Q34-S36 PolarHBondContact O-N 2.69Å; S36-E38 PolarHBondContact O-N 2.9Å
37	R	46.8	Very low	43.1	Very low	249 Å²	249	137.1 Å²	137.1	94%	0.94	77%	0.767	S	S	*	*	S	Bend	trans	34.4	27.7	144.6	-142.1	-173.2	-173.7	-152.1	0.8	121
38	E	42.9	Very low	43.5	Very low	147 Å²	147	138 Å²	138	69%	0.687	77%	0.773	S	S	*	*			trans	-131.8	88.4	174.7	-86.9	159	-171.1	0	0	108	S36 I40	S36-E38 PolarHBondContact O-N 2.9Å; E38-I40 PolarHBondContact O-N 2.96Å
39	G	42.5	Very low	43.6	Very low	83 Å²	83	144.5 Å²	144.5	86%	0.856	78%	0.784	S	S	*	*			trans	-63.4	103.1	168.3	0	0	0	0	0	107.9	G41	G39-G41 PolarHBondContact O-N 3.2Å
40	I	41.7	Very low	43.8	Very low	122 Å²	122	137.9 Å²	137.9	63%	0.626	78%	0.776	S	S	*	*			trans	-68.6	85.6	174.7	-53.2	177.5	0	0	0	107.4	E38 W42	E38-I40 PolarHBondContact O-N 2.96Å; I40-W42 PolarHBondContact O-N 2.79Å
41	G	44.4	Very low	43.8	Very low	73 Å²	73	136.6 Å²	136.6	75%	0.753	77%	0.765	S	S	*	*			trans	-74.2	100	172	0	0	0	0	0	109.3	G39	G39-G41 PolarHBondContact O-N 3.2Å
42	W	40.1	Very low	43.7	Very low	231 Å²	231	136.9 Å²	136.9	88%	0.875	76%	0.757	S	S	*	*			trans	-77.3	125.3	166.2	-71.9	97.7	0	0	0	109.5	I40	I40-W42 PolarHBondContact O-N 2.79Å
43	Q	47.7	Very low	43.8	Very low	147 Å²	147	133.9 Å²	133.9	69%	0.687	75%	0.752	S	S	*	*			trans	-126.1	151	170.4	-108	-161.9	-8.9	0	0	112.4
44	P	40.7	Very low	43.6	Very low	97 Å²	97	135.1 Å²	135.1	63%	0.63	75%	0.753	S	S	*	*			trans	-70	155.3	-172.5	29.2	-33.6	0	0	0	112.8	G46	P44-G46 PolarHBondContact O-N 3.37Å
45	P	42.1	Very low	43.8	Very low	139 Å²	139	134.7 Å²	134.7	90%	0.903	75%	0.751	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.2	129.1	-175.7	25.1	-32.4	0	0	0	111.3
46	G	46.7	Very low	43.7	Very low	80 Å²	80	139.3 Å²	139.3	83%	0.825	75%	0.748	S	S	*	*	T	Hydrogen-bonded Turn	trans	122.8	9.6	171.3	0	0	0	0	0	117.1	P44	P44-G46 PolarHBondContact O-N 3.37Å
47	R	45	Very low	44.1	Very low	213 Å²	213	138 Å²	138	80%	0.804	75%	0.748	S	S	*	*			trans	-125.5	139.2	172.4	-71.9	-174.1	177.9	-117.5	-0.1	111.9
48	S	45.3	Very low	44.1	Very low	114 Å²	114	135.8 Å²	135.8	80%	0.797	75%	0.745	S	S	*	*			trans	-68	147.8	175.4	18.2	0	0	0	0	111.4	A50	S48-A50 PolarHBondContact O-N 3.03Å; S48-A50 VanDerWaalsContact O-N 3.12Å
49	W	48.9	Very low	44.1	Very low	222 Å²	222	136 Å²	136	84%	0.841	75%	0.745	S	S	*	*			trans	-48.7	115	178.9	-83.9	23.1	0	0	0	111.5	H51	W49-H51 AromaticContact CE3-CE1 3.22Å; W49-H51 AromaticContact CE3-NE2 3.18Å; W49-H51 AromaticContact CZ3-CE1 3.33Å; W49-H51 WeakPolarHBondContact CZ3-CE1 3.33Å; W49-H51 AromaticContact CZ3-NE2 3.59Å
50	A	44.8	Very low	44.2	Very low	78 Å²	78	139.3 Å²	139.3	65%	0.645	74%	0.738	S	S	*	*			trans	-95.4	98	162.8	0	0	0	0	0	107.4	S48 T52	S48-A50 PolarHBondContact O-N 3.03Å; S48-A50 VanDerWaalsContact O-N 3.12Å; A50-T52 PolarHBondContact O-N 3.12Å
51	H	41.7	Very low	44.4	Very low	133 Å²	133	139.1 Å²	139.1	62%	0.616	74%	0.743	S	S	*	*			trans	-69.4	96.8	165.1	-71.1	-66.8	0	0	0	108.5	W49 T53	W49-H51 AromaticContact CE3-CE1 3.22Å; W49-H51 AromaticContact CE3-NE2 3.18Å; W49-H51 AromaticContact CZ3-CE1 3.33Å; W49-H51 WeakPolarHBondContact CZ3-CE1 3.33Å; W49-H51 AromaticContact CZ3-NE2 3.59Å; H51-T53 PolarHBondContact O-N 3.22Å
52	T	42.2	Very low	44.7	Very low	98 Å²	98	139.1 Å²	139.1	60%	0.601	74%	0.736	S	S	*	*			trans	-83.2	88	166.5	45.6	0	0	0	0	108.7	A50 A62	A50-T52 PolarHBondContact O-N 3.12Å; T52-A62 HydrophobicContact CG2-CB 4Å
53	T	46.8	Very low	44.8	Very low	123 Å²	123	137.4 Å²	137.4	76%	0.755	73%	0.734	S	S	*	*			trans	-132.7	92	165.3	47.4	0	0	0	0	109.4	H51	H51-T53 PolarHBondContact O-N 3.22Å
54	E	38.9	Very low	44.8	Very low	176 Å²	176	134.5 Å²	134.5	82%	0.822	74%	0.735	S	S	*	*				-178.8	121.3	115.6	-130.1	172	160.1	0	0	107.8	E56	E54-E56 PolarHBondContact O-N 3.39Å
55	Q	45.3	Very low	45.1	Very low	136 Å²	136	135.6 Å²	135.6	64%	0.636	74%	0.741	S	S	*	*			trans	-89.8	102.2	174.2	-177.9	-177.5	4.2	0	0	108	G57 Q60	Q55-G57 PolarHBondContact NE2-O 3.38Å; Q55-G57 WeakPolarHBondContact CG-O 3.44Å; Q55-Q60 HydrophobicContact CG-CG 4.27Å
56	E	41.3	Very low	45.4	Very low	186 Å²	186	135.5 Å²	135.5	87%	0.869	74%	0.737	S	S	*	*			trans	-100.6	99.5	168.2	-144.8	-177.5	178.3	0	0	109	E54	E54-E56 PolarHBondContact O-N 3.39Å
57	G	50.2	Low	45.6	Very low	52 Å²	52	139.1 Å²	139.1	54%	0.536	73%	0.732	S	S	.	*	S	Bend	trans	82.1	-168.6	179.1	0	0	0	0	0	116.4	Q55 H59	Q55-G57 PolarHBondContact NE2-O 3.38Å; Q55-G57 WeakPolarHBondContact CG-O 3.44Å; G57-H59 PolarHBondContact O-N 3.15Å; G57-H59 VanDerWaalsContact O-N 3.15Å
58	K	46.2	Very low	45.9	Very low	201 Å²	201	134.3 Å²	134.3	87%	0.874	73%	0.729	S	S	*	*	S	Bend	trans	-69	-4.8	-175.5	-73.7	-173.1	178.9	-178.2	0	114.7
59	H	44.8	Very low	46.8	Very low	152 Å²	152	133.3 Å²	133.3	70%	0.704	72%	0.719	S	S	*	*	S	Bend	trans	-124.9	118.2	-178.4	-65.3	91.6	0	0	0	109.1	G57 V61	G57-H59 PolarHBondContact O-N 3.15Å; G57-H59 VanDerWaalsContact O-N 3.15Å; H59-V61 PolarHBondContact O-N 3.06Å
60	Q	44.1	Very low	47.1	Very low	152 Å²	152	124.9 Å²	124.9	71%	0.71	70%	0.702	S	S	*	*			trans	-74.9	116.9	174.6	-69.5	-178.9	6.5	0	0	109	Q55	Q55-Q60 HydrophobicContact CG-CG 4.27Å
61	V	45.3	Very low	47.5	Very low	119 Å²	119	127.5 Å²	127.5	72%	0.721	71%	0.712	S	S	*	*			trans	-105.8	102.5	170.3	-175.9	0	0	0	0	107.5	H59 K63	H59-V61 PolarHBondContact O-N 3.06Å; V61-K63 PolarHBondContact O-N 3.14Å; V61-K63 VanDerWaalsContact O-N 3.16Å
62	A	50.5	Low	48.1	Very low	73 Å²	73	128.4 Å²	128.4	60%	0.603	72%	0.721	S	S	*	*			trans	-72.9	105.4	175.8	0	0	0	0	0	109.6	T52 A64	T52-A62 HydrophobicContact CG2-CB 4Å; A62-A64 PolarHBondContact O-N 3.09Å
63	K	41.5	Very low	48.8	Very low	194 Å²	194	126 Å²	126	84%	0.843	71%	0.712	S	S	*	*			trans	-83.5	99.3	172.5	-162.4	178.2	-175.4	-179.5	0	108.8	V61	V61-K63 PolarHBondContact O-N 3.14Å; V61-K63 VanDerWaalsContact O-N 3.16Å
64	A	49	Very low	48.9	Very low	86 Å²	86	127.7 Å²	127.7	71%	0.711	72%	0.715	S	S	*	*			trans	-82.6	115.4	177.9	0	0	0	0	0	110.7	A62	A62-A64 PolarHBondContact O-N 3.09Å
65	T	45.8	Very low	49.8	Very low	121 Å²	121	125.3 Å²	125.3	74%	0.742	71%	0.707	S	S	*	*	P	Polyproline II helix	trans	-85.7	117.3	162.9	22.4	0	0	0	0	109.3
66	V	50.3	Low	50.1	Low	136 Å²	136	126.3 Å²	126.3	82%	0.824	72%	0.717	S	S	*	*	P	Polyproline II helix	trans	-89.3	120.8	179.5	-179.1	0	0	0	0	108.9
67	H	49.2	Very low	50.7	Low	156 Å²	156	124.7 Å²	124.7	72%	0.722	71%	0.714	S	S	*	*	P	Polyproline II helix	trans	-92.2	140.9	170.2	-65.9	-80.8	0	0	0	110.2
68	P	52.4	Low	50.8	Low	113 Å²	113	130.6 Å²	130.6	73%	0.734	73%	0.727	S	S	*	*	P	Polyproline II helix	trans	-66.5	147.5	176.9	28.1	-33.1	0	0	0	110.6
69	P	64.8	Low	50.8	Low	92 Å²	92	126.6 Å²	126.6	60%	0.597	72%	0.719	S	S	*	*	P	Polyproline II helix	trans	-63.1	142.9	177.6	25	-31.6	0	0	0	111.4	A73	P69-A73 HydrophobicContact CB-CB 3.54Å
70	G	55.1	Low	50.9	Low	46 Å²	46	125.8 Å²	125.8	47%	0.474	72%	0.72	S	S	.	*	P	Polyproline II helix	trans	-69.1	169.5	175.7	0	0	0	0	0	113.1	D72 A73	G70-D72 PolarHBondContact O-N 3.16Å; G70-D72 VanDerWaalsContact O-N 3.14Å; G70-A73 WeakPolarHBondContact O-CB 3.21Å; G70-A73 PolarHBondContact O-N 3.27Å
71	P	52.3	Low	51.3	Low	132 Å²	132	124 Å²	124	86%	0.857	72%	0.722	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.6	-28.2	-171.8	23.7	-33.6	0	0	0	114
72	D	54.1	Low	51.4	Low	152 Å²	152	124.8 Å²	124.8	81%	0.813	73%	0.727	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.5	7.8	-179.3	-53.9	-51.4	0	0	0	113.4	G70 L74	G70-D72 PolarHBondContact O-N 3.16Å; G70-D72 VanDerWaalsContact O-N 3.14Å; D72-L74 PolarHBondContact O-N 3.48Å
73	A	57.1	Low	51.2	Low	48 Å²	48	129.8 Å²	129.8	40%	0.397	74%	0.737	S	S	.	*			trans	-74	101.9	179	0	0	0	0	0	110.5	P69 G70 L75	P69-A73 HydrophobicContact CB-CB 3.54Å; G70-A73 WeakPolarHBondContact O-CB 3.21Å; G70-A73 PolarHBondContact O-N 3.27Å; A73-L75 PolarHBondContact O-N 2.72Å
74	L	48.1	Very low	51.2	Low	159 Å²	159	126.6 Å²	126.6	83%	0.832	74%	0.738	S	S	*	*			trans	-69.8	109.4	168.3	-65.3	174.4	0	0	0	109.5	D72 L76	D72-L74 PolarHBondContact O-N 3.48Å; L74-L76 VanDerWaalsContact O-N 3.14Å; L74-L76 PolarHBondContact O-N 3.4Å
75	L	57.8	Low	51.2	Low	125 Å²	125	128.2 Å²	128.2	65%	0.654	74%	0.743	S	S	*	*			trans	-72.6	101.7	174.2	-66.7	170.7	0	0	0	109.6	A73 N77	A73-L75 PolarHBondContact O-N 2.72Å; L75-N77 PolarHBondContact O-N 3.23Å; L75-N77 VanDerWaalsContact O-N 3.09Å
76	L	53.1	Low	51.1	Low	158 Å²	158	128.2 Å²	128.2	83%	0.827	75%	0.745	S	S	*	*			trans	-71.1	5.8	179.1	-81	158.7	0	0	0	114.9	L74	L74-L76 VanDerWaalsContact O-N 3.14Å; L74-L76 PolarHBondContact O-N 3.4Å
77	N	53.5	Low	50.9	Low	152 Å²	152	127.6 Å²	127.6	81%	0.813	74%	0.742	S	S	*	*			trans	-116.2	40.5	-175.2	-72.1	-26.4	0	0	0	113.6	L75 V79	L75-N77 PolarHBondContact O-N 3.23Å; L75-N77 VanDerWaalsContact O-N 3.09Å; N77-V79 VanDerWaalsContact C-N 3.34Å
78	Q	51.5	Low	50.6	Low	176 Å²	176	131.8 Å²	131.8	82%	0.822	75%	0.751	S	S	*	*			trans	-104.8	54.3	156.4	-65.2	-163	73	0	0	109.3	D80	Q78-D80 PolarHBondContact O-N 3.03Å
79	V	46.5	Very low	50.3	Low	116 Å²	116	133.7 Å²	133.7	70%	0.703	76%	0.755	S	S	*	*			trans	-71.5	108.2	150.6	-174.8	0	0	0	0	103.7	N77	N77-V79 VanDerWaalsContact C-N 3.34Å
80	D	48.2	Very low	49.1	Very low	135 Å²	135	140.6 Å²	140.6	72%	0.722	77%	0.769	S	S	*	*			trans	-40.5	130.2	169.7	-111.7	-36.7	0	0	0	107.9	Q78 V82	Q78-D80 PolarHBondContact O-N 3.03Å; D80-V82 VanDerWaalsContact C-N 3.26Å; D80-V82 PolarHBondContact O-N 3.14Å
81	P	51.1	Low	48.5	Very low	116 Å²	116	147.2 Å²	147.2	75%	0.753	79%	0.787	S	S	*	*			trans	-57.6	103.2	169.3	24	-29.9	0	0	0	105.8	Q83	P81-Q83 PolarHBondContact O-N 3.31Å
82	V	48.9	Very low	48.1	Very low	134 Å²	134	153.8 Å²	153.8	81%	0.812	81%	0.807	S	S	*	*			trans	-51.7	112.9	176.2	175.3	0	0	0	0	105	D80 C84	D80-V82 VanDerWaalsContact C-N 3.26Å; D80-V82 PolarHBondContact O-N 3.14Å; V82-C84 PolarHBondContact O-N 3.18Å
83	Q	45.5	Very low	47.8	Very low	178 Å²	178	153.9 Å²	153.9	83%	0.832	81%	0.806	S	S	*	*			trans	-36.1	131.5	-174.9	-83.9	163.5	-31.3	0	0	111	P81 C85	P81-Q83 PolarHBondContact O-N 3.31Å; Q83-C85 PolarHBondContact O-N 2.84Å
84	C	42.2	Very low	47.3	Very low	127 Å²	127	159.5 Å²	159.5	86%	0.858	83%	0.828	S	S	*	*	S	Bend	trans	-29.2	126.3	154.4	-77.7	0	0	0	0	109.9	V82	V82-C84 PolarHBondContact O-N 3.18Å
85	C	48.8	Very low	47.2	Very low	121 Å²	121	159.5 Å²	159.5	82%	0.818	83%	0.828	S	S	*	*	S	Bend	trans	-37.6	138.3	179.7	-66.4	0	0	0	0	112.2	Q83 T87	Q83-C85 PolarHBondContact O-N 2.84Å; C85-T87 PolarHBondContact O-N 3.35Å
86	P	42.7	Very low	46.6	Very low	121 Å²	121	161.5 Å²	161.5	79%	0.786	84%	0.838	S	S	*	*			trans	-59.4	132.5	-170.3	23.4	-33.3	0	0	0	111.2	R88	P86-R88 PolarHBondContact O-N 2.75Å; P86-R88 VanDerWaalsContact O-N 3.08Å
87	T	46.1	Very low	46.2	Very low	123 Å²	123	161.8 Å²	161.8	76%	0.755	84%	0.839	S	S	*	*			trans	-36	115.3	157.1	-47.3	0	0	0	0	108.5	C85 L89	C85-T87 PolarHBondContact O-N 3.35Å; T87-L89 PolarHBondContact O-N 3.08Å
88	R	44	Very low	45.7	Very low	243 Å²	243	162.4 Å²	162.4	92%	0.917	84%	0.84	S	S	*	*			trans	-66.9	81.5	169.3	-72.1	-167.7	-169.6	-151.3	4.4	108.2	P86 R90	P86-R88 PolarHBondContact O-N 2.75Å; P86-R88 VanDerWaalsContact O-N 3.08Å; R88-R90 PolarHBondContact O-N 3.18Å
89	L	46.2	Very low	45.3	Very low	154 Å²	154	161.4 Å²	161.4	81%	0.806	84%	0.842	S	S	*	*			trans	-76.1	87.5	151.7	-87.6	165.3	0	0	0	106.8	T87	T87-L89 PolarHBondContact O-N 3.08Å
90	R	39	Very low	45.2	Very low	237 Å²	237	164.9 Å²	164.9	89%	0.894	85%	0.852	S	S	*	*			trans	-124.1	112.5	146	-78.5	-145.6	176.4	-164.5	1	108.7	R88 Q92	R88-R90 PolarHBondContact O-N 3.18Å; R90-Q92 PolarHBondContact O-N 3.43Å
91	Q	42.6	Very low	44.9	Very low	185 Å²	185	167.4 Å²	167.4	86%	0.864	86%	0.863	S	S	*	*			trans	-47.1	123.1	156.3	-63.3	176	-7.4	0	0	109.2
92	Q	42.2	Very low	44.4	Very low	270 Å²	270	172.1 Å²	172.1	100%	1.262	87%	0.873	S	S	*	*			trans	-166.1	0	133.9	-101.8	176.3	15.2	0	0	107.9	R90	R90-Q92 PolarHBondContact O-N 3.43Å

Retrieved 92 of 92 residues in 17.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).