RRBP1_MOUSE Loading...

Isoform RRp61 of Ribosome-binding protein 1 AlphaSync

Canonical isoform description: Acts as a ribosome receptor and mediates interaction between the ribosome and the endoplasmic reticulum membrane.

AlphaFold DB , UniProt , Accession Q99PL5-2 (canonical: Q99PL5), Species MOUSE (Mus musculus, Mouse), Gene Rrbp1, Length 842 aa.

						>RRBP1_MOUSE|Q99PL5-2|Rrbp1
MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKGEKKKKEKTVEKKGKTKKKEEKPNGKIPEHDLDPNVTIILKEPVRVSAVAVAPTSVHSSVGHTPIATVPAMPQEKLASSPKDRKKKEKKVAKVEPAVSSIVNSIQVLASKSAILEATPKEVPMVAVPPVGSKASSPATSSQGKKGQGAQNQAKKGEGAQNQGKKGEGAQNQAKKGEGAQNQAKKGEGAQNQGKKGEGAQNQAKKGEGGQNQAKKGEGAQNQGKKGEGAQNQGKKGEGAQNQAKKGEGAQNQAKKGEGAQNQGKKGEGAQNQSKKGEGAQNQAKKGEGGQNQAKKGEGAQNQAKKGEGAQNQAKKGEGVQNQAKKGVEGAQNQGKKGEANQNQAKKGEGGQNQTKKGEGPQNQGKKGEAAQKQDKKIEGAQNQGKKPEGTSNQGKKGEGAQNQGKKGEGAQNQSKKGEGAQNQAKKGEGGQNQAKKGEGAQNQAKKGEGAQNQAKKGEGVQNQAKKGVEGAQNQGKKGEANQNQAKKGEGGQNQTKKGEGPQNQGKKGEAAQKQDKKIEGAQNQGKKPEGTSNQGKKGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKGEGPQNQAKKGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKAEGVQSQSKKGEGTQNQGKKGDGNPNQGKKGEGASNQNRKTDTVANQGTKQEGVSNQVKKSEGSPNQGKKAEGAPNQGKKKDGSPSQAKKVDAAANQGKKSEMAPAQGQKASMVQSQEAPKQDAPAKKKSGSRKKGEPVC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.6	Very low	66.5	Low	219 Å²	219	123.5 Å²	123.5	100%	1.079	65%	0.649	S	S	*	*				0	100.9	0	-97	58.5	-178.8	0	0	108	I3	M1-I3 PolarHBondContact O-N 2.92Å
2	D	53	Low	67.7	Low	139 Å²	139	121.9 Å²	121.9	74%	0.743	65%	0.648	S	S	*	*			trans	-82.7	106.6	-170.4	-59.7	-85.2	0	0	0	110.4	Y4	D2-Y4 PolarHBondContact O-N 3.38Å
3	I	57.8	Low	68.9	Low	143 Å²	143	120.2 Å²	120.2	73%	0.733	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.3	3	179.3	-35.6	-178.8	0	0	0	111.4	M1	M1-I3 PolarHBondContact O-N 2.92Å
4	Y	65.9	Low	69.9	Low	210 Å²	210	121.6 Å²	121.6	82%	0.824	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-119.1	8.1	-173.5	-74.7	-79.3	0	0	0	114.2	D2 T6	D2-Y4 PolarHBondContact O-N 3.38Å; Y4-T6 PolarHBondContact O-N 3.14Å
5	D	68.8	Low	70.9	Confident	63 Å²	63	115.9 Å²	115.9	34%	0.337	62%	0.624	S	S	.	*			trans	-62.4	128.7	166.9	152.5	54.7	0	0	0	110.3	Q7 T8 L9	D5-Q7 PolarHBondContact O-N 3.27Å; D5-Q7 PolarHBondContact OD1-N 2.87Å; D5-Q7 WeakPolarHBondContact OD2-CB 3.38Å; D5-Q7 PolarHBondContact OD2-N 2.98Å; D5-T8 WeakPolarHBondContact CB-OG1 3.03Å; D5-T8 PolarHBondContact O-N 2.82Å; D5-T8 PolarHBondContact O-OG1 3.27Å; D5-T8 WeakPolarHBondContact OD2-CB 3.27Å; D5-T8 WeakPolarHBondContact OD2-CG2 3.26Å; D5-T8 PolarHBondContact OD2-N 2.89Å; D5-T8 PolarHBondContact OD2-OG1 3.12Å; D5-L9 WeakPolarHBondContact O-CB 3.37Å; D5-L9 PolarHBondContact O-N 2.97Å
6	T	67.2	Low	71.9	Confident	119 Å²	119	110.9 Å²	110.9	73%	0.73	61%	0.609	S	S	*	*	H	α-helix	trans	-62.9	-26.8	-177.2	-37.2	0	0	0	0	112.5	Y4 G10	Y4-T6 PolarHBondContact O-N 3.14Å; T6-G10 PolarHBondContact O-N 3.08Å
7	Q	71.4	Confident	72.9	Confident	157 Å²	157	112.4 Å²	112.4	73%	0.734	61%	0.608	S	S	*	*	H	α-helix	trans	-73.8	-50.7	177.4	-56.9	-167.9	22.8	0	0	111.5	D5 L9 G10 V11	D5-Q7 PolarHBondContact O-N 3.27Å; D5-Q7 PolarHBondContact OD1-N 2.87Å; D5-Q7 WeakPolarHBondContact OD2-CB 3.38Å; D5-Q7 PolarHBondContact OD2-N 2.98Å; Q7-L9 PolarHBondContact O-N 3.32Å; Q7-G10 WeakPolarHBondContact O-CA 3.43Å; Q7-G10 PolarHBondContact O-N 2.84Å; Q7-G10 VanDerWaalsContact O-N 3.12Å; Q7-V11 WeakPolarHBondContact O-CG2 3.4Å; Q7-V11 PolarHBondContact O-N 2.91Å
8	T	71.7	Confident	73.9	Confident	70 Å²	70	113.1 Å²	113.1	43%	0.429	61%	0.608	S	S	.	*	H	α-helix	trans	-61.9	-40.7	175.4	43.7	0	0	0	0	112	D5 G10 V11 V12	D5-T8 WeakPolarHBondContact CB-OG1 3.03Å; D5-T8 PolarHBondContact O-N 2.82Å; D5-T8 PolarHBondContact O-OG1 3.27Å; D5-T8 WeakPolarHBondContact OD2-CB 3.27Å; D5-T8 WeakPolarHBondContact OD2-CG2 3.26Å; D5-T8 PolarHBondContact OD2-N 2.89Å; D5-T8 PolarHBondContact OD2-OG1 3.12Å; T8-G10 VanDerWaalsContact C-N 3.3Å; T8-G10 PolarHBondContact O-N 3.39Å; T8-V11 PolarHBondContact O-N 2.69Å; T8-V12 WeakPolarHBondContact O-CG2 3.34Å; T8-V12 PolarHBondContact O-N 2.94Å
9	L	74.9	Confident	74.8	Confident	94 Å²	94	111.7 Å²	111.7	49%	0.492	60%	0.604	S	S	.	*	H	α-helix	trans	-59.4	-41.8	171.9	-168.2	72.2	0	0	0	111.6	D5 Q7 V12 V13	D5-L9 WeakPolarHBondContact O-CB 3.37Å; D5-L9 PolarHBondContact O-N 2.97Å; Q7-L9 PolarHBondContact O-N 3.32Å; L9-V12 PolarHBondContact O-N 3.31Å; L9-V13 WeakPolarHBondContact O-CG2 3.4Å; L9-V13 PolarHBondContact O-N 3.31Å
10	G	74.2	Confident	75.6	Confident	38 Å²	38	111.2 Å²	111.2	39%	0.392	61%	0.605	S	S	.	*	H	α-helix	trans	-59.7	-45.2	173.3	0	0	0	0	0	113	T6 Q7 T8 V13 F14	T6-G10 PolarHBondContact O-N 3.08Å; Q7-G10 WeakPolarHBondContact O-CA 3.43Å; Q7-G10 PolarHBondContact O-N 2.84Å; Q7-G10 VanDerWaalsContact O-N 3.12Å; T8-G10 VanDerWaalsContact C-N 3.3Å; T8-G10 PolarHBondContact O-N 3.39Å; G10-V13 PolarHBondContact O-N 3.07Å; G10-F14 VanDerWaalsContact O-CB 3.31Å; G10-F14 WeakPolarHBondContact O-CB 3.48Å; G10-F14 PolarHBondContact O-N 2.76Å
11	V	78.1	Confident	76.3	Confident	106 Å²	106	107.8 Å²	107.8	64%	0.642	59%	0.589	S	S	*	*	H	α-helix	trans	-63.7	-42.4	176.8	173	0	0	0	0	111.5	Q7 T8 G15	Q7-V11 WeakPolarHBondContact O-CG2 3.4Å; Q7-V11 PolarHBondContact O-N 2.91Å; T8-V11 PolarHBondContact O-N 2.69Å; V11-G15 WeakPolarHBondContact O-CA 3.49Å; V11-G15 PolarHBondContact O-N 2.55Å
12	V	81.3	Confident	78.4	Confident	105 Å²	105	100 Å²	100	64%	0.636	56%	0.56	S	S	*	*	H	α-helix	trans	-63.4	-46.7	177.4	170.7	0	0	0	0	111.2	T8 L9 G16	T8-V12 WeakPolarHBondContact O-CG2 3.34Å; T8-V12 PolarHBondContact O-N 2.94Å; L9-V12 PolarHBondContact O-N 3.31Å; V12-G16 PolarHBondContact O-N 3.39Å
13	V	83.2	Confident	80.2	Confident	99 Å²	99	98 Å²	98	60%	0.6	55%	0.548	S	S	*	.	H	α-helix	trans	-66	-45	179.1	172.3	0	0	0	0	111.5	L9 G10 F17	L9-V13 WeakPolarHBondContact O-CG2 3.4Å; L9-V13 PolarHBondContact O-N 3.31Å; G10-V13 PolarHBondContact O-N 3.07Å; V13-F17 WeakPolarHBondContact O-CB 3.34Å; V13-F17 PolarHBondContact O-N 2.97Å
14	F	82	Confident	81.8	Confident	140 Å²	140	92.7 Å²	92.7	61%	0.614	53%	0.528	S	S	*	.	H	α-helix	trans	-73.4	-38	-177.4	-145.7	-86.8	0	0	0	112.3	G10 F17 M18	G10-F14 VanDerWaalsContact O-CB 3.31Å; G10-F14 WeakPolarHBondContact O-CB 3.48Å; G10-F14 PolarHBondContact O-N 2.76Å; F14-F17 PolarHBondContact O-N 3.25Å; F14-M18 HydrophobicContact CE1-CE 4.35Å; F14-M18 PolarHBondContact O-N 2.89Å
15	G	85.3	Confident	82.9	Confident	36 Å²	36	88.1 Å²	88.1	37%	0.371	52%	0.517	S	S	.	.	H	α-helix	trans	-64.9	-46.9	173	0	0	0	0	0	112.1	V11 F17 M18 V19	V11-G15 WeakPolarHBondContact O-CA 3.49Å; V11-G15 PolarHBondContact O-N 2.55Å; G15-F17 VanDerWaalsContact C-N 3.34Å; G15-F17 PolarHBondContact O-N 2.84Å; G15-M18 PolarHBondContact O-N 3.09Å; G15-M18 VanDerWaalsContact O-N 3.15Å; G15-V19 WeakPolarHBondContact O-CG2 3.36Å; G15-V19 PolarHBondContact O-N 2.82Å
16	G	86.4	Confident	83.7	Confident	37 Å²	37	92 Å²	92	38%	0.381	53%	0.531	S	S	.	.	H	α-helix	trans	-58.8	-43.9	173.9	0	0	0	0	0	112.4	V12 M18 V19 V20	V12-G16 PolarHBondContact O-N 3.39Å; G16-M18 PolarHBondContact O-N 2.97Å; G16-V19 PolarHBondContact O-N 3.31Å; G16-V20 WeakPolarHBondContact O-CG2 3.19Å; G16-V20 PolarHBondContact O-N 3.05Å
17	F	89.1	Confident	84.6	Confident	136 Å²	136	91.6 Å²	91.6	60%	0.596	52%	0.524	S	S	*	.	H	α-helix	trans	-62.5	-38.7	174.5	-177	-99.3	0	0	0	112.7	V13 F14 G15 S21	V13-F17 WeakPolarHBondContact O-CB 3.34Å; V13-F17 PolarHBondContact O-N 2.97Å; F14-F17 PolarHBondContact O-N 3.25Å; G15-F17 VanDerWaalsContact C-N 3.34Å; G15-F17 PolarHBondContact O-N 2.84Å; F17-S21 WeakPolarHBondContact CE1-OG 3.31Å; F17-S21 WeakPolarHBondContact O-CB 3.44Å; F17-S21 PolarHBondContact O-N 3.36Å; F17-S21 PolarHBondContact O-OG 3.33Å
18	M	92	Very high	85	Confident	124 Å²	124	88.7 Å²	88.7	61%	0.611	52%	0.517	S	S	*	.	H	α-helix	trans	-65.1	-42.2	173.6	-85.1	-155.2	164.6	0	0	112.7	F14 G15 G16 S21 A22	F14-M18 HydrophobicContact CE1-CE 4.35Å; F14-M18 PolarHBondContact O-N 2.89Å; G15-M18 PolarHBondContact O-N 3.09Å; G15-M18 VanDerWaalsContact O-N 3.15Å; G16-M18 PolarHBondContact O-N 2.97Å; M18-S21 PolarHBondContact O-N 2.91Å; M18-A22 WeakPolarHBondContact O-CB 3Å; M18-A22 PolarHBondContact O-N 2.82Å
19	V	90.5	Very high	85.1	Confident	88 Å²	88	87.9 Å²	87.9	53%	0.533	51%	0.514	S	S	.	.	H	α-helix	trans	-63.6	-47.8	177.4	173	0	0	0	0	111	G15 G16 S21 A22 I23	G15-V19 WeakPolarHBondContact O-CG2 3.36Å; G15-V19 PolarHBondContact O-N 2.82Å; G16-V19 PolarHBondContact O-N 3.31Å; V19-S21 VanDerWaalsContact C-N 3.31Å; V19-S21 PolarHBondContact O-N 2.83Å; V19-A22 PolarHBondContact O-N 3Å; V19-I23 HydrophobicContact CG1-CD1 3.9Å; V19-I23 WeakPolarHBondContact O-CG1 3.43Å; V19-I23 PolarHBondContact O-N 2.91Å
20	V	91.6	Very high	85.3	Confident	101 Å²	101	86.8 Å²	86.8	61%	0.612	51%	0.512	S	S	*	.	H	α-helix	trans	-62.2	-39.7	176.3	174.1	0	0	0	0	111.2	G16 G24	G16-V20 WeakPolarHBondContact O-CG2 3.19Å; G16-V20 PolarHBondContact O-N 3.05Å; V20-G24 PolarHBondContact O-N 2.92Å
21	S	90.3	Very high	85	Confident	39 Å²	39	91.7 Å²	91.7	27%	0.273	52%	0.522	S	S	.	.	H	α-helix	trans	-64.8	-42	175.5	-63.3	0	0	0	0	112.2	F17 M18 V19 G24 I25	F17-S21 WeakPolarHBondContact CE1-OG 3.31Å; F17-S21 WeakPolarHBondContact O-CB 3.44Å; F17-S21 PolarHBondContact O-N 3.36Å; F17-S21 PolarHBondContact O-OG 3.33Å; M18-S21 PolarHBondContact O-N 2.91Å; V19-S21 VanDerWaalsContact C-N 3.31Å; V19-S21 PolarHBondContact O-N 2.83Å; S21-G24 PolarHBondContact O-N 3.44Å; S21-I25 WeakPolarHBondContact O-CB 3.21Å; S21-I25 VanDerWaalsContact O-CG1 3.24Å; S21-I25 WeakPolarHBondContact O-CG1 3.4Å; S21-I25 PolarHBondContact O-N 2.98Å
22	A	91.2	Very high	84.5	Confident	57 Å²	57	89.9 Å²	89.9	47%	0.471	51%	0.514	S	S	.	.	H	α-helix	trans	-63.8	-44.6	177.4	0	0	0	0	0	111.7	M18 V19 I25 F26	M18-A22 WeakPolarHBondContact O-CB 3Å; M18-A22 PolarHBondContact O-N 2.82Å; V19-A22 PolarHBondContact O-N 3Å; A22-I25 PolarHBondContact O-N 2.86Å; A22-F26 WeakPolarHBondContact O-CB 3.36Å; A22-F26 PolarHBondContact O-N 3.01Å
23	I	91.8	Very high	83.6	Confident	95 Å²	95	91.4 Å²	91.4	49%	0.487	52%	0.516	S	S	.	.	H	α-helix	trans	-62	-44.3	174.4	-65.9	166.3	0	0	0	110.5	V19 I25 F26 L27	V19-I23 HydrophobicContact CG1-CD1 3.9Å; V19-I23 WeakPolarHBondContact O-CG1 3.43Å; V19-I23 PolarHBondContact O-N 2.91Å; I23-I25 PolarHBondContact O-N 2.92Å; I23-F26 PolarHBondContact O-N 2.89Å; I23-L27 HydrophobicContact CG2-CD1 3.96Å; I23-L27 HydrophobicContact CG2-CG 4.38Å; I23-L27 WeakPolarHBondContact O-CB 2.96Å; I23-L27 WeakPolarHBondContact O-CG 3.29Å; I23-L27 PolarHBondContact O-N 2.83Å
24	G	91.6	Very high	82.3	Confident	32 Å²	32	94.5 Å²	94.5	33%	0.33	52%	0.521	S	S	.	.	H	α-helix	trans	-60.6	-44.6	176.6	0	0	0	0	0	113.2	V20 S21 V28	V20-G24 PolarHBondContact O-N 2.92Å; S21-G24 PolarHBondContact O-N 3.44Å; G24-V28 WeakPolarHBondContact O-CB 3.32Å; G24-V28 VanDerWaalsContact O-CG2 3.3Å; G24-V28 WeakPolarHBondContact O-CG2 3.42Å; G24-V28 PolarHBondContact O-N 3.05Å
25	I	88.3	Confident	81.1	Confident	114 Å²	114	94.5 Å²	94.5	59%	0.585	52%	0.523	S	S	*	.	H	α-helix	trans	-64.8	-41.3	175.9	-68.8	164.3	0	0	0	111	S21 A22 I23 S29	S21-I25 WeakPolarHBondContact O-CB 3.21Å; S21-I25 VanDerWaalsContact O-CG1 3.24Å; S21-I25 WeakPolarHBondContact O-CG1 3.4Å; S21-I25 PolarHBondContact O-N 2.98Å; A22-I25 PolarHBondContact O-N 2.86Å; I23-I25 PolarHBondContact O-N 2.92Å; I25-S29 VanDerWaalsContact O-CB 3.29Å; I25-S29 WeakPolarHBondContact O-CB 3.43Å; I25-S29 PolarHBondContact O-N 3.41Å; I25-S29 PolarHBondContact O-OG 3.14Å
26	F	86.3	Confident	79.9	Confident	145 Å²	145	97.4 Å²	97.4	64%	0.636	53%	0.534	S	S	*	.	H	α-helix	trans	-61.8	-50.8	177.1	-171.4	-94.6	0	0	0	111	A22 I23 V28 S29 T30	A22-F26 WeakPolarHBondContact O-CB 3.36Å; A22-F26 PolarHBondContact O-N 3.01Å; I23-F26 PolarHBondContact O-N 2.89Å; F26-V28 PolarHBondContact O-N 3.19Å; F26-S29 PolarHBondContact O-N 3.21Å; F26-T30 WeakPolarHBondContact O-CB 3.39Å; F26-T30 PolarHBondContact O-N 3.24Å; F26-T30 PolarHBondContact O-OG1 2.97Å
27	L	84.7	Confident	78.9	Confident	111 Å²	111	99.1 Å²	99.1	58%	0.581	54%	0.54	S	S	*	.	H	α-helix	trans	-59.7	-45.1	177.3	-70.4	173.1	0	0	0	112.5	I23 S29 T30 F31	I23-L27 HydrophobicContact CG2-CD1 3.96Å; I23-L27 HydrophobicContact CG2-CG 4.38Å; I23-L27 WeakPolarHBondContact O-CB 2.96Å; I23-L27 WeakPolarHBondContact O-CG 3.29Å; I23-L27 PolarHBondContact O-N 2.83Å; L27-S29 VanDerWaalsContact C-N 3.34Å; L27-S29 PolarHBondContact O-N 2.7Å; L27-T30 PolarHBondContact O-N 3.41Å; L27-F31 WeakPolarHBondContact O-CB 3.43Å; L27-F31 PolarHBondContact O-N 2.89Å
28	V	81	Confident	77.8	Confident	95 Å²	95	100.7 Å²	100.7	58%	0.576	54%	0.544	S	S	*	.	H	α-helix	trans	-64	-39.4	177.3	168.9	0	0	0	0	111.6	G24 F26 S32	G24-V28 WeakPolarHBondContact O-CB 3.32Å; G24-V28 VanDerWaalsContact O-CG2 3.3Å; G24-V28 WeakPolarHBondContact O-CG2 3.42Å; G24-V28 PolarHBondContact O-N 3.05Å; F26-V28 PolarHBondContact O-N 3.19Å; V28-S32 VanDerWaalsContact O-CB 3.3Å; V28-S32 WeakPolarHBondContact O-CB 3.41Å; V28-S32 PolarHBondContact O-N 2.86Å; V28-S32 PolarHBondContact O-OG 3.17Å
29	S	74.3	Confident	76.7	Confident	54 Å²	54	101.4 Å²	101.4	38%	0.378	55%	0.545	S	S	.	.	H	α-helix	trans	-67.7	-46.4	177.3	-60.5	0	0	0	0	111.4	I25 F26 L27 F31 S32 M33	I25-S29 VanDerWaalsContact O-CB 3.29Å; I25-S29 WeakPolarHBondContact O-CB 3.43Å; I25-S29 PolarHBondContact O-N 3.41Å; I25-S29 PolarHBondContact O-OG 3.14Å; F26-S29 PolarHBondContact O-N 3.21Å; L27-S29 VanDerWaalsContact C-N 3.34Å; L27-S29 PolarHBondContact O-N 2.7Å; S29-F31 VanDerWaalsContact C-N 3.32Å; S29-F31 PolarHBondContact O-N 3.25Å; S29-S32 PolarHBondContact O-N 3.49Å; S29-M33 WeakPolarHBondContact O-CB 3.43Å; S29-M33 VanDerWaalsContact O-CG 3.28Å; S29-M33 WeakPolarHBondContact O-CG 3.43Å; S29-M33 PolarHBondContact O-N 2.93Å
30	T	77.1	Confident	75.8	Confident	71 Å²	71	103.2 Å²	103.2	44%	0.436	55%	0.548	S	S	.	.	H	α-helix	trans	-61.5	-38.9	176.5	-56.2	0	0	0	0	112	F26 L27 K34	F26-T30 WeakPolarHBondContact O-CB 3.39Å; F26-T30 PolarHBondContact O-N 3.24Å; F26-T30 PolarHBondContact O-OG1 2.97Å; L27-T30 PolarHBondContact O-N 3.41Å; T30-K34 PolarHBondContact O-N 3.27Å
31	F	68.9	Low	75.2	Confident	141 Å²	141	101 Å²	101	62%	0.618	54%	0.54	S	S	*	.	H	α-helix	trans	-71.1	-44.8	177.1	-153.5	-84.9	0	0	0	111.9	L27 S29 M33 K34 E35	L27-F31 WeakPolarHBondContact O-CB 3.43Å; L27-F31 PolarHBondContact O-N 2.89Å; S29-F31 VanDerWaalsContact C-N 3.32Å; S29-F31 PolarHBondContact O-N 3.25Å; F31-M33 VanDerWaalsContact C-N 3.33Å; F31-M33 PolarHBondContact O-N 2.81Å; F31-K34 WeakPolarHBondContact O-CB 3.4Å; F31-K34 PolarHBondContact O-N 3.44Å; F31-E35 HydrophobicContact CE1-CG 4.49Å; F31-E35 PolarHBondContact O-N 2.95Å
32	S	67.7	Low	74.6	Confident	68 Å²	68	101.7 Å²	101.7	48%	0.476	54%	0.54	S	S	.	.	H	α-helix	trans	-62.8	-37.6	178	-57.9	0	0	0	0	112.6	V28 S29 K34 E35 T36	V28-S32 VanDerWaalsContact O-CB 3.3Å; V28-S32 WeakPolarHBondContact O-CB 3.41Å; V28-S32 PolarHBondContact O-N 2.86Å; V28-S32 PolarHBondContact O-OG 3.17Å; S29-S32 PolarHBondContact O-N 3.49Å; S32-K34 PolarHBondContact O-N 2.82Å; S32-E35 PolarHBondContact O-N 2.85Å; S32-T36 PolarHBondContact O-N 3.25Å; S32-T36 PolarHBondContact O-OG1 3.34Å
33	M	61.6	Low	74.1	Confident	137 Å²	137	101.5 Å²	101.5	68%	0.675	54%	0.539	S	S	*	.	H	α-helix	trans	-62.3	-31	173.3	-75.5	177.3	173.8	0	0	112.5	S29 F31 T36 S37	S29-M33 WeakPolarHBondContact O-CB 3.43Å; S29-M33 VanDerWaalsContact O-CG 3.28Å; S29-M33 WeakPolarHBondContact O-CG 3.43Å; S29-M33 PolarHBondContact O-N 2.93Å; F31-M33 VanDerWaalsContact C-N 3.33Å; F31-M33 PolarHBondContact O-N 2.81Å; M33-T36 PolarHBondContact O-OG1 2.99Å; M33-S37 PolarHBondContact O-N 2.83Å
34	K	56	Low	73.5	Confident	163 Å²	163	100.2 Å²	100.2	71%	0.709	53%	0.533	S	S	*	.	H	α-helix	trans	-74	-36.7	-178.5	-136.2	172.3	-172.7	176.9	0	112.6	T30 F31 S32 S37	T30-K34 PolarHBondContact O-N 3.27Å; F31-K34 WeakPolarHBondContact O-CB 3.4Å; F31-K34 PolarHBondContact O-N 3.44Å; S32-K34 PolarHBondContact O-N 2.82Å; K34-S37 PolarHBondContact O-N 3.12Å
35	E	57.8	Low	72.8	Confident	140 Å²	140	103.8 Å²	103.8	65%	0.654	54%	0.541	S	S	*	.	H	α-helix	trans	-68.9	-38.8	176	-64.9	-161.9	158.1	0	0	112.3	F31 S32 S37 Y38	F31-E35 HydrophobicContact CE1-CG 4.49Å; F31-E35 PolarHBondContact O-N 2.95Å; S32-E35 PolarHBondContact O-N 2.85Å; E35-S37 VanDerWaalsContact C-N 3.27Å; E35-S37 PolarHBondContact O-N 2.96Å; E35-Y38 PolarHBondContact O-N 2.84Å
36	T	59.8	Low	72.4	Confident	98 Å²	98	106.8 Å²	106.8	60%	0.601	55%	0.545	S	S	*	.	H	α-helix	trans	-62.9	-32.5	173.8	43.1	0	0	0	0	113.2	S32 M33 Y38 E40	S32-T36 PolarHBondContact O-N 3.25Å; S32-T36 PolarHBondContact O-OG1 3.34Å; M33-T36 PolarHBondContact O-OG1 2.99Å; T36-Y38 VanDerWaalsContact C-N 3.31Å; T36-Y38 PolarHBondContact O-N 2.82Å; T36-E40 PolarHBondContact O-N 3.07Å
37	S	65.6	Low	72.1	Confident	73 Å²	73	106 Å²	106	51%	0.51	54%	0.542	S	S	.	.	H	α-helix	trans	-67.5	-27.7	-179.2	-174.1	0	0	0	0	113.6	M33 K34 E35 A41	M33-S37 PolarHBondContact O-N 2.83Å; K34-S37 PolarHBondContact O-N 3.12Å; E35-S37 VanDerWaalsContact C-N 3.27Å; E35-S37 PolarHBondContact O-N 2.96Å; S37-A41 WeakPolarHBondContact O-CB 3.39Å; S37-A41 PolarHBondContact O-N 2.83Å
38	Y	66.3	Low	71.8	Confident	169 Å²	169	106.8 Å²	106.8	66%	0.663	54%	0.542	S	S	*	.	H	α-helix	trans	-78.7	-42.9	-173.8	-169.6	-100.1	0	0	0	112.5	E35 T36 E40 A41 L42	E35-Y38 PolarHBondContact O-N 2.84Å; T36-Y38 VanDerWaalsContact C-N 3.31Å; T36-Y38 PolarHBondContact O-N 2.82Å; Y38-E40 VanDerWaalsContact C-N 3.35Å; Y38-A41 PolarHBondContact O-N 2.91Å; Y38-L42 HydrophobicContact CD1-CD1 4.08Å; Y38-L42 HydrophobicContact CE1-CD1 3.67Å; Y38-L42 PolarHBondContact O-N 2.89Å; Y38-L42 VanDerWaalsContact O-N 3.1Å
39	E	67.8	Low	71.3	Confident	139 Å²	139	108 Å²	108	65%	0.65	54%	0.543	S	S	*	.	H	α-helix	trans	-62.3	-41	170.6	-92.1	-71.8	134.9	0	0	111.4	L42 A43	E39-L42 PolarHBondContact O-N 3.14Å; E39-A43 WeakPolarHBondContact O-CB 3.44Å; E39-A43 PolarHBondContact O-N 2.85Å
40	E	72.6	Confident	71.2	Confident	125 Å²	125	108 Å²	108	58%	0.584	55%	0.547	S	S	*	.	H	α-helix	trans	-68	-35.1	177.3	-176.3	160	-158.3	0	0	112.7	T36 Y38 A43 N44	T36-E40 PolarHBondContact O-N 3.07Å; Y38-E40 VanDerWaalsContact C-N 3.35Å; E40-A43 PolarHBondContact O-N 3.03Å; E40-N44 WeakPolarHBondContact O-CB 3.44Å; E40-N44 PolarHBondContact O-N 2.9Å; E40-N44 PolarHBondContact O-ND2 2.95Å
41	A	78	Confident	70.8	Confident	54 Å²	54	111.5 Å²	111.5	45%	0.446	56%	0.555	S	S	.	*	H	α-helix	trans	-62.3	-46.1	172.6	0	0	0	0	0	111.8	S37 Y38 A43 N44 Q45	S37-A41 WeakPolarHBondContact O-CB 3.39Å; S37-A41 PolarHBondContact O-N 2.83Å; Y38-A41 PolarHBondContact O-N 2.91Å; A41-A43 VanDerWaalsContact C-N 3.31Å; A41-A43 PolarHBondContact O-N 3.12Å; A41-N44 PolarHBondContact O-N 2.85Å; A41-Q45 PolarHBondContact O-N 2.88Å
42	L	77.6	Confident	70.5	Confident	54 Å²	54	109.6 Å²	109.6	28%	0.283	56%	0.555	S	S	.	*	H	α-helix	trans	-62.3	-36.2	174.1	-88.8	163.6	0	0	0	112.8	Y38 E39 R46	Y38-L42 HydrophobicContact CD1-CD1 4.08Å; Y38-L42 HydrophobicContact CE1-CD1 3.67Å; Y38-L42 PolarHBondContact O-N 2.89Å; Y38-L42 VanDerWaalsContact O-N 3.1Å; E39-L42 PolarHBondContact O-N 3.14Å; L42-R46 WeakPolarHBondContact O-CG 3.49Å; L42-R46 PolarHBondContact O-N 2.85Å
43	A	80.4	Confident	70	Confident	53 Å²	53	114.2 Å²	114.2	44%	0.438	57%	0.569	S	S	.	*	H	α-helix	trans	-67.9	-41.5	173.9	0	0	0	0	0	112.2	E39 E40 A41 K47	E39-A43 WeakPolarHBondContact O-CB 3.44Å; E39-A43 PolarHBondContact O-N 2.85Å; E40-A43 PolarHBondContact O-N 3.03Å; A41-A43 VanDerWaalsContact C-N 3.31Å; A41-A43 PolarHBondContact O-N 3.12Å; A43-K47 WeakPolarHBondContact O-CB 2.99Å; A43-K47 PolarHBondContact O-N 3.49Å; A43-K47 VanDerWaalsContact O-N 3.17Å
44	N	79	Confident	69.7	Low	68 Å²	68	114.8 Å²	114.8	36%	0.364	57%	0.57	S	S	.	*	H	α-helix	trans	-71.3	-39	178.8	-82.1	-39.2	0	0	0	112.7	E40 A41 R46 K47 E48	E40-N44 WeakPolarHBondContact O-CB 3.44Å; E40-N44 PolarHBondContact O-N 2.9Å; E40-N44 PolarHBondContact O-ND2 2.95Å; A41-N44 PolarHBondContact O-N 2.85Å; N44-R46 VanDerWaalsContact C-N 3.32Å; N44-R46 PolarHBondContact O-N 3.44Å; N44-K47 CarbonylContact O-C 3.53Å; N44-K47 WeakPolarHBondContact O-CA 3.39Å; N44-K47 WeakPolarHBondContact O-CB 3.34Å; N44-K47 PolarHBondContact O-N 2.83Å; N44-E48 WeakPolarHBondContact O-CB 3.42Å; N44-E48 PolarHBondContact O-N 2.64Å
45	Q	78.9	Confident	69.4	Low	107 Å²	107	115.5 Å²	115.5	50%	0.5	58%	0.576	S	S	.	*	H	α-helix	trans	-58.4	-42.8	174.9	-168.6	-164	55.2	0	0	111.9	A41 K47 E48 M49	A41-Q45 PolarHBondContact O-N 2.88Å; Q45-K47 VanDerWaalsContact C-N 3.3Å; Q45-K47 PolarHBondContact O-N 2.76Å; Q45-E48 PolarHBondContact O-N 3.45Å; Q45-M49 HydrophobicContact CG-CE 4.29Å; Q45-M49 PolarHBondContact O-N 2.83Å
46	R	78.8	Confident	68.5	Low	178 Å²	178	118.9 Å²	118.9	67%	0.672	59%	0.589	S	S	*	*	H	α-helix	trans	-64.5	-34	174.3	-70.8	173.3	176.4	162.8	2.2	112.8	L42 N44 A50	L42-R46 WeakPolarHBondContact O-CG 3.49Å; L42-R46 PolarHBondContact O-N 2.85Å; N44-R46 VanDerWaalsContact C-N 3.32Å; N44-R46 PolarHBondContact O-N 3.44Å; R46-A50 PolarHBondContact O-N 2.89Å
47	K	80.5	Confident	67.5	Low	129 Å²	129	116.2 Å²	116.2	56%	0.561	58%	0.581	S	S	*	*	H	α-helix	trans	-76.4	-27	178.7	-166.8	-177.7	-177.4	-174.9	0	112.2	A43 N44 Q45 K51	A43-K47 WeakPolarHBondContact O-CB 2.99Å; A43-K47 PolarHBondContact O-N 3.49Å; A43-K47 VanDerWaalsContact O-N 3.17Å; N44-K47 CarbonylContact O-C 3.53Å; N44-K47 WeakPolarHBondContact O-CA 3.39Å; N44-K47 WeakPolarHBondContact O-CB 3.34Å; N44-K47 PolarHBondContact O-N 2.83Å; Q45-K47 VanDerWaalsContact C-N 3.3Å; Q45-K47 PolarHBondContact O-N 2.76Å; K47-K51 WeakPolarHBondContact O-CG 2.93Å; K47-K51 PolarHBondContact O-N 2.65Å
48	E	77.2	Confident	66.1	Low	127 Å²	127	122.1 Å²	122.1	59%	0.593	60%	0.6	S	S	*	*	H	α-helix	trans	-76.5	-46.2	174.3	-175.2	163.9	-129.3	0	0	111.7	N44 Q45 A50 K51 T52	N44-E48 WeakPolarHBondContact O-CB 3.42Å; N44-E48 PolarHBondContact O-N 2.64Å; Q45-E48 PolarHBondContact O-N 3.45Å; E48-A50 PolarHBondContact O-N 3.33Å; E48-K51 WeakPolarHBondContact O-CA 3.27Å; E48-K51 WeakPolarHBondContact O-CB 3.48Å; E48-K51 PolarHBondContact O-N 2.95Å; E48-T52 PolarHBondContact O-N 3.39Å
49	M	71.5	Confident	64.6	Low	120 Å²	120	124 Å²	124	59%	0.591	61%	0.611	S	S	*	*	H	α-helix	trans	-59.8	-25.9	169.9	-73.7	-165	-87.4	0	0	113.1	Q45 T52	Q45-M49 HydrophobicContact CG-CE 4.29Å; Q45-M49 PolarHBondContact O-N 2.83Å; M49-T52 PolarHBondContact O-OG1 3.34Å
50	A	73.1	Confident	63	Low	55 Å²	55	126.8 Å²	126.8	46%	0.455	62%	0.621	S	S	.	*	H	α-helix	trans	-77.2	-23.4	170.9	0	0	0	0	0	113.8	R46 E48	R46-A50 PolarHBondContact O-N 2.89Å; E48-A50 PolarHBondContact O-N 3.33Å
51	K	68.3	Low	61.2	Low	143 Å²	143	129.9 Å²	129.9	62%	0.622	63%	0.633	S	S	*	*	H	α-helix	trans	-81.7	-39.2	176.8	-80	177.8	173.5	-174	0	112.7	K47 E48 H53 H54 Q55	K47-K51 WeakPolarHBondContact O-CG 2.93Å; K47-K51 PolarHBondContact O-N 2.65Å; E48-K51 WeakPolarHBondContact O-CA 3.27Å; E48-K51 WeakPolarHBondContact O-CB 3.48Å; E48-K51 PolarHBondContact O-N 2.95Å; K51-H53 PolarHBondContact O-N 3.23Å; K51-H54 WeakPolarHBondContact O-CA 3.32Å; K51-H54 PolarHBondContact O-N 3.14Å; K51-Q55 PolarHBondContact O-N 3.25Å; K51-Q55 VanDerWaalsContact O-N 3.11Å
52	T	62.2	Low	59.2	Low	101 Å²	101	136.3 Å²	136.3	62%	0.62	65%	0.651	S	S	*	*	H	α-helix	trans	-60.4	-36.3	178.2	52.6	0	0	0	0	111.5	E48 M49 H54	E48-T52 PolarHBondContact O-N 3.39Å; M49-T52 PolarHBondContact O-OG1 3.34Å; T52-H54 PolarHBondContact O-N 3.33Å
53	H	57.3	Low	57.1	Low	165 Å²	165	142.1 Å²	142.1	76%	0.764	68%	0.677	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.5	-16.6	173.2	-155.9	-57.9	0	0	0	113.9	K51	K51-H53 PolarHBondContact O-N 3.23Å
54	H	54.1	Low	55	Low	150 Å²	150	148.4 Å²	148.4	69%	0.694	69%	0.694	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.3	-20.5	179.5	-99	-69.7	0	0	0	114.7	K51 T52 K56 G57	K51-H54 WeakPolarHBondContact O-CA 3.32Å; K51-H54 PolarHBondContact O-N 3.14Å; T52-H54 PolarHBondContact O-N 3.33Å; H54-K56 PolarHBondContact O-N 3.38Å; H54-K56 VanDerWaalsContact O-N 3.14Å; H54-G57 PolarHBondContact O-N 3.01Å
55	Q	50.2	Low	52.7	Low	178 Å²	178	151.1 Å²	151.1	83%	0.832	71%	0.713	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.9	-6.9	177.5	-91.7	-165	1.4	0	0	114.9	K51 G57	K51-Q55 PolarHBondContact O-N 3.25Å; K51-Q55 VanDerWaalsContact O-N 3.11Å; Q55-G57 PolarHBondContact O-N 2.84Å
56	K	40.2	Very low	50.8	Low	211 Å²	211	151.9 Å²	151.9	92%	0.917	73%	0.725	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.8	4.6	166.3	-148.6	173.4	-176.7	177.6	0	113.2	H54	H54-K56 PolarHBondContact O-N 3.38Å; H54-K56 VanDerWaalsContact O-N 3.14Å
57	G	38.1	Very low	48.7	Very low	42 Å²	42	151.7 Å²	151.7	43%	0.433	73%	0.732	S	S	.	*	S	Bend	trans	-121.9	133	171.5	0	0	0	0	0	113	H54 Q55	H54-G57 PolarHBondContact O-N 3.01Å; Q55-G57 PolarHBondContact O-N 2.84Å
58	E	35.2	Very low	46.5	Very low	196 Å²	196	153.7 Å²	153.7	92%	0.916	74%	0.74	S	S	*	*			trans	62.5	67.1	153.5	-54.2	-166.4	100.1	0	0	118.9	K60	E58-K60 VanDerWaalsContact C-N 3.32Å; E58-K60 PolarHBondContact O-N 3.18Å
59	K	34.8	Very low	44.1	Very low	208 Å²	208	157.4 Å²	157.4	90%	0.904	76%	0.755	S	S	*	*			trans	-57.5	94.5	141.6	-82.4	-177	174.7	177.5	0	109.7
60	K	35.4	Very low	42.2	Very low	198 Å²	198	155.2 Å²	155.2	86%	0.861	76%	0.762	S	S	*	*			trans	-169.9	116.3	146.9	-106.1	151.3	-171.5	176.3	0	115.7	E58	E58-K60 VanDerWaalsContact C-N 3.32Å; E58-K60 PolarHBondContact O-N 3.18Å
61	K	34.5	Very low	40.2	Very low	190 Å²	190	162 Å²	162	83%	0.826	78%	0.782	S	S	*	*			trans	91	117.6	133.4	-147.4	166	-171.7	175.2	0	119.3
62	K	35.7	Very low	38.8	Very low	190 Å²	190	161.9 Å²	161.9	83%	0.826	79%	0.793	S	S	*	*			trans	75.7	72.6	158.4	-73.6	-176.3	171.1	-172.5	0	120.2
63	E	34.1	Very low	37.4	Very low	176 Å²	176	166.1 Å²	166.1	82%	0.822	80%	0.803	S	S	*	*				-65.3	137	126.9	-124.7	156	173.1	0	0	107.6
64	K	35.4	Very low	36.2	Very low	185 Å²	185	165.8 Å²	165.8	80%	0.804	80%	0.799	S	S	*	*				55.7	98.3	59.6	-70.6	-172.8	179.1	-176.1	0	110.8
65	T	32.2	Very low	35.4	Very low	125 Å²	125	167.6 Å²	167.6	77%	0.767	81%	0.805	S	S	*	*			cis	78.9	99.9	22.9	-35.8	0	0	0	0	114.8
66	V	37.7	Very low	34.7	Very low	123 Å²	123	166.2 Å²	166.2	75%	0.745	80%	0.799	S	S	*	*			trans	71.6	106.8	154.4	178.9	0	0	0	0	118.7
67	E	34.5	Very low	34.6	Very low	173 Å²	173	164.5 Å²	164.5	81%	0.808	79%	0.794	S	S	*	*				-118.3	122.1	123.1	-67.1	-145.1	97.7	0	0	107.7
68	K	34.2	Very low	34.4	Very low	171 Å²	171	172 Å²	172	74%	0.743	82%	0.815	S	S	*	*				50.9	101	103.1	-67.1	179.4	178	172.9	0	113.1
69	K	27.8	Very low	34.7	Very low	206 Å²	206	168.1 Å²	168.1	90%	0.896	81%	0.806	S	S	*	*			cis	73.1	91.4	41.4	-162	-172	-178.6	178.8	0	113.7
70	G	30.8	Very low	34.6	Very low	73 Å²	73	165 Å²	165	75%	0.753	80%	0.799	S	S	*	*			trans	147	90.6	169	0	0	0	0	0	111.1
71	K	31.9	Very low	34.6	Very low	199 Å²	199	159.3 Å²	159.3	87%	0.865	80%	0.797	S	S	*	*				97.7	81.3	52.1	-82.4	-163.4	167.6	-169.8	0	113.7
72	T	37.7	Very low	34.6	Very low	140 Å²	140	158.5 Å²	158.5	86%	0.859	79%	0.794	S	S	*	*			trans	-162.6	124.4	141.5	9.5	0	0	0	0	104.2
73	K	33	Very low	34.5	Very low	189 Å²	189	155.7 Å²	155.7	82%	0.822	79%	0.786	S	S	*	*			cis	56.9	127.3	33.3	-91.3	-163.2	175.1	-169.6	0	112.2
74	K	33.4	Very low	34.7	Very low	158 Å²	158	153 Å²	153	69%	0.687	78%	0.784	S	S	*	*			cis	-162	127.9	-1.5	-169.6	-160.8	-176.8	-150.5	0	110.5	E76	K74-E76 WeakPolarHBondContact CE-OE2 3.28Å; K74-E76 IonicContact NZ-OE2 2.63Å; K74-E76 PolarHBondContact NZ-OE2 3.04Å; K74-E76 VanDerWaalsContact NZ-OE2 3.1Å
75	K	36.6	Very low	34.5	Very low	189 Å²	189	153 Å²	153	82%	0.822	79%	0.787	S	S	*	*			trans	-154.2	147.2	141.2	-154.4	-176	178.2	-160.9	0	108.3
76	E	35.8	Very low	34.7	Very low	149 Å²	149	155.2 Å²	155.2	70%	0.696	79%	0.788	S	S	*	*			trans	-107.3	135.2	178.8	-70.2	156.7	85.6	0	0	108.5	K74	K74-E76 WeakPolarHBondContact CE-OE2 3.28Å; K74-E76 IonicContact NZ-OE2 2.63Å; K74-E76 PolarHBondContact NZ-OE2 3.04Å; K74-E76 VanDerWaalsContact NZ-OE2 3.1Å
77	E	37.9	Very low	34.3	Very low	175 Å²	175	156 Å²	156	82%	0.818	79%	0.788	S	S	*	*			trans	-148.7	129.1	160.8	-152	166.5	137.3	0	0	109.1
78	K	34	Very low	34.5	Very low	200 Å²	200	155.9 Å²	155.9	87%	0.87	79%	0.792	S	S	*	*			trans	-161.3	154.6	-176.8	-80.5	-170.5	179.3	-179.7	0	106.4
79	P	41.4	Very low	34.4	Very low	114 Å²	114	154.8 Å²	154.8	74%	0.74	80%	0.795	S	S	*	*			cis	-134.3	150.7	19.7	39.9	-23.2	0	0	0	117.2
80	N	33	Very low	34.5	Very low	141 Å²	141	151.3 Å²	151.3	75%	0.754	79%	0.793	S	S	*	*			trans	36.1	95.6	130.9	-171.2	68.1	0	0	0	119.5
81	G	36.2	Very low	34.5	Very low	79 Å²	79	154.1 Å²	154.1	81%	0.814	79%	0.791	S	S	*	*			trans	-118.1	145.9	152.1	0	0	0	0	0	110.1
82	K	33.5	Very low	34.6	Very low	173 Å²	173	151 Å²	151	75%	0.752	79%	0.788	S	S	*	*			trans	-111.6	142.5	-179	-80.6	-174.5	176	-177.8	0	111.8
83	I	33.1	Very low	34.3	Very low	131 Å²	131	149.6 Å²	149.6	67%	0.672	78%	0.78	S	S	*	*			trans	27.9	113	139.4	-40	167.4	0	0	0	115.2	E85	I83-E85 HydrophobicContact CG2-CG 4.06Å
84	P	39.2	Very low	34.6	Very low	121 Å²	121	148 Å²	148	79%	0.786	78%	0.779	S	S	*	*				-103.7	137	102.7	-20.7	35	0	0	0	113.8
85	E	30.3	Very low	34.6	Very low	184 Å²	184	147.1 Å²	147.1	86%	0.86	78%	0.78	S	S	*	*			trans	-79	141.7	148.3	-67.3	175.1	150	0	0	106.3	I83	I83-E85 HydrophobicContact CG2-CG 4.06Å
86	H	36.9	Very low	34.2	Very low	171 Å²	171	145.1 Å²	145.1	79%	0.792	78%	0.778	S	S	*	*			trans	-139.3	127.2	175.4	-158.1	-64.9	0	0	0	108.6
87	D	29.8	Very low	34	Very low	140 Å²	140	147.2 Å²	147.2	75%	0.749	78%	0.784	S	S	*	*			trans	-60.1	149.9	174.6	-65.9	-85.4	0	0	0	111.3
88	L	37.5	Very low	33.6	Very low	170 Å²	170	147.2 Å²	147.2	89%	0.89	78%	0.784	S	S	*	*			trans	-125.4	118.9	168.6	-73.2	176.3	0	0	0	108.2
89	D	32.7	Very low	33.8	Very low	149 Å²	149	143.7 Å²	143.7	80%	0.797	78%	0.782	S	S	*	*			trans	-66.9	147.3	-164.7	-70.7	-80.1	0	0	0	115.5	N91	D89-N91 PolarHBondContact O-N 2.82Å; D89-N91 VanDerWaalsContact O-N 3.12Å
90	P	30.1	Very low	33.3	Very low	133 Å²	133	144.9 Å²	144.9	86%	0.864	79%	0.787	S	S	*	*			trans	-84.9	80.5	-179.2	35.1	-36	0	0	0	112.4
91	N	31	Very low	33	Very low	131 Å²	131	149.4 Å²	149.4	70%	0.701	79%	0.793	S	S	*	*			trans	-147.3	85.3	168	-160.2	-1.9	0	0	0	115.7	D89	D89-N91 PolarHBondContact O-N 2.82Å; D89-N91 VanDerWaalsContact O-N 3.12Å
92	V	34	Very low	32.9	Very low	134 Å²	134	152.5 Å²	152.5	81%	0.812	80%	0.796	S	S	*	*			trans	-132.8	104.9	155.2	-178.5	0	0	0	0	109.1	I94	V92-I94 PolarHBondContact O-N 2.97Å
93	T	30.4	Very low	32.7	Very low	110 Å²	110	149.7 Å²	149.7	68%	0.675	80%	0.798	S	S	*	*			trans	-67.4	115.4	176.2	-50.6	0	0	0	0	111	I95	T93-I95 HydrophobicContact CG2-CG1 4.33Å
94	I	39.3	Very low	32.5	Very low	157 Å²	157	147.8 Å²	147.8	81%	0.805	80%	0.802	S	S	*	*			trans	-98.3	115	165	-63.2	-176.3	0	0	0	108.5	V92 L96	V92-I94 PolarHBondContact O-N 2.97Å; I94-L96 PolarHBondContact O-N 3.13Å
95	I	34	Very low	32.3	Very low	139 Å²	139	148.4 Å²	148.4	71%	0.713	80%	0.803	S	S	*	*			trans	-73.1	124	-169.9	-62.6	175.3	0	0	0	111	T93	T93-I95 HydrophobicContact CG2-CG1 4.33Å
96	L	27.6	Very low	32.3	Very low	147 Å²	147	144.5 Å²	144.5	77%	0.77	80%	0.803	S	S	*	*			trans	-74.7	129.2	171.3	-163.9	163.2	0	0	0	109.3	I94 E98	I94-L96 PolarHBondContact O-N 3.13Å; L96-E98 HydrophobicContact CD2-CG 4.43Å
97	K	32.1	Very low	32.1	Very low	193 Å²	193	142.9 Å²	142.9	84%	0.839	80%	0.804	S	S	*	*			trans	-122.4	133.6	170.5	-107	176.9	174.9	175.3	0	110.5
98	E	29.3	Very low	32.2	Very low	174 Å²	174	140.5 Å²	140.5	81%	0.813	80%	0.804	S	S	*	*	P	Polyproline II helix	trans	-81	141.8	-160.5	-61.5	171.8	100.6	0	0	114.3	L96	L96-E98 HydrophobicContact CD2-CG 4.43Å
99	P	38.4	Very low	32.1	Very low	126 Å²	126	137.6 Å²	137.6	82%	0.818	80%	0.795	S	S	*	*	P	Polyproline II helix	trans	-77.5	139.9	165.7	-11.5	28.4	0	0	0	112.2
100	V	31.9	Very low	32.2	Very low	140 Å²	140	137.2 Å²	137.2	85%	0.848	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-79.7	141	-177.1	179	0	0	0	0	113
101	R	25.7	Very low	32.2	Very low	236 Å²	236	135.8 Å²	135.8	89%	0.891	79%	0.792	S	S	*	*	P	Polyproline II helix	trans	-52.9	147.1	-178	-43.7	171.5	-168.8	-161.7	0.4	114.3
102	V	34.1	Very low	32.4	Very low	143 Å²	143	135.4 Å²	135.4	87%	0.867	79%	0.794	S	S	*	*			trans	-150	129.9	146.3	-106.9	0	0	0	0	113
103	S	29.3	Very low	32.4	Very low	114 Å²	114	137.1 Å²	137.1	80%	0.797	79%	0.793	S	S	*	*			trans	31.3	122.2	161.8	-151	0	0	0	0	121.3
104	A	28.6	Very low	32.6	Very low	92 Å²	92	137.7 Å²	137.7	76%	0.76	80%	0.801	S	S	*	*			trans	-73.8	155.1	159	0	0	0	0	0	112.1
105	V	35.3	Very low	32.4	Very low	133 Å²	133	135.9 Å²	135.9	81%	0.806	80%	0.802	S	S	*	*			trans	-136.6	109	160.4	-180	0	0	0	0	107.5
106	A	31	Very low	32.9	Very low	103 Å²	103	134.3 Å²	134.3	85%	0.851	80%	0.799	S	S	*	*			trans	-94.2	116.7	-176.6	0	0	0	0	0	111.5
107	V	32.8	Very low	33.4	Very low	136 Å²	136	128 Å²	128	82%	0.824	77%	0.77	S	S	*	*			trans	-139.4	126.4	165.6	-176.3	0	0	0	0	108.9
108	A	31.7	Very low	33.8	Very low	91 Å²	91	121.1 Å²	121.1	75%	0.752	74%	0.741	S	S	*	*			trans	-120.6	172.3	-175.3	0	0	0	0	0	110.2
109	P	34.6	Very low	34.3	Very low	108 Å²	108	112.9 Å²	112.9	70%	0.701	70%	0.702	S	S	*	*				-127.9	-170.1	-126.1	35.1	-15.5	0	0	0	116.1
110	T	34.5	Very low	34.6	Very low	141 Å²	141	106.9 Å²	106.9	87%	0.865	66%	0.663	S	S	*	*			trans	73.9	165.5	170.7	76.6	0	0	0	0	115.8
111	S	31.5	Very low	35.2	Very low	103 Å²	103	100.6 Å²	100.6	72%	0.72	63%	0.625	S	S	*	*			cis	-167.9	178.7	-41.8	-160.6	0	0	0	0	107.1
112	V	34.5	Very low	35.9	Very low	123 Å²	123	90.7 Å²	90.7	75%	0.745	59%	0.593	S	S	*	*			cis	-148.6	166.3	8.8	-145.8	0	0	0	0	111
113	H	34.6	Very low	36.2	Very low	171 Å²	171	89.7 Å²	89.7	79%	0.792	59%	0.588	S	S	*	*			trans	8.3	134.2	149.7	-89.6	-133.9	0	0	0	123.7
114	S	33.4	Very low	36.6	Very low	121 Å²	121	89.5 Å²	89.5	85%	0.846	58%	0.582	S	S	*	*				177.1	177.3	106	-80.2	0	0	0	0	114.5
115	S	36.5	Very low	37	Very low	119 Å²	119	91.1 Å²	91.1	83%	0.832	58%	0.584	S	S	*	*			trans	-146.6	-161.8	-162.4	-168.9	0	0	0	0	114.6
116	V	42.7	Very low	37	Very low	107 Å²	107	88.8 Å²	88.8	65%	0.648	58%	0.579	S	S	*	*			trans	89.6	145.3	-175.2	-173.9	0	0	0	0	113.5	H118 Q707	V116-H118 WeakPolarHBondContact CG1-NE2 3.18Å; V116-Q707 PolarHBondContact O-NE2 3.27Å
117	G	38.6	Very low	37.1	Very low	15 Å²	15	91.2 Å²	91.2	16%	0.155	57%	0.574	C	S	.	*			cis	166	165.2	6.5	0	0	0	0	0	106.4	G705 Q707	G117-G705 CarbonylContact C-O 3.54Å; G117-G705 VanDerWaalsContact C-O 3.29Å; G117-G705 CarbonylContact O-C 3.44Å; G117-G705 WeakPolarHBondContact O-CA 3.35Å; G117-Q707 PolarHBondContact O-NE2 3.33Å
118	H	40	Very low	37.1	Very low	48 Å²	48	90.9 Å²	90.9	22%	0.222	58%	0.575	C	S	.	*			cis	178.6	-139.8	47.6	-38.2	115.6	0	0	0	113.6	V116 E684 G685 A686 E704 G705 D724	V116-H118 WeakPolarHBondContact CG1-NE2 3.18Å; H118-E684 CarbonylContact O-C 3.55Å; H118-G685 VanDerWaalsContact CA-N 3.31Å; H118-G685 CarbonylContact O-C 3.56Å; H118-G685 WeakPolarHBondContact O-CA 3Å; H118-G685 PolarHBondContact O-N 2.85Å; H118-A686 PolarHBondContact O-N 3.39Å; H118-E704 CarbonylContact C-O 3.54Å; H118-E704 VanDerWaalsContact C-O 3.29Å; H118-E704 HydrophobicContact CB-CB 3.31Å; H118-E704 HydrophobicContact CB-CG 4.46Å; H118-E704 WeakPolarHBondContact ND1-CB 3.37Å; H118-G705 PolarHBondContact N-O 2.9Å; H118-G705 VanDerWaalsContact ND1-CA 3.34Å; H118-G705 WeakPolarHBondContact ND1-CA 3.42Å; H118-G705 PolarHBondContact ND1-N 2.69Å; H118-D724 PolarHBondContact ND1-O 2.95Å
119	T	41.4	Very low	37	Very low	0 Å²	0	94.5 Å²	94.5	0%	0	58%	0.577	C	S	.	*				-80.5	-110	-119.8	75.9	0	0	0	0	129.4	N678 G683 E684 N698 K702 A703 E704	T119-N678 WeakPolarHBondContact O-CB 3.22Å; T119-N678 PolarHBondContact O-ND2 3.45Å; T119-G683 VanDerWaalsContact CB-CA 3.45Å; T119-G683 WeakPolarHBondContact CB-O 3.05Å; T119-G683 WeakPolarHBondContact CG2-O 3.33Å; T119-E684 HydrophobicContact CG2-CB 4.46Å; T119-E684 HydrophobicContact CG2-CG 4.08Å; T119-E684 PolarHBondContact O-N 3.34Å; T119-E684 VanDerWaalsContact O-O 3.1Å; T119-N698 VanDerWaalsContact C-OD1 3.3Å; T119-N698 PolarHBondContact N-ND2 2.96Å; T119-N698 PolarHBondContact O-OD1 2.86Å; T119-K702 PolarHBondContact OG1-O 3.05Å; T119-A703 WeakPolarHBondContact OG1-CA 3.34Å; T119-E704 HydrophobicContact CG2-CB 4.06Å; T119-E704 HydrophobicContact CG2-CG 4.4Å; T119-E704 WeakPolarHBondContact CG2-OE2 2.99Å; T119-E704 PolarHBondContact N-O 2.84Å; T119-E704 PolarHBondContact OG1-N 3.25Å
120	P	44.5	Very low	36.9	Very low	0 Å²	0	96.7 Å²	96.7	0%	0	58%	0.578	C	S	.	*				-151.5	-165.3	-113.8	54.3	-40.2	0	0	0	125.8	N678 G680 N698 Q699 K702 A703	P120-N678 CarbonylContact C-O 3.57Å; P120-N678 VanDerWaalsContact C-O 3.32Å; P120-N678 CarbonylContact O-C 3.53Å; P120-G680 WeakPolarHBondContact CB-O 3.38Å; P120-N698 VanDerWaalsContact CD-CB 3.41Å; P120-N698 WeakPolarHBondContact CD-ND2 3.48Å; P120-N698 CarbonylContact O-C 3.31Å; P120-Q699 PolarHBondContact O-N 2.93Å; P120-K702 WeakPolarHBondContact CG-O 3.39Å; P120-A703 VanDerWaalsContact CG-CA 3.45Å; P120-A703 HydrophobicContact CG-CB 3.58Å
121	I	43.7	Very low	36.7	Very low	8 Å²	8	98.3 Å²	98.3	4%	0.041	57%	0.573	C	S	.	*			trans	88.4	124.3	142.8	-64.8	131.3	0	0	0	128.5	Q679 G680 K681 Q699 G700 K701 K702	I121-Q679 CarbonylContact C-O 3.59Å; I121-Q679 VanDerWaalsContact C-O 3.28Å; I121-Q679 VanDerWaalsContact N-C 3.31Å; I121-Q679 VanDerWaalsContact N-CA 3.34Å; I121-Q679 VanDerWaalsContact O-CA 3.27Å; I121-Q679 WeakPolarHBondContact O-CA 3.27Å; I121-Q679 WeakPolarHBondContact O-CG 3.28Å; I121-G680 VanDerWaalsContact CA-C 3.44Å; I121-G680 VanDerWaalsContact CA-N 3.31Å; I121-G680 VanDerWaalsContact CA-O 3.28Å; I121-G680 WeakPolarHBondContact CA-O 3.37Å; I121-G680 WeakPolarHBondContact CG1-O 3.29Å; I121-G680 PolarHBondContact N-O 3Å; I121-K681 WeakPolarHBondContact CD1-O 3.4Å; I121-K681 VanDerWaalsContact CG1-CA 3.41Å; I121-K681 WeakPolarHBondContact CG1-O 3.38Å; I121-Q699 VanDerWaalsContact CB-O 3.25Å; I121-Q699 WeakPolarHBondContact CB-O 2.98Å; I121-Q699 WeakPolarHBondContact CG2-O 3.27Å; I121-G700 WeakPolarHBondContact CD1-O 3.47Å; I121-G700 VanDerWaalsContact CG2-CA 3.42Å; I121-K701 HydrophobicContact CD1-CB 4.02Å; I121-K701 HydrophobicContact CG1-CB 4.44Å; I121-K702 WeakPolarHBondContact CD1-O 3.44Å
122	A	40.3	Very low	36.7	Very low	28 Å²	28	102.1 Å²	102.1	23%	0.231	58%	0.584	C	S	.	*			trans	78	154	154.1	0	0	0	0	0	119.2	Q679	A122-Q679 CarbonylContact C-O 3.57Å; A122-Q679 VanDerWaalsContact N-C 3.28Å; A122-Q679 PolarHBondContact N-O 2.93Å; A122-Q679 WeakPolarHBondContact O-CB 3.4Å
123	T	41.2	Very low	36.7	Very low	122 Å²	122	101.3 Å²	101.3	75%	0.748	59%	0.59	S	S	*	*			cis	-150	123.8	26.3	-59	0	0	0	0	109.2
124	V	38.1	Very low	36.5	Very low	111 Å²	111	98.6 Å²	98.6	67%	0.673	59%	0.591	S	S	*	*				56.3	144.5	102.3	-176.3	0	0	0	0	114.6
125	P	37.1	Very low	36.2	Very low	126 Å²	126	98.7 Å²	98.7	82%	0.818	59%	0.591	S	S	*	*			cis	-104.5	-110	2.6	15.3	10.2	0	0	0	114.3
126	A	34.8	Very low	36.3	Very low	84 Å²	84	98.8 Å²	98.8	69%	0.694	59%	0.589	S	S	*	*			cis	-159.5	157.7	-14.4	0	0	0	0	0	111.4
127	M	33.1	Very low	35.9	Very low	153 Å²	153	103.6 Å²	103.6	75%	0.754	60%	0.601	S	S	*	*			trans	-158.8	155.8	168.8	-74.1	-173.3	59	0	0	111.1	Q129	M127-Q129 HydrophobicContact CE-CG 3.98Å
128	P	32.8	Very low	35.7	Very low	129 Å²	129	110 Å²	110	84%	0.838	63%	0.632	S	S	*	*				-137.7	-170.2	110	28.5	-9.5	0	0	0	114.2
129	Q	28.7	Very low	35.5	Very low	168 Å²	168	119.8 Å²	119.8	79%	0.785	67%	0.667	S	S	*	*			trans	-128.7	151.9	-174.2	-68	164.1	-127.8	0	0	111.6	M127	M127-Q129 HydrophobicContact CE-CG 3.98Å
130	E	32.9	Very low	35	Very low	154 Å²	154	129.3 Å²	129.3	72%	0.72	71%	0.708	S	S	*	*			trans	-149.2	149.1	155	-96.5	-144.6	111.4	0	0	115.1
131	K	30.6	Very low	34.2	Very low	175 Å²	175	138.8 Å²	138.8	76%	0.761	75%	0.749	S	S	*	*			trans	42.3	122.8	154.3	-70.4	169.2	177.6	138.4	0	121.8
132	L	30.3	Very low	33.8	Very low	182 Å²	182	147.5 Å²	147.5	95%	0.953	79%	0.787	S	S	*	*			trans	-108.8	151.7	149.7	-74	166.7	0	0	0	108.3
133	A	35.2	Very low	33.4	Very low	107 Å²	107	154.1 Å²	154.1	88%	0.884	81%	0.813	S	S	*	*			trans	-137.5	153.8	173.1	0	0	0	0	0	110.7
134	S	31.1	Very low	33.3	Very low	114 Å²	114	157.5 Å²	157.5	80%	0.797	82%	0.817	S	S	*	*			trans	-117.2	150.5	-170.7	51.5	0	0	0	0	112.8
135	S	27.6	Very low	33	Very low	122 Å²	122	160.9 Å²	160.9	85%	0.853	82%	0.823	S	S	*	*			trans	-169.2	109	165.8	-83.8	0	0	0	0	111.4
136	P	37.9	Very low	32.8	Very low	121 Å²	121	161.6 Å²	161.6	79%	0.786	83%	0.825	S	S	*	*			trans	-78.6	154	162.8	-7.6	26	0	0	0	110.8
137	K	34.2	Very low	32.7	Very low	208 Å²	208	161.7 Å²	161.7	90%	0.904	83%	0.826	S	S	*	*			trans	-155.5	101	169.5	-140.2	163.7	-167.7	164.7	0	112.8
138	D	33.4	Very low	33	Very low	151 Å²	151	164.2 Å²	164.2	81%	0.807	83%	0.832	S	S	*	*			trans	-67.5	145.2	173.1	-81	-83.2	0	0	0	113.1
139	R	36.1	Very low	32.8	Very low	253 Å²	253	163.6 Å²	163.6	96%	0.955	83%	0.826	S	S	*	*			trans	-140.5	115.1	156.1	-79.7	-162.2	164	-169.5	-5.2	110.5
140	K	31.7	Very low	33	Very low	200 Å²	200	164.1 Å²	164.1	87%	0.87	83%	0.829	S	S	*	*			trans	-113.9	156.7	-177.4	-168.4	-179.9	179.7	176	0	109.9
141	K	28.4	Very low	33.1	Very low	199 Å²	199	162.6 Å²	162.6	87%	0.865	83%	0.832	S	S	*	*			trans	63.1	106.5	159.8	-167.1	179.6	-173.1	179.4	0	117.8
142	K	34.7	Very low	33.3	Very low	190 Å²	190	159.3 Å²	159.3	83%	0.826	84%	0.837	S	S	*	*				-156	93.1	129.6	-148.2	164.6	-169	169.5	0	112.4
143	E	31.9	Very low	33.3	Very low	168 Å²	168	156.8 Å²	156.8	79%	0.785	83%	0.829	S	S	*	*			trans	-73.7	148.7	152.4	-82.7	-177.3	84.4	0	0	109.7
144	K	39	Very low	33.1	Very low	192 Å²	192	157.6 Å²	157.6	84%	0.835	83%	0.828	S	S	*	*			trans	-143	106.7	149.8	-95.7	-158.8	168.9	-165.3	0	108.6
145	K	30.7	Very low	33.1	Very low	182 Å²	182	157 Å²	157	79%	0.791	83%	0.825	S	S	*	*			trans	-73.2	152	147.2	-68.6	-179.7	-179.4	176.2	0	108.3
146	V	34.2	Very low	33.4	Very low	141 Å²	141	159.1 Å²	159.1	86%	0.855	82%	0.824	S	S	*	*			trans	174.4	132.2	135.2	147.9	0	0	0	0	105.9
147	A	33.2	Very low	33	Very low	87 Å²	87	159.7 Å²	159.7	72%	0.719	83%	0.825	S	S	*	*			trans	-86.8	152.4	171.3	0	0	0	0	0	109.8
148	K	39.3	Very low	33	Very low	205 Å²	205	156 Å²	156	89%	0.891	82%	0.815	S	S	*	*			trans	-120.4	134.9	154.9	-175.7	159.4	-178.7	169.4	0	108.4
149	V	27.2	Very low	32.9	Very low	116 Å²	116	153.8 Å²	153.8	70%	0.703	81%	0.812	S	S	*	*			trans	-108.4	176.9	-177.4	176.8	0	0	0	0	108.1
150	E	33.1	Very low	32.9	Very low	180 Å²	180	149 Å²	149	84%	0.841	80%	0.804	S	S	*	*			trans	91.2	117.7	168.2	-53.8	-164.1	150.1	0	0	117.8
151	P	35.7	Very low	32.7	Very low	122 Å²	122	147.8 Å²	147.8	79%	0.792	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-96.2	134	158.6	35.4	-26.9	0	0	0	111
152	A	34.7	Very low	32.7	Very low	105 Å²	105	144.3 Å²	144.3	87%	0.868	80%	0.796	S	S	*	*	P	Polyproline II helix	trans	-80.8	142.9	172.2	0	0	0	0	0	111.6
153	V	29.7	Very low	32.7	Very low	129 Å²	129	143.5 Å²	143.5	78%	0.782	80%	0.8	S	S	*	*	P	Polyproline II helix	trans	-100.6	142.3	175.6	177.6	0	0	0	0	109.5
154	S	31.2	Very low	32.7	Very low	124 Å²	124	139.8 Å²	139.8	87%	0.867	80%	0.798	S	S	*	*			trans	-150.7	119.5	167.3	-63.8	0	0	0	0	109.7
155	S	32.2	Very low	32.6	Very low	103 Å²	103	136.7 Å²	136.7	72%	0.72	80%	0.801	S	S	*	*			trans	-135.7	119	178.6	55.2	0	0	0	0	109.3
156	I	33.2	Very low	32.8	Very low	165 Å²	165	137.7 Å²	137.7	85%	0.846	81%	0.805	S	S	*	*			trans	-127.7	118.9	170.9	-64.3	172.9	0	0	0	107.3
157	V	30.1	Very low	32.8	Very low	133 Å²	133	136.9 Å²	136.9	81%	0.806	81%	0.806	S	S	*	*			trans	-95	134.9	165.5	174.9	0	0	0	0	106.5
158	N	33	Very low	32.7	Very low	131 Å²	131	136.8 Å²	136.8	70%	0.701	81%	0.805	S	S	*	*			trans	-121.1	127.8	176.5	-164.2	-3.3	0	0	0	109.3
159	S	31	Very low	32.5	Very low	105 Å²	105	134.5 Å²	134.5	73%	0.734	80%	0.801	S	S	*	*			trans	-134.1	124.8	179.9	-69.5	0	0	0	0	108.7
160	I	36.4	Very low	32.7	Very low	152 Å²	152	136.1 Å²	136.1	78%	0.779	80%	0.804	S	S	*	*			trans	-128.2	142.9	178.4	-63.4	-178.5	0	0	0	108.2
161	Q	28.8	Very low	32.7	Very low	174 Å²	174	136 Å²	136	81%	0.813	80%	0.804	S	S	*	*			trans	-112.1	-177.5	-173.1	-58.6	-177	24.2	0	0	112
162	V	28	Very low	32.8	Very low	127 Å²	127	134 Å²	134	77%	0.77	80%	0.798	S	S	*	*			trans	75.6	127	159.8	-176.5	0	0	0	0	117.3
163	L	34.7	Very low	32.9	Very low	173 Å²	173	135.8 Å²	135.8	91%	0.906	80%	0.798	S	S	*	*			trans	-169	153.9	131.6	-101.7	170.7	0	0	0	109.9
164	A	31.8	Very low	33.3	Very low	89 Å²	89	135.2 Å²	135.2	74%	0.736	80%	0.797	S	S	*	*			trans	-143.1	162.2	-173.3	0	0	0	0	0	112.6
165	S	36.3	Very low	33.5	Very low	128 Å²	128	138.9 Å²	138.9	90%	0.895	80%	0.797	S	S	*	*			trans	-161.8	170.7	177.7	-80.6	0	0	0	0	113.3
166	K	35	Very low	33.4	Very low	203 Å²	203	142.3 Å²	142.3	88%	0.883	80%	0.802	S	S	*	*			trans	-122.9	174.8	-160.5	-57	178.8	177.8	-179.6	0	115.2
167	S	33.8	Very low	33.5	Very low	124 Å²	124	140.3 Å²	140.3	87%	0.867	80%	0.797	S	S	*	*			trans	80.8	156.8	159.4	75.6	0	0	0	0	120.3
168	A	32.7	Very low	33.8	Very low	85 Å²	85	139.1 Å²	139.1	70%	0.702	79%	0.792	S	S	*	*			cis	-175.5	-179.9	-30	0	0	0	0	0	112.3
169	I	34.1	Very low	33.7	Very low	156 Å²	156	141.6 Å²	141.6	80%	0.8	80%	0.802	S	S	*	*			trans	86.3	120.9	152.7	-71.5	168	0	0	0	122.1
170	L	32.1	Very low	33.7	Very low	150 Å²	150	143 Å²	143	79%	0.785	81%	0.806	S	S	*	*			trans	61.8	135.5	148	-69.9	172	0	0	0	128
171	E	32.1	Very low	33.4	Very low	177 Å²	177	140.3 Å²	140.3	83%	0.827	81%	0.806	S	S	*	*			trans	83.7	141.1	138	-90.4	179.8	133.1	0	0	128.4
172	A	37.8	Very low	33.3	Very low	80 Å²	80	138.8 Å²	138.8	66%	0.661	81%	0.808	S	S	*	*			trans	79.6	78.1	147.9	0	0	0	0	0	124.9
173	T	36.3	Very low	34	Very low	144 Å²	144	138 Å²	138	88%	0.883	81%	0.806	S	S	*	*			trans	59.2	157	130.3	49.3	0	0	0	0	124.5
174	P	37.9	Very low	33.9	Very low	117 Å²	117	135.1 Å²	135.1	76%	0.76	80%	0.797	S	S	*	*			trans	-130.4	171.3	-155	43.7	-28.8	0	0	0	118.4
175	K	35.6	Very low	33.8	Very low	200 Å²	200	138.1 Å²	138.1	87%	0.87	81%	0.806	S	S	*	*			trans	-172.3	154.4	136.2	-109.5	173.4	-177.1	-177.5	0	114.6
176	E	31.5	Very low	33.6	Very low	175 Å²	175	135.8 Å²	135.8	82%	0.818	80%	0.802	S	S	*	*			trans	65.9	153.8	170.3	-72.8	-59.7	100.7	0	0	120.6
177	V	34.2	Very low	33.5	Very low	123 Å²	123	131.7 Å²	131.7	75%	0.745	80%	0.799	S	S	*	*			trans	-140.3	-170.1	-152.4	-133.9	0	0	0	0	112.5
178	P	36.8	Very low	33.4	Very low	108 Å²	108	135.7 Å²	135.7	70%	0.701	80%	0.801	S	S	*	*				-122.8	158.7	-120.6	41.8	-25.5	0	0	0	117.3
179	M	30.5	Very low	33.3	Very low	184 Å²	184	136.3 Å²	136.3	91%	0.906	81%	0.806	S	S	*	*			trans	-144	110	151	-94.7	-153.2	168.5	0	0	114.2
180	V	30.6	Very low	33	Very low	135 Å²	135	134 Å²	134	82%	0.818	80%	0.804	S	S	*	*			trans	63.4	144.5	139.7	-168.6	0	0	0	0	120.1
181	A	31.8	Very low	33.4	Very low	95 Å²	95	132.1 Å²	132.1	79%	0.785	80%	0.804	S	S	*	*			trans	85.5	90.3	170.6	0	0	0	0	0	118
182	V	26	Very low	33.8	Very low	141 Å²	141	129.1 Å²	129.1	86%	0.855	80%	0.799	S	S	*	*			trans	-58.9	142	-179.5	177.8	0	0	0	0	115
183	P	41.6	Very low	34.1	Very low	111 Å²	111	127.7 Å²	127.7	72%	0.721	79%	0.788	S	S	*	*			trans	-92.8	174.1	177.1	38.9	-38.2	0	0	0	114
184	P	34.3	Very low	35	Very low	112 Å²	112	124 Å²	124	73%	0.727	77%	0.765	S	S	*	*			trans	-149.8	151.6	132.5	37.2	-20.5	0	0	0	118.4
185	V	28.8	Very low	35.7	Very low	152 Å²	152	122.2 Å²	122.2	92%	0.921	76%	0.756	S	S	*	*			trans	60.2	138.3	149.9	-60.2	0	0	0	0	123.8
186	G	32.8	Very low	36.9	Very low	79 Å²	79	114.2 Å²	114.2	81%	0.814	72%	0.724	S	S	*	*			trans	163	81.7	157	0	0	0	0	0	116.7
187	S	32.3	Very low	38	Very low	117 Å²	117	113.4 Å²	113.4	82%	0.818	72%	0.721	S	S	*	*			trans	-119.4	139.3	-176.2	-60	0	0	0	0	115
188	K	31.4	Very low	38.8	Very low	208 Å²	208	109.1 Å²	109.1	90%	0.904	70%	0.701	S	S	*	*			trans	70.3	150.2	165.9	-59.8	-161.2	179.5	-172.3	0	120.2
189	A	30.9	Very low	39.5	Very low	98 Å²	98	112.3 Å²	112.3	81%	0.81	70%	0.704	S	S	*	*			trans	64.7	72.7	144.7	0	0	0	0	0	120.9
190	S	28	Very low	40.2	Very low	108 Å²	108	112.8 Å²	112.8	76%	0.755	70%	0.701	S	S	*	*				-164.5	147.8	123.7	42.5	0	0	0	0	110
191	S	39.7	Very low	41	Very low	111 Å²	111	108.6 Å²	108.6	78%	0.776	69%	0.685	S	S	*	*			trans	-62.3	126.7	171.2	55.9	0	0	0	0	108.2	A193	S191-A193 PolarHBondContact O-N 2.98Å; S191-A193 VanDerWaalsContact O-N 3.08Å
192	P	40.5	Very low	42.1	Very low	113 Å²	113	113.4 Å²	113.4	73%	0.734	69%	0.691	S	S	*	*			trans	-59.4	116.4	-154.1	19.5	-32.9	0	0	0	112.2	T194	P192-T194 PolarHBondContact O-N 2.94Å
193	A	44.9	Very low	43.6	Very low	51 Å²	51	108.4 Å²	108.4	42%	0.421	67%	0.669	S	S	.	*			trans	-57.7	107.4	162.7	0	0	0	0	0	107.2	S191 S195	S191-A193 PolarHBondContact O-N 2.98Å; S191-A193 VanDerWaalsContact O-N 3.08Å; A193-S195 VanDerWaalsContact C-N 3.27Å; A193-S195 PolarHBondContact O-N 2.86Å
194	T	54.7	Low	44.7	Very low	65 Å²	65	104.7 Å²	104.7	40%	0.399	65%	0.647	S	S	.	*			trans	-68.9	89.2	-175	56.6	0	0	0	0	108.6	P192 Q215	P192-T194 PolarHBondContact O-N 2.94Å; T194-Q215 PolarHBondContact O-N 2.83Å; T194-Q215 VanDerWaalsContact O-N 3.07Å
195	S	53.7	Low	46.4	Very low	81 Å²	81	104.1 Å²	104.1	57%	0.566	64%	0.635	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-103.1	126.4	-179.1	67.1	0	0	0	0	110	A193 Q215	A193-S195 VanDerWaalsContact C-N 3.27Å; A193-S195 PolarHBondContact O-N 2.86Å; S195-Q215 CarbonylContact C-O 3.59Å; S195-Q215 WeakPolarHBondContact CA-O 3.47Å
196	S	59.4	Low	48.4	Very low	31 Å²	31	98.2 Å²	98.2	22%	0.217	60%	0.598	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-115.8	131.5	177.3	76.2	0	0	0	0	110.3	A204 Q215 N216 Q217	S196-A204 VanDerWaalsContact OG-CB 3.26Å; S196-A204 WeakPolarHBondContact OG-CB 3.38Å; S196-Q215 PolarHBondContact N-O 2.81Å; S196-N216 PolarHBondContact OG-OD1 2.63Å; S196-Q217 PolarHBondContact O-N 2.88Å
197	Q	56.1	Low	50.1	Low	159 Å²	159	100.8 Å²	100.8	74%	0.743	59%	0.589	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-121.6	85.8	179.5	-67.5	-159.1	16.2	0	0	111.9	Q217	Q197-Q217 WeakPolarHBondContact CA-O 3.32Å
198	G	51	Low	51.7	Low	32 Å²	32	97 Å²	97	33%	0.33	57%	0.565	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-82.4	118.1	179.5	0	0	0	0	0	113.4	Q217	G198-Q217 PolarHBondContact N-O 3.44Å
199	K	51.1	Low	53.2	Low	175 Å²	175	95.4 Å²	95.4	76%	0.761	56%	0.558	S	S	*	*	S	Bend	trans	-71.4	-44.7	167.1	-72.8	-180	-176.9	170.4	0	111.2
200	K	43.6	Very low	54.4	Low	194 Å²	194	99.2 Å²	99.2	84%	0.843	56%	0.557	S	S	*	*	S	Bend	trans	-146.2	132.7	163.3	-65.1	176.6	-177.4	174.3	0	105.2
201	G	49.3	Very low	55.7	Low	47 Å²	47	95.7 Å²	95.7	49%	0.485	54%	0.537	S	S	.	.			trans	-176.8	146.2	179	0	0	0	0	0	111.9
202	Q	53.8	Low	56.5	Low	196 Å²	196	97.4 Å²	97.4	92%	0.916	53%	0.533	S	S	*	.	S	Bend	trans	-71	163.3	172.7	-66.8	167	-6.7	0	0	110.1	A204	Q202-A204 PolarHBondContact O-N 2.85Å
203	G	56.9	Low	57.4	Low	37 Å²	37	93.1 Å²	93.1	38%	0.381	51%	0.509	S	S	.	.			trans	-45.4	107.6	-164.6	0	0	0	0	0	115.9	Q205 E222 G223	G203-Q205 PolarHBondContact O-N 3.49Å; G203-E222 WeakPolarHBondContact CA-O 3.36Å; G203-E222 PolarHBondContact N-O 2.82Å; G203-G223 WeakPolarHBondContact CA-O 3.32Å
204	A	65.4	Low	58.6	Low	33 Å²	33	91.5 Å²	91.5	27%	0.273	50%	0.495	S	S	.	.			trans	-62	122.2	171.2	0	0	0	0	0	109.8	S196 Q202 Q225	S196-A204 VanDerWaalsContact OG-CB 3.26Å; S196-A204 WeakPolarHBondContact OG-CB 3.38Å; Q202-A204 PolarHBondContact O-N 2.85Å; A204-Q225 PolarHBondContact O-N 2.76Å
205	Q	69.6	Low	59.4	Low	100 Å²	100	91.5 Å²	91.5	47%	0.467	49%	0.491	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	107.1	-175.5	-172.8	-177.5	64.9	0	0	111.1	G203 Q207 Q225	G203-Q205 PolarHBondContact O-N 3.49Å; Q205-Q207 HydrophobicContact CG-CG 4.23Å; Q205-Q207 VanDerWaalsContact OE1-NE2 3.12Å; Q205-Q225 CarbonylContact C-O 3.55Å; Q205-Q225 VanDerWaalsContact CA-O 3.27Å; Q205-Q225 WeakPolarHBondContact CA-O 3.02Å; Q205-Q225 HydrophobicContact CB-CB 4.42Å; Q205-Q225 HydrophobicContact CG-CB 4.03Å
206	N	70.4	Confident	60.2	Low	28 Å²	28	87.9 Å²	87.9	15%	0.15	47%	0.465	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.2	127.2	173.7	-56.8	-50.7	0	0	0	110	A214 N216 Q225 N226 Q227	N206-A214 HydrophobicContact CB-CB 4.43Å; N206-N216 PolarHBondContact ND2-ND2 2.85Å; N206-N216 PolarHBondContact ND2-OD1 3.49Å; N206-Q225 PolarHBondContact N-O 3.01Å; N206-N226 WeakPolarHBondContact CB-OD1 3.36Å; N206-N226 PolarHBondContact ND2-OD1 2.89Å; N206-N226 WeakPolarHBondContact O-CA 3.38Å; N206-Q227 PolarHBondContact O-N 2.83Å
207	Q	70.5	Confident	60.8	Low	132 Å²	132	90 Å²	90	62%	0.617	47%	0.471	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-122.4	125.6	175	-57.7	-163.3	32.2	0	0	111.3	Q205 Q227	Q205-Q207 HydrophobicContact CG-CG 4.23Å; Q205-Q207 VanDerWaalsContact OE1-NE2 3.12Å; Q207-Q227 WeakPolarHBondContact CA-O 3.31Å; Q207-Q227 HydrophobicContact CG-CB 4.39Å
208	A	65.6	Low	61.2	Low	39 Å²	39	83.4 Å²	83.4	32%	0.322	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.5	140.6	-173.3	0	0	0	0	0	114.6	Q227 A228 K229	A208-Q227 PolarHBondContact N-O 2.92Å; A208-A228 WeakPolarHBondContact O-CA 3.29Å; A208-K229 PolarHBondContact O-N 3.34Å; A208-K229 VanDerWaalsContact O-N 3.14Å
209	K	61.4	Low	61.8	Low	174 Å²	174	88 Å²	88	76%	0.757	46%	0.457	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.9	-48.8	172.7	-67	177.7	-174.6	171.3	0	111	K229 K230	K209-K229 WeakPolarHBondContact O-CB 3.43Å; K209-K230 PolarHBondContact O-N 3.23Å
210	K	56.4	Low	62.1	Low	178 Å²	178	86.1 Å²	86.1	77%	0.774	45%	0.449	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-128	147.6	158.8	-74.7	-179.4	178.4	177.7	0	106.4	K230	K210-K230 WeakPolarHBondContact CA-O 3.43Å
211	G	54.9	Low	62.7	Low	33 Å²	33	78 Å²	78	34%	0.34	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-172.2	137.6	172.7	0	0	0	0	0	112.8	K230 G231 E232	G211-K230 PolarHBondContact N-O 3.32Å; G211-G231 WeakPolarHBondContact O-CA 3.4Å; G211-E232 PolarHBondContact O-N 3.02Å
212	E	58.1	Low	63.3	Low	148 Å²	148	80.7 Å²	80.7	69%	0.692	42%	0.42	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.1	146.3	170.7	-73.3	159.3	-151.9	0	0	108.8	A214 E232	E212-A214 PolarHBondContact O-N 2.97Å; E212-E232 CarbonylContact C-O 3.57Å; E212-E232 WeakPolarHBondContact CA-O 3.35Å; E212-E232 HydrophobicContact CG-CB 4.39Å
213	G	58.9	Low	63.6	Low	22 Å²	22	72.8 Å²	72.8	23%	0.227	39%	0.392	C	S	.	.			trans	66	30.8	163.6	0	0	0	0	0	117.1	Q215 E232	G213-Q215 WeakPolarHBondContact O-CG 2.91Å; G213-Q215 PolarHBondContact O-N 3.26Å; G213-E232 PolarHBondContact N-O 3.37Å
214	A	69.1	Low	64.3	Low	17 Å²	17	72 Å²	72	14%	0.14	38%	0.381	C	S	.	.			trans	-63.1	117.1	170.4	0	0	0	0	0	110.4	N206 E212 A234 Q235	N206-A214 HydrophobicContact CB-CB 4.43Å; E212-A214 PolarHBondContact O-N 2.97Å; A214-A234 CarbonylContact O-C 3.55Å; A214-A234 WeakPolarHBondContact O-CA 3.36Å; A214-Q235 PolarHBondContact O-N 2.94Å
215	Q	71.9	Confident	64.8	Low	65 Å²	65	72.6 Å²	72.6	30%	0.304	38%	0.379	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.2	112.9	-170.5	-73.3	-163.8	-0.8	0	0	113.4	T194 S195 S196 G213 Q235	T194-Q215 PolarHBondContact O-N 2.83Å; T194-Q215 VanDerWaalsContact O-N 3.07Å; S195-Q215 CarbonylContact C-O 3.59Å; S195-Q215 WeakPolarHBondContact CA-O 3.47Å; S196-Q215 PolarHBondContact N-O 2.81Å; G213-Q215 WeakPolarHBondContact O-CG 2.91Å; G213-Q215 PolarHBondContact O-N 3.26Å; Q215-Q235 CarbonylContact C-O 3.54Å; Q215-Q235 WeakPolarHBondContact CA-O 3.35Å; Q215-Q235 HydrophobicContact CG-CB 4.31Å
216	N	71.5	Confident	64.9	Low	6 Å²	6	68.1 Å²	68.1	3%	0.032	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	122.5	172.8	-57.4	-46.9	0	0	0	110.4	S196 N206 A224 N226 Q235 N236 Q237	S196-N216 PolarHBondContact OG-OD1 2.63Å; N206-N216 PolarHBondContact ND2-ND2 2.85Å; N206-N216 PolarHBondContact ND2-OD1 3.49Å; N216-A224 HydrophobicContact CB-CB 4.29Å; N216-N226 PolarHBondContact ND2-OD1 2.86Å; N216-Q235 PolarHBondContact N-O 3.41Å; N216-N236 WeakPolarHBondContact CB-OD1 3.29Å; N216-N236 PolarHBondContact ND2-OD1 3.27Å; N216-N236 CarbonylContact O-C 3.56Å; N216-N236 WeakPolarHBondContact O-CA 3.28Å; N216-Q237 PolarHBondContact O-N 2.94Å
217	Q	72.1	Confident	65.1	Low	74 Å²	74	69.8 Å²	69.8	35%	0.346	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	127	179.4	-56.5	-163.1	30	0	0	111.9	S196 Q197 G198 Q237	S196-Q217 PolarHBondContact O-N 2.88Å; Q197-Q217 WeakPolarHBondContact CA-O 3.32Å; G198-Q217 PolarHBondContact N-O 3.44Å; Q217-Q237 WeakPolarHBondContact CA-O 3.25Å; Q217-Q237 HydrophobicContact CG-CB 4.37Å
218	G	63.5	Low	65	Low	21 Å²	21	64.9 Å²	64.9	22%	0.216	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.2	146.5	-171.8	0	0	0	0	0	116.4	Q237 A238 K239	G218-Q237 PolarHBondContact N-O 2.85Å; G218-A238 WeakPolarHBondContact O-CA 3.3Å; G218-K239 PolarHBondContact O-N 2.83Å; G218-K239 VanDerWaalsContact O-N 3.14Å
219	K	62.9	Low	65	Low	129 Å²	129	69 Å²	69	56%	0.561	36%	0.358	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.2	-48.6	169.3	-71.7	-176.3	-177.2	179.6	0	111.1	K239 K240	K219-K239 WeakPolarHBondContact O-CB 3.39Å; K219-K240 PolarHBondContact O-N 2.89Å; K219-K240 VanDerWaalsContact O-N 3.14Å
220	K	57.9	Low	64.9	Low	135 Å²	135	65.3 Å²	65.3	59%	0.587	34%	0.342	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-127.7	138.5	162.4	-71.2	-174	177.7	-174.6	0	107.1	K240	K220-K240 WeakPolarHBondContact CA-O 3.42Å
221	G	57	Low	65.1	Low	24 Å²	24	57.4 Å²	57.4	25%	0.247	31%	0.311	C	S	.	.			trans	-168.2	126.4	172.4	0	0	0	0	0	111.1	K240 G241	G221-K240 PolarHBondContact N-O 2.82Å; G221-G241 WeakPolarHBondContact O-CA 3.33Å
222	E	60.4	Low	65.5	Low	103 Å²	103	59.1 Å²	59.1	48%	0.481	31%	0.31	S	S	.	.	S	Bend	trans	-101.7	143.3	171.6	-75	117.2	-142.2	0	0	109.1	G203 A224 K240 E242	G203-E222 WeakPolarHBondContact CA-O 3.36Å; G203-E222 PolarHBondContact N-O 2.82Å; E222-A224 PolarHBondContact O-N 3.12Å; E222-K240 IonicContact OE1-NZ 3.06Å; E222-K240 PolarHBondContact OE1-NZ 2.96Å; E222-E242 WeakPolarHBondContact CA-O 2.99Å; E222-E242 HydrophobicContact CG-CB 4.15Å
223	G	61.8	Low	65.8	Low	31 Å²	31	53.2 Å²	53.2	32%	0.32	29%	0.289	S	S	.	.			trans	68.2	28.4	168	0	0	0	0	0	117.2	G203 Q225 E242	G203-G223 WeakPolarHBondContact CA-O 3.32Å; G223-Q225 PolarHBondContact O-N 3.08Å; G223-E242 PolarHBondContact N-O 2.83Å
224	A	71.8	Confident	66.5	Low	19 Å²	19	53.2 Å²	53.2	16%	0.157	29%	0.286	C	S	.	.			trans	-63	126.6	173.1	0	0	0	0	0	111.1	N216 E222 A244 Q245	N216-A224 HydrophobicContact CB-CB 4.29Å; E222-A224 PolarHBondContact O-N 3.12Å; A224-A244 CarbonylContact O-C 3.55Å; A224-A244 WeakPolarHBondContact O-CA 3.12Å; A224-Q245 PolarHBondContact O-N 3.36Å
225	Q	74.5	Confident	66.9	Low	46 Å²	46	54.4 Å²	54.4	22%	0.215	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	133.4	-173.1	-71.7	-167.8	-0.2	0	0	112.7	A204 Q205 N206 G223 Q245	A204-Q225 PolarHBondContact O-N 2.76Å; Q205-Q225 CarbonylContact C-O 3.55Å; Q205-Q225 VanDerWaalsContact CA-O 3.27Å; Q205-Q225 WeakPolarHBondContact CA-O 3.02Å; Q205-Q225 HydrophobicContact CB-CB 4.42Å; Q205-Q225 HydrophobicContact CG-CB 4.03Å; N206-Q225 PolarHBondContact N-O 3.01Å; G223-Q225 PolarHBondContact O-N 3.08Å; Q225-Q245 CarbonylContact C-O 3.56Å; Q225-Q245 VanDerWaalsContact CA-O 3.31Å; Q225-Q245 WeakPolarHBondContact CA-O 3.38Å; Q225-Q245 HydrophobicContact CG-CB 4.31Å; Q225-Q245 VanDerWaalsContact NE2-OE1 3.09Å
226	N	73.1	Confident	67	Low	7 Å²	7	51.6 Å²	51.6	4%	0.037	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	128.7	165.8	-58.2	-56.3	0	0	0	110	N206 N216 A234 N236 Q245 N246 Q247	N206-N226 WeakPolarHBondContact CB-OD1 3.36Å; N206-N226 PolarHBondContact ND2-OD1 2.89Å; N206-N226 WeakPolarHBondContact O-CA 3.38Å; N216-N226 PolarHBondContact ND2-OD1 2.86Å; N226-A234 HydrophobicContact CB-CB 4.28Å; N226-N236 PolarHBondContact ND2-ND2 3.43Å; N226-N236 PolarHBondContact ND2-OD1 2.84Å; N226-Q245 PolarHBondContact N-O 3.26Å; N226-N246 WeakPolarHBondContact CB-OD1 3.38Å; N226-N246 PolarHBondContact ND2-OD1 3.25Å; N226-N246 CarbonylContact O-C 3.53Å; N226-N246 WeakPolarHBondContact O-CA 3.33Å; N226-Q247 PolarHBondContact O-N 2.97Å
227	Q	74.6	Confident	67.2	Low	63 Å²	63	54.5 Å²	54.5	29%	0.294	29%	0.29	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.7	116.9	178.3	-55	-165.6	24.2	0	0	111.4	N206 Q207 A208 Q247	N206-Q227 PolarHBondContact O-N 2.83Å; Q207-Q227 WeakPolarHBondContact CA-O 3.31Å; Q207-Q227 HydrophobicContact CG-CB 4.39Å; A208-Q227 PolarHBondContact N-O 2.92Å; Q227-Q247 WeakPolarHBondContact CA-O 3.41Å; Q227-Q247 HydrophobicContact CG-CB 4.44Å
228	A	67.9	Low	67	Low	29 Å²	29	52.1 Å²	52.1	24%	0.24	28%	0.283	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	138.1	-175.3	0	0	0	0	0	114.1	A208 Q247 G248 K249	A208-A228 WeakPolarHBondContact O-CA 3.29Å; A228-Q247 PolarHBondContact N-O 2.88Å; A228-G248 WeakPolarHBondContact O-CA 3Å; A228-K249 PolarHBondContact O-N 2.85Å
229	K	65.1	Low	67.1	Low	125 Å²	125	57 Å²	57	54%	0.543	30%	0.298	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75	-48	173.5	-63.8	178.3	-177.1	176.3	0	111.4	A208 K209 K249 K250	A208-K229 PolarHBondContact O-N 3.34Å; A208-K229 VanDerWaalsContact O-N 3.14Å; K209-K229 WeakPolarHBondContact O-CB 3.43Å; K229-K249 WeakPolarHBondContact O-CB 3.37Å; K229-K250 PolarHBondContact O-N 2.83Å; K229-K250 VanDerWaalsContact O-N 3.12Å
230	K	60	Low	67.2	Low	96 Å²	96	53.9 Å²	53.9	42%	0.417	29%	0.285	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	134.7	156.6	-172.4	-164.6	-174.8	-110.1	0	107.5	K209 K210 G211 E232 K250	K209-K230 PolarHBondContact O-N 3.23Å; K210-K230 WeakPolarHBondContact CA-O 3.43Å; G211-K230 PolarHBondContact N-O 3.32Å; K230-E232 WeakPolarHBondContact CE-OE1 3.42Å; K230-E232 IonicContact NZ-OE1 2.69Å; K230-E232 PolarHBondContact NZ-OE1 3.04Å; K230-K250 WeakPolarHBondContact CA-O 3.35Å; K230-K250 HydrophobicContact CG-CB 4.4Å
231	G	60.5	Low	67.4	Low	12 Å²	12	47.8 Å²	47.8	12%	0.124	26%	0.26	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-166.3	155.2	170.3	0	0	0	0	0	114.3	G211 K250 G251 E252	G211-G231 WeakPolarHBondContact O-CA 3.4Å; G231-K250 PolarHBondContact N-O 3.01Å; G231-G251 WeakPolarHBondContact O-CA 3.33Å; G231-E252 PolarHBondContact O-N 3.2Å
232	E	63.9	Low	67.7	Low	69 Å²	69	49.2 Å²	49.2	32%	0.322	26%	0.26	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.2	138.5	-173.4	-78.3	152.6	-123.4	0	0	109.9	G211 E212 G213 K230 E252	G211-E232 PolarHBondContact O-N 3.02Å; E212-E232 CarbonylContact C-O 3.57Å; E212-E232 WeakPolarHBondContact CA-O 3.35Å; E212-E232 HydrophobicContact CG-CB 4.39Å; G213-E232 PolarHBondContact N-O 3.37Å; K230-E232 WeakPolarHBondContact CE-OE1 3.42Å; K230-E232 IonicContact NZ-OE1 2.69Å; K230-E232 PolarHBondContact NZ-OE1 3.04Å; E232-E252 WeakPolarHBondContact CA-O 3.4Å; E232-E252 HydrophobicContact CG-CB 4.18Å
233	G	63.1	Low	67.9	Low	24 Å²	24	45.6 Å²	45.6	25%	0.247	25%	0.25	C	C	.	.			trans	68.5	34.4	174	0	0	0	0	0	116	Q235 E252	G233-Q235 PolarHBondContact O-N 2.83Å; G233-E252 PolarHBondContact N-O 3.07Å
234	A	73.2	Confident	68.5	Low	22 Å²	22	45.1 Å²	45.1	18%	0.182	24%	0.243	C	C	.	.			trans	-69.4	121	172.2	0	0	0	0	0	110.9	A214 N226 A254 Q255	A214-A234 CarbonylContact O-C 3.55Å; A214-A234 WeakPolarHBondContact O-CA 3.36Å; N226-A234 HydrophobicContact CB-CB 4.28Å; A234-A254 CarbonylContact O-C 3.5Å; A234-A254 WeakPolarHBondContact O-CA 3.38Å; A234-Q255 PolarHBondContact O-N 3.46Å
235	Q	77.4	Confident	68.8	Low	43 Å²	43	46.1 Å²	46.1	20%	0.201	24%	0.244	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.2	134.2	-174.9	-54.2	-174.9	-1.4	0	0	113.3	A214 Q215 N216 G233 Q255	A214-Q235 PolarHBondContact O-N 2.94Å; Q215-Q235 CarbonylContact C-O 3.54Å; Q215-Q235 WeakPolarHBondContact CA-O 3.35Å; Q215-Q235 HydrophobicContact CG-CB 4.31Å; N216-Q235 PolarHBondContact N-O 3.41Å; G233-Q235 PolarHBondContact O-N 2.83Å; Q235-Q255 CarbonylContact C-O 3.56Å; Q235-Q255 VanDerWaalsContact CA-O 3.31Å; Q235-Q255 WeakPolarHBondContact CA-O 3.38Å; Q235-Q255 HydrophobicContact CG-CB 4.22Å
236	N	74.4	Confident	68.9	Low	6 Å²	6	44.2 Å²	44.2	3%	0.032	24%	0.236	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	127.4	168.6	-58.4	-54.8	0	0	0	110.1	N216 N226 A244 N246 Q255 N256 Q257	N216-N236 WeakPolarHBondContact CB-OD1 3.29Å; N216-N236 PolarHBondContact ND2-OD1 3.27Å; N216-N236 CarbonylContact O-C 3.56Å; N216-N236 WeakPolarHBondContact O-CA 3.28Å; N226-N236 PolarHBondContact ND2-ND2 3.43Å; N226-N236 PolarHBondContact ND2-OD1 2.84Å; N236-A244 HydrophobicContact CB-CB 3.99Å; N236-N246 PolarHBondContact ND2-OD1 3.46Å; N236-Q255 PolarHBondContact N-O 3.48Å; N236-N256 WeakPolarHBondContact CB-OD1 3.43Å; N236-N256 PolarHBondContact ND2-OD1 3.09Å; N236-N256 CarbonylContact O-C 3.56Å; N236-N256 WeakPolarHBondContact O-CA 3.38Å; N236-Q257 PolarHBondContact O-N 2.8Å
237	Q	75.7	Confident	69.2	Low	66 Å²	66	47.2 Å²	47.2	31%	0.308	25%	0.25	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	121.4	179.9	-54.8	-165.1	28.7	0	0	112.5	N216 Q217 G218 Q257	N216-Q237 PolarHBondContact O-N 2.94Å; Q217-Q237 WeakPolarHBondContact CA-O 3.25Å; Q217-Q237 HydrophobicContact CG-CB 4.37Å; G218-Q237 PolarHBondContact N-O 2.85Å; Q237-Q257 WeakPolarHBondContact CA-O 3.26Å; Q237-Q257 HydrophobicContact CG-CB 4.32Å
238	A	68.3	Low	68.9	Low	25 Å²	25	45.3 Å²	45.3	21%	0.207	25%	0.246	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	142.8	-174.8	0	0	0	0	0	114.4	G218 Q257 K259	G218-A238 WeakPolarHBondContact O-CA 3.3Å; A238-Q257 PolarHBondContact N-O 2.85Å; A238-K259 PolarHBondContact O-N 2.61Å
239	K	66.3	Low	68.9	Low	122 Å²	122	49.6 Å²	49.6	53%	0.53	26%	0.26	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81	-49.9	170.2	-60.5	-175.9	-179.7	-179.5	0	111.9	G218 K219 K259 K260	G218-K239 PolarHBondContact O-N 2.83Å; G218-K239 VanDerWaalsContact O-N 3.14Å; K219-K239 WeakPolarHBondContact O-CB 3.39Å; K239-K259 HydrophobicContact CG-CD 4.43Å; K239-K259 WeakPolarHBondContact O-CB 3.31Å; K239-K260 PolarHBondContact O-N 2.92Å
240	K	64	Low	68.9	Low	65 Å²	65	49.6 Å²	49.6	28%	0.283	26%	0.26	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	137.6	153.6	-177	-165	176.1	-76	0	107.8	K219 K220 G221 E222 E242 K260	K219-K240 PolarHBondContact O-N 2.89Å; K219-K240 VanDerWaalsContact O-N 3.14Å; K220-K240 WeakPolarHBondContact CA-O 3.42Å; G221-K240 PolarHBondContact N-O 2.82Å; E222-K240 IonicContact OE1-NZ 3.06Å; E222-K240 PolarHBondContact OE1-NZ 2.96Å; K240-E242 VanDerWaalsContact CE-OE1 3.25Å; K240-E242 WeakPolarHBondContact CE-OE1 3.35Å; K240-E242 IonicContact NZ-OE1 3.35Å; K240-E242 PolarHBondContact NZ-OE1 2.96Å; K240-E242 IonicContact NZ-OE2 2.89Å; K240-E242 PolarHBondContact NZ-OE2 3.49Å; K240-K260 VanDerWaalsContact CA-O 3.3Å; K240-K260 WeakPolarHBondContact CA-O 3.29Å
241	G	62.2	Low	69.1	Low	6 Å²	6	46 Å²	46	6%	0.062	25%	0.25	C	C	.	.			trans	-173.3	147.6	171.2	0	0	0	0	0	112.2	G221 K260 G261	G221-G241 WeakPolarHBondContact O-CA 3.33Å; G241-K260 PolarHBondContact N-O 2.85Å; G241-G261 WeakPolarHBondContact O-CA 3.41Å
242	E	63.9	Low	69.5	Low	55 Å²	55	49.1 Å²	49.1	26%	0.257	26%	0.261	S	S	.	.	S	Bend	trans	-118	140.3	179	-79.8	104.8	-118.4	0	0	109.5	E222 G223 K240 E262	E222-E242 WeakPolarHBondContact CA-O 2.99Å; E222-E242 HydrophobicContact CG-CB 4.15Å; G223-E242 PolarHBondContact N-O 2.83Å; K240-E242 VanDerWaalsContact CE-OE1 3.25Å; K240-E242 WeakPolarHBondContact CE-OE1 3.35Å; K240-E242 IonicContact NZ-OE1 3.35Å; K240-E242 PolarHBondContact NZ-OE1 2.96Å; K240-E242 IonicContact NZ-OE2 2.89Å; K240-E242 PolarHBondContact NZ-OE2 3.49Å; E242-E262 HydrophobicContact CB-CB 4.09Å; E242-E262 HydrophobicContact CG-CB 3.73Å; E242-E262 HydrophobicContact CG-CG 3.82Å
243	G	64.5	Low	69.6	Low	26 Å²	26	47 Å²	47	27%	0.268	26%	0.258	S	S	.	.			trans	68.5	38.1	165.5	0	0	0	0	0	117.1	E262	G243-E262 PolarHBondContact N-O 3.46Å
244	A	75	Confident	70.3	Confident	21 Å²	21	46.9 Å²	46.9	17%	0.174	25%	0.254	C	S	.	.			trans	-69.3	129.1	172.3	0	0	0	0	0	111.4	A224 N236 G264 Q265	A224-A244 CarbonylContact O-C 3.55Å; A224-A244 WeakPolarHBondContact O-CA 3.12Å; N236-A244 HydrophobicContact CB-CB 3.99Å; A244-G264 CarbonylContact O-C 3.54Å; A244-G264 WeakPolarHBondContact O-CA 3.33Å; A244-Q265 PolarHBondContact O-N 2.89Å
245	Q	78.5	Confident	70.6	Confident	40 Å²	40	47.8 Å²	47.8	19%	0.187	26%	0.255	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.4	138	-175.1	-55.2	-177.2	-45.5	0	0	113.2	A224 Q225 N226 Q265	A224-Q245 PolarHBondContact O-N 3.36Å; Q225-Q245 CarbonylContact C-O 3.56Å; Q225-Q245 VanDerWaalsContact CA-O 3.31Å; Q225-Q245 WeakPolarHBondContact CA-O 3.38Å; Q225-Q245 HydrophobicContact CG-CB 4.31Å; Q225-Q245 VanDerWaalsContact NE2-OE1 3.09Å; N226-Q245 PolarHBondContact N-O 3.26Å; Q245-Q265 CarbonylContact C-O 3.54Å; Q245-Q265 VanDerWaalsContact CA-O 3.28Å; Q245-Q265 WeakPolarHBondContact CA-O 3.43Å; Q245-Q265 HydrophobicContact CG-CB 4.25Å
246	N	76	Confident	70.7	Confident	7 Å²	7	46.1 Å²	46.1	4%	0.037	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.7	126.6	167.4	-58.8	-55.3	0	0	0	109.4	N226 N236 A254 N256 Q265 N266 Q267	N226-N246 WeakPolarHBondContact CB-OD1 3.38Å; N226-N246 PolarHBondContact ND2-OD1 3.25Å; N226-N246 CarbonylContact O-C 3.53Å; N226-N246 WeakPolarHBondContact O-CA 3.33Å; N236-N246 PolarHBondContact ND2-OD1 3.46Å; N246-A254 HydrophobicContact CB-CB 4.2Å; N246-N256 PolarHBondContact ND2-OD1 3Å; N246-Q265 PolarHBondContact N-O 3.07Å; N246-N266 WeakPolarHBondContact CB-OD1 3.35Å; N246-N266 PolarHBondContact ND2-OD1 2.93Å; N246-N266 CarbonylContact O-C 3.59Å; N246-N266 WeakPolarHBondContact O-CA 3.32Å; N246-Q267 PolarHBondContact O-N 3.18Å
247	Q	78.4	Confident	70.8	Confident	70 Å²	70	49 Å²	49	33%	0.327	26%	0.26	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	140.3	-179.5	-55.4	-165	25.5	0	0	112.3	N226 Q227 A228 Q267	N226-Q247 PolarHBondContact O-N 2.97Å; Q227-Q247 WeakPolarHBondContact CA-O 3.41Å; Q227-Q247 HydrophobicContact CG-CB 4.44Å; A228-Q247 PolarHBondContact N-O 2.88Å; Q247-Q267 CarbonylContact C-O 3.54Å; Q247-Q267 WeakPolarHBondContact CA-O 3.4Å; Q247-Q267 HydrophobicContact CG-CB 4.34Å
248	G	68.5	Low	70.6	Confident	22 Å²	22	47 Å²	47	23%	0.227	26%	0.256	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-167.9	168.3	175.2	0	0	0	0	0	118.5	A228 Q267 A268 K269	A228-G248 WeakPolarHBondContact O-CA 3Å; G248-Q267 PolarHBondContact N-O 3.43Å; G248-A268 WeakPolarHBondContact O-CA 3.26Å; G248-K269 PolarHBondContact O-N 3.04Å; G248-K269 VanDerWaalsContact O-N 3.09Å
249	K	68.5	Low	70.5	Confident	119 Å²	119	51.4 Å²	51.4	52%	0.517	27%	0.27	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.1	-47.8	175.5	-59.2	-175	-178.4	-174.2	0	111.7	A228 K229 K269 K270	A228-K249 PolarHBondContact O-N 2.85Å; K229-K249 WeakPolarHBondContact O-CB 3.37Å; K249-K269 HydrophobicContact CG-CD 4.45Å; K249-K269 WeakPolarHBondContact O-CB 3.31Å; K249-K270 PolarHBondContact O-N 3.15Å
250	K	65.6	Low	70.5	Confident	125 Å²	125	51.9 Å²	51.9	54%	0.543	27%	0.272	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	135.2	165	-68.7	-175.7	178.9	-178.3	0	108	K229 K230 G231 K270	K229-K250 PolarHBondContact O-N 2.83Å; K229-K250 VanDerWaalsContact O-N 3.12Å; K230-K250 WeakPolarHBondContact CA-O 3.35Å; K230-K250 HydrophobicContact CG-CB 4.4Å; G231-K250 PolarHBondContact N-O 3.01Å; K250-K270 WeakPolarHBondContact CA-O 3.45Å; K250-K270 HydrophobicContact CG-CB 4.47Å
251	G	64.3	Low	70.4	Confident	20 Å²	20	49.4 Å²	49.4	21%	0.206	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-173.2	152.1	169	0	0	0	0	0	115.1	G231 K270 G271 E272	G231-G251 WeakPolarHBondContact O-CA 3.33Å; G251-K270 PolarHBondContact N-O 2.92Å; G251-G271 WeakPolarHBondContact O-CA 3.4Å; G251-E272 PolarHBondContact O-N 2.96Å
252	E	67.8	Low	70.5	Confident	79 Å²	79	55.1 Å²	55.1	37%	0.369	29%	0.29	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	141.3	-167	-55	177	-171.6	0	0	109.5	G231 E232 G233 A254 K270 E272	G231-E252 PolarHBondContact O-N 3.2Å; E232-E252 WeakPolarHBondContact CA-O 3.4Å; E232-E252 HydrophobicContact CG-CB 4.18Å; G233-E252 PolarHBondContact N-O 3.07Å; E252-A254 PolarHBondContact O-N 2.85Å; E252-K270 IonicContact OE1-NZ 3.14Å; E252-K270 PolarHBondContact OE1-NZ 2.93Å; E252-E272 CarbonylContact C-O 3.46Å; E252-E272 VanDerWaalsContact CA-O 3.27Å; E252-E272 WeakPolarHBondContact CA-O 3.49Å; E252-E272 HydrophobicContact CG-CB 4.24Å
253	G	66.2	Low	70.5	Confident	25 Å²	25	53 Å²	53	26%	0.258	28%	0.284	S	S	.	.			trans	67.9	32	178.6	0	0	0	0	0	115.9	Q255 E272	G253-Q255 PolarHBondContact O-N 2.95Å; G253-E272 PolarHBondContact N-O 2.84Å
254	A	76.9	Confident	70.9	Confident	20 Å²	20	52.2 Å²	52.2	17%	0.165	28%	0.275	C	S	.	.			trans	-71.4	120.9	175.5	0	0	0	0	0	111.4	A234 N246 E252 A274 Q275	A234-A254 CarbonylContact O-C 3.5Å; A234-A254 WeakPolarHBondContact O-CA 3.38Å; N246-A254 HydrophobicContact CB-CB 4.2Å; E252-A254 PolarHBondContact O-N 2.85Å; A254-A274 CarbonylContact O-C 3.57Å; A254-A274 WeakPolarHBondContact O-CA 3.41Å; A254-Q275 PolarHBondContact O-N 2.85Å
255	Q	81.3	Confident	71.2	Confident	42 Å²	42	53.6 Å²	53.6	20%	0.196	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	138.4	-174	-59	-174.2	-15	0	0	113.7	A234 Q235 N236 G253 Q275	A234-Q255 PolarHBondContact O-N 3.46Å; Q235-Q255 CarbonylContact C-O 3.56Å; Q235-Q255 VanDerWaalsContact CA-O 3.31Å; Q235-Q255 WeakPolarHBondContact CA-O 3.38Å; Q235-Q255 HydrophobicContact CG-CB 4.22Å; N236-Q255 PolarHBondContact N-O 3.48Å; G253-Q255 PolarHBondContact O-N 2.95Å; Q255-Q275 CarbonylContact C-O 3.54Å; Q255-Q275 VanDerWaalsContact CA-O 3.29Å; Q255-Q275 WeakPolarHBondContact CA-O 3.41Å; Q255-Q275 HydrophobicContact CG-CB 4.3Å
256	N	77.8	Confident	71.3	Confident	7 Å²	7	52 Å²	52	4%	0.037	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	129.3	165.6	-56.9	-60	0	0	0	110.3	N236 N246 N266 Q275 N276 Q277	N236-N256 WeakPolarHBondContact CB-OD1 3.43Å; N236-N256 PolarHBondContact ND2-OD1 3.09Å; N236-N256 CarbonylContact O-C 3.56Å; N236-N256 WeakPolarHBondContact O-CA 3.38Å; N246-N256 PolarHBondContact ND2-OD1 3Å; N256-N266 PolarHBondContact ND2-OD1 2.6Å; N256-Q275 PolarHBondContact N-O 3.3Å; N256-N276 WeakPolarHBondContact CB-OD1 3.46Å; N256-N276 PolarHBondContact ND2-OD1 3.11Å; N256-N276 CarbonylContact O-C 3.59Å; N256-N276 WeakPolarHBondContact O-CA 3.32Å; N256-Q277 PolarHBondContact O-N 3Å
257	Q	77.9	Confident	71.5	Confident	66 Å²	66	55 Å²	55	31%	0.308	28%	0.284	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	115.2	-179.8	-55.4	-166	30.4	0	0	111.8	N236 Q237 A238 Q277	N236-Q257 PolarHBondContact O-N 2.8Å; Q237-Q257 WeakPolarHBondContact CA-O 3.26Å; Q237-Q257 HydrophobicContact CG-CB 4.32Å; A238-Q257 PolarHBondContact N-O 2.85Å; Q257-Q277 WeakPolarHBondContact CA-O 3.43Å; Q257-Q277 HydrophobicContact CG-CB 4.43Å
258	A	70	Confident	71.3	Confident	25 Å²	25	53 Å²	53	21%	0.207	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	130.3	-176.1	0	0	0	0	0	113.2	Q277 G278 K279	A258-Q277 PolarHBondContact N-O 3.49Å; A258-G278 WeakPolarHBondContact O-CA 3.31Å; A258-K279 PolarHBondContact O-N 3.45Å
259	K	67.9	Low	71.5	Confident	117 Å²	117	57.6 Å²	57.6	51%	0.509	29%	0.293	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.4	-32.4	176.1	-64.8	176.3	-175.2	172.5	0	112.7	A238 K239 K279	A238-K259 PolarHBondContact O-N 2.61Å; K239-K259 HydrophobicContact CG-CD 4.43Å; K239-K259 WeakPolarHBondContact O-CB 3.31Å; K259-K279 WeakPolarHBondContact O-CB 3.44Å
260	K	66.2	Low	71.7	Confident	132 Å²	132	55 Å²	55	57%	0.574	28%	0.282	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-154.3	129.5	168.6	-176.4	-169.6	174.3	-168	0	110.4	K239 K240 G241 K280	K239-K260 PolarHBondContact O-N 2.92Å; K240-K260 VanDerWaalsContact CA-O 3.3Å; K240-K260 WeakPolarHBondContact CA-O 3.29Å; G241-K260 PolarHBondContact N-O 2.85Å; K260-K280 WeakPolarHBondContact CA-O 2.97Å
261	G	61.2	Low	71.7	Confident	13 Å²	13	49.4 Å²	49.4	13%	0.134	26%	0.26	C	S	.	.	S	Bend	trans	146	178.6	168.6	0	0	0	0	0	112.9	G241 K280 G281	G241-G261 WeakPolarHBondContact O-CA 3.41Å; G261-K280 PolarHBondContact N-O 2.99Å; G261-G281 WeakPolarHBondContact O-CA 2.96Å
262	E	63.4	Low	72.1	Confident	126 Å²	126	50.8 Å²	50.8	59%	0.589	26%	0.261	S	S	*	.	S	Bend	trans	-65.1	143.9	178.1	-64.3	-178.3	-175.5	0	0	112.3	E242 G243	E242-E262 HydrophobicContact CB-CB 4.09Å; E242-E262 HydrophobicContact CG-CB 3.73Å; E242-E262 HydrophobicContact CG-CG 3.82Å; G243-E262 PolarHBondContact N-O 3.46Å
263	G	65.6	Low	72.1	Confident	12 Å²	12	48.3 Å²	48.3	12%	0.124	26%	0.257	C	S	.	.	P	Polyproline II helix	trans	-69.6	155.3	-159.9	0	0	0	0	0	115.4	E282	G263-E282 WeakPolarHBondContact CA-O 3.24Å; G263-E282 PolarHBondContact N-O 3.05Å
264	G	72.7	Confident	72.8	Confident	8 Å²	8	48 Å²	48	8%	0.082	25%	0.252	C	S	.	.	P	Polyproline II helix	trans	-70.8	150.3	171.6	0	0	0	0	0	112.6	A244 N276 Q285	A244-G264 CarbonylContact O-C 3.54Å; A244-G264 WeakPolarHBondContact O-CA 3.33Å; G264-N276 PolarHBondContact O-ND2 2.82Å; G264-N276 PolarHBondContact O-OD1 3.39Å; G264-Q285 PolarHBondContact O-N 2.98Å
265	Q	81	Confident	73.1	Confident	51 Å²	51	48.9 Å²	48.9	24%	0.238	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	124.9	176.6	-55.3	-178.2	-7.3	0	0	110.6	A244 Q245 N246 Q285	A244-Q265 PolarHBondContact O-N 2.89Å; Q245-Q265 CarbonylContact C-O 3.54Å; Q245-Q265 VanDerWaalsContact CA-O 3.28Å; Q245-Q265 WeakPolarHBondContact CA-O 3.43Å; Q245-Q265 HydrophobicContact CG-CB 4.25Å; N246-Q265 PolarHBondContact N-O 3.07Å; Q265-Q285 CarbonylContact C-O 3.55Å; Q265-Q285 VanDerWaalsContact CA-O 3.32Å; Q265-Q285 WeakPolarHBondContact CA-O 3.36Å; Q265-Q285 HydrophobicContact CG-CB 4.28Å
266	N	80	Confident	73.1	Confident	6 Å²	6	47.1 Å²	47.1	3%	0.032	24%	0.244	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-112.6	126.4	172.6	-57.1	-57.3	0	0	0	110.2	N246 N256 A274 N276 Q285 N286 Q287	N246-N266 WeakPolarHBondContact CB-OD1 3.35Å; N246-N266 PolarHBondContact ND2-OD1 2.93Å; N246-N266 CarbonylContact O-C 3.59Å; N246-N266 WeakPolarHBondContact O-CA 3.32Å; N256-N266 PolarHBondContact ND2-OD1 2.6Å; N266-A274 HydrophobicContact CB-CB 4.04Å; N266-N276 PolarHBondContact ND2-OD1 2.83Å; N266-N276 VanDerWaalsContact ND2-OD1 3.12Å; N266-Q285 PolarHBondContact N-O 2.86Å; N266-N286 WeakPolarHBondContact CB-OD1 3.37Å; N266-N286 PolarHBondContact ND2-OD1 2.61Å; N266-N286 CarbonylContact O-C 3.56Å; N266-N286 WeakPolarHBondContact O-CA 3.05Å; N266-Q287 PolarHBondContact O-N 3.42Å
267	Q	80.8	Confident	73.2	Confident	70 Å²	70	50.1 Å²	50.1	33%	0.327	26%	0.258	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.7	113.4	-179.9	-56.2	-165.6	23.2	0	0	111.8	N246 Q247 G248 Q287	N246-Q267 PolarHBondContact O-N 3.18Å; Q247-Q267 CarbonylContact C-O 3.54Å; Q247-Q267 WeakPolarHBondContact CA-O 3.4Å; Q247-Q267 HydrophobicContact CG-CB 4.34Å; G248-Q267 PolarHBondContact N-O 3.43Å; Q267-Q287 WeakPolarHBondContact CA-O 3.35Å; Q267-Q287 HydrophobicContact CG-CB 4.38Å
268	A	74.5	Confident	72.9	Confident	27 Å²	27	48 Å²	48	22%	0.223	26%	0.255	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.6	135.5	-175.7	0	0	0	0	0	113.4	G248 Q287 G288 K289	G248-A268 WeakPolarHBondContact O-CA 3.26Å; A268-Q287 PolarHBondContact N-O 2.87Å; A268-G288 WeakPolarHBondContact O-CA 3.33Å; A268-K289 PolarHBondContact O-N 3.02Å
269	K	72.4	Confident	72.8	Confident	120 Å²	120	52.1 Å²	52.1	52%	0.522	27%	0.268	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.9	-49.8	174.2	-63.1	-178.4	-178.1	178.5	0	111	G248 K249 K289 K290	G248-K269 PolarHBondContact O-N 3.04Å; G248-K269 VanDerWaalsContact O-N 3.09Å; K249-K269 HydrophobicContact CG-CD 4.45Å; K249-K269 WeakPolarHBondContact O-CB 3.31Å; K269-K289 VanDerWaalsContact O-CB 3.29Å; K269-K289 WeakPolarHBondContact O-CB 3.42Å; K269-K289 PolarHBondContact O-N 3.31Å; K269-K290 PolarHBondContact O-N 3.25Å
270	K	71.7	Confident	72.8	Confident	63 Å²	63	52.5 Å²	52.5	27%	0.274	27%	0.269	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	132	153.3	176.2	-172.3	-174.5	-89.4	0	107.1	K249 K250 G251 E252 E272 K290	K249-K270 PolarHBondContact O-N 3.15Å; K250-K270 WeakPolarHBondContact CA-O 3.45Å; K250-K270 HydrophobicContact CG-CB 4.47Å; G251-K270 PolarHBondContact N-O 2.92Å; E252-K270 IonicContact OE1-NZ 3.14Å; E252-K270 PolarHBondContact OE1-NZ 2.93Å; K270-E272 WeakPolarHBondContact CE-OE1 3.26Å; K270-E272 IonicContact NZ-OE1 2.55Å; K270-E272 PolarHBondContact NZ-OE1 2.98Å; K270-E272 IonicContact NZ-OE2 2.7Å; K270-E272 PolarHBondContact NZ-OE2 2.84Å; K270-E272 VanDerWaalsContact NZ-OE2 3.14Å; K270-K290 WeakPolarHBondContact CA-O 3.29Å; K270-K290 HydrophobicContact CG-CD 4.25Å
271	G	66.4	Low	72.7	Confident	8 Å²	8	47.1 Å²	47.1	8%	0.082	25%	0.251	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-159.2	153.5	168.4	0	0	0	0	0	114.5	G251 K290 G291 E292	G251-G271 WeakPolarHBondContact O-CA 3.4Å; G271-K290 PolarHBondContact N-O 2.89Å; G271-G291 VanDerWaalsContact O-CA 3.32Å; G271-G291 WeakPolarHBondContact O-CA 3.02Å; G271-E292 PolarHBondContact O-N 3.04Å; G271-E292 VanDerWaalsContact O-N 3.12Å
272	E	73	Confident	73	Confident	50 Å²	50	51.1 Å²	51.1	23%	0.234	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.3	134.5	-168.4	-56.8	179.9	-178.9	0	0	108.6	G251 E252 G253 K270 K290 E292	G251-E272 PolarHBondContact O-N 2.96Å; E252-E272 CarbonylContact C-O 3.46Å; E252-E272 VanDerWaalsContact CA-O 3.27Å; E252-E272 WeakPolarHBondContact CA-O 3.49Å; E252-E272 HydrophobicContact CG-CB 4.24Å; G253-E272 PolarHBondContact N-O 2.84Å; K270-E272 WeakPolarHBondContact CE-OE1 3.26Å; K270-E272 IonicContact NZ-OE1 2.55Å; K270-E272 PolarHBondContact NZ-OE1 2.98Å; K270-E272 IonicContact NZ-OE2 2.7Å; K270-E272 PolarHBondContact NZ-OE2 2.84Å; K270-E272 VanDerWaalsContact NZ-OE2 3.14Å; E272-K290 IonicContact OE1-NZ 3.41Å; E272-K290 PolarHBondContact OE1-NZ 2.96Å; E272-E292 CarbonylContact C-O 3.53Å; E272-E292 VanDerWaalsContact CA-O 3.28Å; E272-E292 WeakPolarHBondContact CA-O 3.05Å; E272-E292 HydrophobicContact CG-CB 4.21Å
273	G	67.8	Low	73.2	Confident	27 Å²	27	46.6 Å²	46.6	28%	0.278	25%	0.254	S	S	.	.			trans	69.2	34.1	-179.8	0	0	0	0	0	116.3	E292	G273-E292 PolarHBondContact N-O 3.41Å
274	A	79.9	Confident	73.9	Confident	18 Å²	18	46.9 Å²	46.9	15%	0.149	26%	0.255	C	S	.	.			trans	-73.4	124.3	174.9	0	0	0	0	0	111.6	A254 N266 A294 Q295	A254-A274 CarbonylContact O-C 3.57Å; A254-A274 WeakPolarHBondContact O-CA 3.41Å; N266-A274 HydrophobicContact CB-CB 4.04Å; A274-A294 CarbonylContact O-C 3.54Å; A274-A294 VanDerWaalsContact O-CA 3.31Å; A274-A294 WeakPolarHBondContact O-CA 3.37Å; A274-Q295 PolarHBondContact O-N 3.06Å
275	Q	83.7	Confident	74.4	Confident	39 Å²	39	48.3 Å²	48.3	18%	0.182	26%	0.259	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.3	137.6	-173	-58.5	-178.8	-41.4	0	0	113.6	A254 Q255 N256 Q295	A254-Q275 PolarHBondContact O-N 2.85Å; Q255-Q275 CarbonylContact C-O 3.54Å; Q255-Q275 VanDerWaalsContact CA-O 3.29Å; Q255-Q275 WeakPolarHBondContact CA-O 3.41Å; Q255-Q275 HydrophobicContact CG-CB 4.3Å; N256-Q275 PolarHBondContact N-O 3.3Å; Q275-Q295 CarbonylContact C-O 3.56Å; Q275-Q295 VanDerWaalsContact CA-O 3.29Å; Q275-Q295 WeakPolarHBondContact CA-O 3.42Å; Q275-Q295 HydrophobicContact CG-CB 4.24Å
276	N	81.5	Confident	74.5	Confident	5 Å²	5	46.2 Å²	46.2	3%	0.027	25%	0.25	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.9	128.3	166.7	-58.6	-56.6	0	0	0	109.7	N256 G264 N266 A284 Q285 N286 Q295 N296 Q297	N256-N276 WeakPolarHBondContact CB-OD1 3.46Å; N256-N276 PolarHBondContact ND2-OD1 3.11Å; N256-N276 CarbonylContact O-C 3.59Å; N256-N276 WeakPolarHBondContact O-CA 3.32Å; G264-N276 PolarHBondContact O-ND2 2.82Å; G264-N276 PolarHBondContact O-OD1 3.39Å; N266-N276 PolarHBondContact ND2-OD1 2.83Å; N266-N276 VanDerWaalsContact ND2-OD1 3.12Å; N276-A284 HydrophobicContact CB-CB 3.98Å; N276-Q285 PolarHBondContact ND2-O 2.88Å; N276-Q285 VanDerWaalsContact ND2-O 3.13Å; N276-N286 PolarHBondContact ND2-OD1 3.1Å; N276-Q295 PolarHBondContact N-O 2.9Å; N276-N296 WeakPolarHBondContact CB-OD1 3.46Å; N276-N296 PolarHBondContact ND2-OD1 2.88Å; N276-N296 CarbonylContact O-C 3.57Å; N276-N296 WeakPolarHBondContact O-CA 3.46Å; N276-Q297 PolarHBondContact O-N 3.36Å
277	Q	80.6	Confident	74.7	Confident	69 Å²	69	49.2 Å²	49.2	32%	0.322	26%	0.264	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.4	139.5	-178.7	-56	-167.6	28.4	0	0	112.4	N256 Q257 A258 Q297	N256-Q277 PolarHBondContact O-N 3Å; Q257-Q277 WeakPolarHBondContact CA-O 3.43Å; Q257-Q277 HydrophobicContact CG-CB 4.43Å; A258-Q277 PolarHBondContact N-O 3.49Å; Q277-Q297 CarbonylContact C-O 3.56Å; Q277-Q297 WeakPolarHBondContact CA-O 3.31Å; Q277-Q297 HydrophobicContact CG-CB 4.4Å
278	G	70.1	Confident	74.4	Confident	23 Å²	23	46.9 Å²	46.9	24%	0.237	26%	0.259	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-162.8	166.6	176	0	0	0	0	0	118.2	A258 Q297 A298 K299	A258-G278 WeakPolarHBondContact O-CA 3.31Å; G278-Q297 PolarHBondContact N-O 3.29Å; G278-A298 WeakPolarHBondContact O-CA 3.29Å; G278-K299 PolarHBondContact O-N 2.93Å; G278-K299 VanDerWaalsContact O-N 3.11Å
279	K	69.4	Low	74.5	Confident	110 Å²	110	51.2 Å²	51.2	48%	0.478	27%	0.272	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.9	-43.7	174.6	-55.6	-174.5	-178.8	-175.2	0	112.3	A258 K259 K299 K300	A258-K279 PolarHBondContact O-N 3.45Å; K259-K279 WeakPolarHBondContact O-CB 3.44Å; K279-K299 HydrophobicContact CG-CD 4.34Å; K279-K299 WeakPolarHBondContact O-CB 3.37Å; K279-K300 PolarHBondContact O-N 2.6Å
280	K	67.5	Low	74.6	Confident	126 Å²	126	48.4 Å²	48.4	55%	0.548	26%	0.26	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137	127.8	167.9	-72.9	-171.6	176	-173.4	0	107.9	K260 G261 K300	K260-K280 WeakPolarHBondContact CA-O 2.97Å; G261-K280 PolarHBondContact N-O 2.99Å; K280-K300 WeakPolarHBondContact CA-O 3.13Å
281	G	64	Low	74.5	Confident	19 Å²	19	46.2 Å²	46.2	20%	0.196	26%	0.255	C	S	.	.			trans	-179.5	152.6	172.7	0	0	0	0	0	112.8	G261 K300 G301	G261-G281 WeakPolarHBondContact O-CA 2.96Å; G281-K300 PolarHBondContact N-O 2.86Å; G281-G301 WeakPolarHBondContact O-CA 3.43Å
282	E	67.7	Low	74.9	Confident	96 Å²	96	47.9 Å²	47.9	45%	0.449	26%	0.261	S	S	.	.	S	Bend	trans	-121.2	149.3	-174	-74.7	128	-131.9	0	0	109.8	G263 A284 E302	G263-E282 WeakPolarHBondContact CA-O 3.24Å; G263-E282 PolarHBondContact N-O 3.05Å; E282-A284 PolarHBondContact O-N 3.02Å; E282-E302 CarbonylContact C-O 3.56Å; E282-E302 WeakPolarHBondContact CA-O 3.36Å; E282-E302 HydrophobicContact CG-CB 4.09Å
283	G	66.6	Low	74.9	Confident	31 Å²	31	46.8 Å²	46.8	32%	0.32	26%	0.263	S	S	.	.			trans	71.8	28.5	171.5	0	0	0	0	0	116.8	Q285 E302	G283-Q285 PolarHBondContact O-N 2.85Å; G283-E302 PolarHBondContact N-O 2.97Å
284	A	80	Confident	75.6	Confident	18 Å²	18	46.2 Å²	46.2	15%	0.149	26%	0.256	C	S	.	.			trans	-68	126.4	174	0	0	0	0	0	111.6	N276 E282 A304 Q305	N276-A284 HydrophobicContact CB-CB 3.98Å; E282-A284 PolarHBondContact O-N 3.02Å; A284-A304 CarbonylContact O-C 3.54Å; A284-A304 WeakPolarHBondContact O-CA 3.31Å; A284-Q305 PolarHBondContact O-N 2.73Å
285	Q	83.9	Confident	75.9	Confident	39 Å²	39	47.3 Å²	47.3	18%	0.182	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	144.8	-173.3	-61.7	-169.4	-9	0	0	114.1	G264 Q265 N266 N276 G283 Q305	G264-Q285 PolarHBondContact O-N 2.98Å; Q265-Q285 CarbonylContact C-O 3.55Å; Q265-Q285 VanDerWaalsContact CA-O 3.32Å; Q265-Q285 WeakPolarHBondContact CA-O 3.36Å; Q265-Q285 HydrophobicContact CG-CB 4.28Å; N266-Q285 PolarHBondContact N-O 2.86Å; N276-Q285 PolarHBondContact ND2-O 2.88Å; N276-Q285 VanDerWaalsContact ND2-O 3.13Å; G283-Q285 PolarHBondContact O-N 2.85Å; Q285-Q305 CarbonylContact C-O 3.45Å; Q285-Q305 VanDerWaalsContact CA-O 3.32Å; Q285-Q305 WeakPolarHBondContact CA-O 3.46Å; Q285-Q305 HydrophobicContact CG-CB 4.33Å
286	N	83.4	Confident	75.9	Confident	7 Å²	7	45.7 Å²	45.7	4%	0.037	25%	0.25	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	129.7	162.2	-57	-65	0	0	0	109.7	N266 N276 A294 N296 Q305 N306 Q307	N266-N286 WeakPolarHBondContact CB-OD1 3.37Å; N266-N286 PolarHBondContact ND2-OD1 2.61Å; N266-N286 CarbonylContact O-C 3.56Å; N266-N286 WeakPolarHBondContact O-CA 3.05Å; N276-N286 PolarHBondContact ND2-OD1 3.1Å; N286-A294 HydrophobicContact CB-CB 4.04Å; N286-N296 PolarHBondContact ND2-OD1 2.87Å; N286-Q305 PolarHBondContact N-O 2.85Å; N286-N306 WeakPolarHBondContact CB-OD1 2.93Å; N286-N306 PolarHBondContact ND2-OD1 2.87Å; N286-N306 CarbonylContact O-C 3.57Å; N286-N306 WeakPolarHBondContact O-CA 3.4Å; N286-Q307 PolarHBondContact O-N 2.94Å
287	Q	83.5	Confident	76	Confident	68 Å²	68	48.6 Å²	48.6	32%	0.318	26%	0.264	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	142.8	-178	-54.7	-166.4	24.4	0	0	112.4	N266 Q267 A268 Q307	N266-Q287 PolarHBondContact O-N 3.42Å; Q267-Q287 WeakPolarHBondContact CA-O 3.35Å; Q267-Q287 HydrophobicContact CG-CB 4.38Å; A268-Q287 PolarHBondContact N-O 2.87Å; Q287-Q307 CarbonylContact C-O 3.6Å; Q287-Q307 VanDerWaalsContact CA-O 3.29Å; Q287-Q307 WeakPolarHBondContact CA-O 3.34Å; Q287-Q307 HydrophobicContact CG-CB 4.44Å
288	G	74.3	Confident	75.7	Confident	22 Å²	22	46.7 Å²	46.7	23%	0.227	26%	0.26	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-172.7	177.3	174.7	0	0	0	0	0	118.9	A268 Q307 A308 K309	A268-G288 WeakPolarHBondContact O-CA 3.33Å; G288-Q307 PolarHBondContact N-O 3.25Å; G288-A308 WeakPolarHBondContact O-CA 3.42Å; G288-K309 PolarHBondContact O-N 2.68Å
289	K	76.9	Confident	75.8	Confident	117 Å²	117	51 Å²	51	51%	0.509	27%	0.272	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.7	-52.4	172.5	-56.3	-173.2	-179.6	-174.3	0	111.8	A268 K269 K309 K310	A268-K289 PolarHBondContact O-N 3.02Å; K269-K289 VanDerWaalsContact O-CB 3.29Å; K269-K289 WeakPolarHBondContact O-CB 3.42Å; K269-K289 PolarHBondContact O-N 3.31Å; K289-K309 HydrophobicContact CG-CD 4.41Å; K289-K309 WeakPolarHBondContact O-CB 3.33Å; K289-K309 PolarHBondContact O-N 2.96Å; K289-K310 PolarHBondContact O-N 2.69Å
290	K	75.8	Confident	75.9	Confident	62 Å²	62	49.5 Å²	49.5	27%	0.27	27%	0.266	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	124	161.3	-175.3	-169	-174.2	-105.1	0	107.6	K269 K270 G271 E272 E292 K310	K269-K290 PolarHBondContact O-N 3.25Å; K270-K290 WeakPolarHBondContact CA-O 3.29Å; K270-K290 HydrophobicContact CG-CD 4.25Å; G271-K290 PolarHBondContact N-O 2.89Å; E272-K290 IonicContact OE1-NZ 3.41Å; E272-K290 PolarHBondContact OE1-NZ 2.96Å; K290-E292 WeakPolarHBondContact CE-OE1 3.44Å; K290-E292 IonicContact NZ-OE1 3.6Å; K290-E292 PolarHBondContact NZ-OE1 3.45Å; K290-E292 IonicContact NZ-OE2 2.6Å; K290-E292 PolarHBondContact NZ-OE2 3.23Å; K290-K310 WeakPolarHBondContact CA-O 3.36Å
291	G	68.1	Low	75.8	Confident	16 Å²	16	44 Å²	44	17%	0.165	25%	0.245	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-138.5	126.6	179.8	0	0	0	0	0	111.6	G271 K310 G311 E312	G271-G291 VanDerWaalsContact O-CA 3.32Å; G271-G291 WeakPolarHBondContact O-CA 3.02Å; G291-K310 PolarHBondContact N-O 3.45Å; G291-G311 CarbonylContact O-C 3.53Å; G291-G311 VanDerWaalsContact O-CA 3.26Å; G291-G311 WeakPolarHBondContact O-CA 3.34Å; G291-E312 PolarHBondContact O-N 2.94Å
292	E	75.8	Confident	76.1	Confident	43 Å²	43	45.7 Å²	45.7	20%	0.201	25%	0.248	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.4	134.3	-178.1	-57.1	-180	170.4	0	0	109.7	G271 E272 G273 K290 K310 E312	G271-E292 PolarHBondContact O-N 3.04Å; G271-E292 VanDerWaalsContact O-N 3.12Å; E272-E292 CarbonylContact C-O 3.53Å; E272-E292 VanDerWaalsContact CA-O 3.28Å; E272-E292 WeakPolarHBondContact CA-O 3.05Å; E272-E292 HydrophobicContact CG-CB 4.21Å; G273-E292 PolarHBondContact N-O 3.41Å; K290-E292 WeakPolarHBondContact CE-OE1 3.44Å; K290-E292 IonicContact NZ-OE1 3.6Å; K290-E292 PolarHBondContact NZ-OE1 3.45Å; K290-E292 IonicContact NZ-OE2 2.6Å; K290-E292 PolarHBondContact NZ-OE2 3.23Å; E292-K310 IonicContact OE1-NZ 2.85Å; E292-E312 CarbonylContact C-O 3.54Å; E292-E312 WeakPolarHBondContact CA-O 3.26Å; E292-E312 HydrophobicContact CB-CB 4.26Å; E292-E312 HydrophobicContact CG-CB 3.83Å
293	G	72.7	Confident	76.1	Confident	28 Å²	28	42.4 Å²	42.4	29%	0.289	24%	0.239	S	C	.	.	S	Bend	trans	67.7	33.1	-179.1	0	0	0	0	0	115.6	E312	G293-E312 PolarHBondContact N-O 2.96Å
294	A	82.5	Confident	76.9	Confident	14 Å²	14	41.9 Å²	41.9	12%	0.116	23%	0.232	C	C	.	.			trans	-73.3	124.1	176.4	0	0	0	0	0	111.7	A274 N286 A314 Q315	A274-A294 CarbonylContact O-C 3.54Å; A274-A294 VanDerWaalsContact O-CA 3.31Å; A274-A294 WeakPolarHBondContact O-CA 3.37Å; N286-A294 HydrophobicContact CB-CB 4.04Å; A294-A314 CarbonylContact O-C 3.53Å; A294-A314 VanDerWaalsContact O-CA 3.29Å; A294-A314 WeakPolarHBondContact O-CA 3.42Å; A294-Q315 PolarHBondContact O-N 3.23Å
295	Q	85.7	Confident	77.1	Confident	41 Å²	41	42.9 Å²	42.9	19%	0.192	23%	0.234	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	137.8	-173.8	-56.7	-177	-24.1	0	0	114	A274 Q275 N276 Q315	A274-Q295 PolarHBondContact O-N 3.06Å; Q275-Q295 CarbonylContact C-O 3.56Å; Q275-Q295 VanDerWaalsContact CA-O 3.29Å; Q275-Q295 WeakPolarHBondContact CA-O 3.42Å; Q275-Q295 HydrophobicContact CG-CB 4.24Å; N276-Q295 PolarHBondContact N-O 2.9Å; Q295-Q315 CarbonylContact C-O 3.54Å; Q295-Q315 VanDerWaalsContact CA-O 3.26Å; Q295-Q315 WeakPolarHBondContact CA-O 3.42Å; Q295-Q315 HydrophobicContact CG-CB 4.28Å
296	N	84.2	Confident	77.2	Confident	5 Å²	5	41.3 Å²	41.3	3%	0.027	23%	0.226	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	128.6	168.1	-58.7	-53.5	0	0	0	110	N276 N286 A304 Q305 N306 Q315 N316 Q317	N276-N296 WeakPolarHBondContact CB-OD1 3.46Å; N276-N296 PolarHBondContact ND2-OD1 2.88Å; N276-N296 CarbonylContact O-C 3.57Å; N276-N296 WeakPolarHBondContact O-CA 3.46Å; N286-N296 PolarHBondContact ND2-OD1 2.87Å; N296-A304 HydrophobicContact CB-CB 3.99Å; N296-Q305 PolarHBondContact ND2-O 3.23Å; N296-N306 PolarHBondContact ND2-OD1 3.39Å; N296-N306 VanDerWaalsContact ND2-OD1 3.08Å; N296-Q315 PolarHBondContact N-O 2.94Å; N296-N316 WeakPolarHBondContact CB-OD1 3.43Å; N296-N316 PolarHBondContact ND2-OD1 2.85Å; N296-N316 CarbonylContact O-C 3.51Å; N296-N316 WeakPolarHBondContact O-CA 3.27Å; N296-Q317 PolarHBondContact O-N 3.38Å
297	Q	82.6	Confident	77.3	Confident	67 Å²	67	44.2 Å²	44.2	31%	0.313	24%	0.24	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-131	117.6	-178.4	-56.1	-167.7	28	0	0	112.6	N276 Q277 G278 Q317	N276-Q297 PolarHBondContact O-N 3.36Å; Q277-Q297 CarbonylContact C-O 3.56Å; Q277-Q297 WeakPolarHBondContact CA-O 3.31Å; Q277-Q297 HydrophobicContact CG-CB 4.4Å; G278-Q297 PolarHBondContact N-O 3.29Å; Q297-Q317 WeakPolarHBondContact CA-O 3.4Å; Q297-Q317 HydrophobicContact CG-CB 4.42Å
298	A	75.7	Confident	77.2	Confident	29 Å²	29	42 Å²	42	24%	0.24	23%	0.233	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-132.6	138.6	-175.5	0	0	0	0	0	114.2	G278 Q317 G318 K319	G278-A298 WeakPolarHBondContact O-CA 3.29Å; A298-Q317 PolarHBondContact N-O 2.89Å; A298-G318 WeakPolarHBondContact O-CA 3.36Å; A298-K319 PolarHBondContact O-N 3.44Å
299	K	72.3	Confident	77.5	Confident	114 Å²	114	46.4 Å²	46.4	50%	0.496	25%	0.246	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-78.4	-46.5	173.9	-60.8	-178.8	-176.8	178.4	0	112.2	G278 K279 K319 K320	G278-K299 PolarHBondContact O-N 2.93Å; G278-K299 VanDerWaalsContact O-N 3.11Å; K279-K299 HydrophobicContact CG-CD 4.34Å; K279-K299 WeakPolarHBondContact O-CB 3.37Å; K299-K319 WeakPolarHBondContact O-CB 3.24Å; K299-K320 PolarHBondContact O-N 3.35Å
300	K	70.9	Confident	77.7	Confident	78 Å²	78	44.6 Å²	44.6	34%	0.339	24%	0.238	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	137.9	149.3	-170.7	-157.8	-179.1	-105.7	0	107	K279 K280 G281 E302 K320	K279-K300 PolarHBondContact O-N 2.6Å; K280-K300 WeakPolarHBondContact CA-O 3.13Å; G281-K300 PolarHBondContact N-O 2.86Å; K300-E302 WeakPolarHBondContact CE-OE1 3.19Å; K300-E302 IonicContact NZ-OE1 2.65Å; K300-E302 PolarHBondContact NZ-OE1 3.09Å; K300-E302 IonicContact NZ-OE2 2.72Å; K300-E302 PolarHBondContact NZ-OE2 3.46Å; K300-K320 VanDerWaalsContact CA-O 3.31Å; K300-K320 WeakPolarHBondContact CA-O 3.42Å; K300-K320 HydrophobicContact CG-CB 4.25Å
301	G	65.5	Low	77.6	Confident	11 Å²	11	42 Å²	42	11%	0.113	23%	0.229	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-174.3	148.7	167.3	0	0	0	0	0	113.3	G281 K320 G321 E322	G281-G301 WeakPolarHBondContact O-CA 3.43Å; G301-K320 PolarHBondContact N-O 3.03Å; G301-G321 WeakPolarHBondContact O-CA 3.39Å; G301-E322 PolarHBondContact O-N 3.16Å
302	E	69.7	Low	78.2	Confident	54 Å²	54	45.1 Å²	45.1	25%	0.252	24%	0.239	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	152.3	179.1	-71.9	102	-98.6	0	0	111.2	E282 G283 K300 A304 E322	E282-E302 CarbonylContact C-O 3.56Å; E282-E302 WeakPolarHBondContact CA-O 3.36Å; E282-E302 HydrophobicContact CG-CB 4.09Å; G283-E302 PolarHBondContact N-O 2.97Å; K300-E302 WeakPolarHBondContact CE-OE1 3.19Å; K300-E302 IonicContact NZ-OE1 2.65Å; K300-E302 PolarHBondContact NZ-OE1 3.09Å; K300-E302 IonicContact NZ-OE2 2.72Å; K300-E302 PolarHBondContact NZ-OE2 3.46Å; E302-A304 PolarHBondContact O-N 3.4Å; E302-E322 CarbonylContact C-O 3.56Å; E302-E322 VanDerWaalsContact CA-O 3.31Å; E302-E322 WeakPolarHBondContact CA-O 3.36Å; E302-E322 HydrophobicContact CG-CB 3.92Å
303	G	68.4	Low	78.2	Confident	26 Å²	26	44.1 Å²	44.1	27%	0.268	24%	0.24	S	C	.	.			trans	69.1	33.8	170.1	0	0	0	0	0	116	Q305 E322	G303-Q305 PolarHBondContact O-N 3.23Å; G303-E322 PolarHBondContact N-O 2.92Å
304	A	82	Confident	78.8	Confident	20 Å²	20	43.5 Å²	43.5	17%	0.165	23%	0.233	C	C	.	.			trans	-73.4	122.4	174.4	0	0	0	0	0	111.2	A284 N296 E302 A324 Q325	A284-A304 CarbonylContact O-C 3.54Å; A284-A304 WeakPolarHBondContact O-CA 3.31Å; N296-A304 HydrophobicContact CB-CB 3.99Å; E302-A304 PolarHBondContact O-N 3.4Å; A304-A324 CarbonylContact O-C 3.49Å; A304-A324 WeakPolarHBondContact O-CA 3.27Å; A304-Q325 PolarHBondContact O-N 2.6Å
305	Q	86.1	Confident	79	Confident	40 Å²	40	44.9 Å²	44.9	19%	0.187	24%	0.237	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	138.7	-172.1	-63	-180	-29	0	0	113.5	A284 Q285 N286 N296 G303 Q325	A284-Q305 PolarHBondContact O-N 2.73Å; Q285-Q305 CarbonylContact C-O 3.45Å; Q285-Q305 VanDerWaalsContact CA-O 3.32Å; Q285-Q305 WeakPolarHBondContact CA-O 3.46Å; Q285-Q305 HydrophobicContact CG-CB 4.33Å; N286-Q305 PolarHBondContact N-O 2.85Å; N296-Q305 PolarHBondContact ND2-O 3.23Å; G303-Q305 PolarHBondContact O-N 3.23Å; Q305-Q325 CarbonylContact C-O 3.6Å; Q305-Q325 WeakPolarHBondContact CA-O 3.45Å; Q305-Q325 HydrophobicContact CG-CB 4.28Å
306	N	85.4	Confident	79	Confident	6 Å²	6	43.1 Å²	43.1	3%	0.032	23%	0.229	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	128.7	166.5	-57.9	-58.8	0	0	0	110.1	N286 N296 A314 N316 Q325 N326 Q327	N286-N306 WeakPolarHBondContact CB-OD1 2.93Å; N286-N306 PolarHBondContact ND2-OD1 2.87Å; N286-N306 CarbonylContact O-C 3.57Å; N286-N306 WeakPolarHBondContact O-CA 3.4Å; N296-N306 PolarHBondContact ND2-OD1 3.39Å; N296-N306 VanDerWaalsContact ND2-OD1 3.08Å; N306-A314 HydrophobicContact CB-CB 4.05Å; N306-N316 PolarHBondContact ND2-OD1 2.89Å; N306-Q325 PolarHBondContact N-O 3.31Å; N306-N326 WeakPolarHBondContact CB-OD1 3.45Å; N306-N326 PolarHBondContact ND2-OD1 2.86Å; N306-N326 CarbonylContact O-C 3.36Å; N306-N326 WeakPolarHBondContact O-CA 2.77Å; N306-Q327 PolarHBondContact O-N 2.86Å
307	Q	85.4	Confident	78.9	Confident	67 Å²	67	46.2 Å²	46.2	31%	0.313	24%	0.243	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-130.9	120.9	-178.2	-55.6	-167.5	28	0	0	112.2	N286 Q287 G288 Q327	N286-Q307 PolarHBondContact O-N 2.94Å; Q287-Q307 CarbonylContact C-O 3.6Å; Q287-Q307 VanDerWaalsContact CA-O 3.29Å; Q287-Q307 WeakPolarHBondContact CA-O 3.34Å; Q287-Q307 HydrophobicContact CG-CB 4.44Å; G288-Q307 PolarHBondContact N-O 3.25Å; Q307-Q327 WeakPolarHBondContact CA-O 3.31Å; Q307-Q327 HydrophobicContact CG-CB 4.43Å
308	A	82.1	Confident	78.5	Confident	22 Å²	22	44.1 Å²	44.1	18%	0.182	24%	0.239	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-142.1	144.1	-177.1	0	0	0	0	0	114.4	G288 Q327 S328 K329	G288-A308 WeakPolarHBondContact O-CA 3.42Å; A308-Q327 PolarHBondContact N-O 2.98Å; A308-S328 WeakPolarHBondContact O-CA 2.96Å; A308-S328 WeakPolarHBondContact O-CB 3.31Å; A308-K329 PolarHBondContact O-N 2.75Å
309	K	79	Confident	78.3	Confident	115 Å²	115	48 Å²	48	50%	0.5	25%	0.25	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.6	-50.9	171.6	-62.7	-172.8	-178.5	-175.9	0	111.1	G288 K289 K329 K330	G288-K309 PolarHBondContact O-N 2.68Å; K289-K309 HydrophobicContact CG-CD 4.41Å; K289-K309 WeakPolarHBondContact O-CB 3.33Å; K289-K309 PolarHBondContact O-N 2.96Å; K309-K329 WeakPolarHBondContact O-CB 3.41Å; K309-K329 PolarHBondContact O-N 2.84Å; K309-K330 PolarHBondContact O-N 3.3Å
310	K	81.8	Confident	78.3	Confident	78 Å²	78	48.5 Å²	48.5	34%	0.339	25%	0.253	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	123.2	157.7	-174	-166.4	174.7	-150.7	0	107.6	K289 K290 G291 E292 K330	K289-K310 PolarHBondContact O-N 2.69Å; K290-K310 WeakPolarHBondContact CA-O 3.36Å; G291-K310 PolarHBondContact N-O 3.45Å; E292-K310 IonicContact OE1-NZ 2.85Å; K310-K330 WeakPolarHBondContact CA-O 3.42Å
311	G	73.7	Confident	78.1	Confident	8 Å²	8	45.6 Å²	45.6	8%	0.082	25%	0.245	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-127.1	144.6	-179.7	0	0	0	0	0	113	G291 K330 G331 E332	G291-G311 CarbonylContact O-C 3.53Å; G291-G311 VanDerWaalsContact O-CA 3.26Å; G291-G311 WeakPolarHBondContact O-CA 3.34Å; G311-K330 PolarHBondContact N-O 3.33Å; G311-G331 VanDerWaalsContact O-CA 3.29Å; G311-G331 WeakPolarHBondContact O-CA 3.39Å; G311-E332 PolarHBondContact O-N 2.85Å
312	E	79.8	Confident	78.3	Confident	82 Å²	82	48.1 Å²	48.1	38%	0.383	25%	0.254	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.2	139	173.4	-159.3	168	142.2	0	0	111	G291 E292 G293 A314 E332	G291-E312 PolarHBondContact O-N 2.94Å; E292-E312 CarbonylContact C-O 3.54Å; E292-E312 WeakPolarHBondContact CA-O 3.26Å; E292-E312 HydrophobicContact CB-CB 4.26Å; E292-E312 HydrophobicContact CG-CB 3.83Å; G293-E312 PolarHBondContact N-O 2.96Å; E312-A314 VanDerWaalsContact C-N 3.33Å; E312-A314 PolarHBondContact O-N 3.39Å; E312-E332 CarbonylContact C-O 3.55Å; E312-E332 WeakPolarHBondContact CA-O 3.39Å; E312-E332 HydrophobicContact CG-CB 3.97Å
313	G	77	Confident	78.3	Confident	21 Å²	21	46.9 Å²	46.9	22%	0.216	26%	0.256	C	S	.	.	S	Bend	trans	62.2	31.7	172.7	0	0	0	0	0	115.3	Q315 E332	G313-Q315 PolarHBondContact O-N 2.91Å; G313-E332 PolarHBondContact N-O 3.49Å
314	A	84.5	Confident	79	Confident	16 Å²	16	46.7 Å²	46.7	13%	0.132	25%	0.252	C	S	.	.			trans	-72.1	122.2	177.5	0	0	0	0	0	111.2	A294 N306 E312 A334 Q335	A294-A314 CarbonylContact O-C 3.53Å; A294-A314 VanDerWaalsContact O-CA 3.29Å; A294-A314 WeakPolarHBondContact O-CA 3.42Å; N306-A314 HydrophobicContact CB-CB 4.05Å; E312-A314 VanDerWaalsContact C-N 3.33Å; E312-A314 PolarHBondContact O-N 3.39Å; A314-A334 CarbonylContact O-C 3.53Å; A314-A334 VanDerWaalsContact O-CA 3.31Å; A314-A334 WeakPolarHBondContact O-CA 3.29Å; A314-Q335 PolarHBondContact O-N 2.87Å
315	Q	87.1	Confident	79.2	Confident	43 Å²	43	47.7 Å²	47.7	20%	0.201	25%	0.253	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.1	131.6	-173.9	-58.3	-175.7	-11	0	0	113.5	A294 Q295 N296 G313 Q335	A294-Q315 PolarHBondContact O-N 3.23Å; Q295-Q315 CarbonylContact C-O 3.54Å; Q295-Q315 VanDerWaalsContact CA-O 3.26Å; Q295-Q315 WeakPolarHBondContact CA-O 3.42Å; Q295-Q315 HydrophobicContact CG-CB 4.28Å; N296-Q315 PolarHBondContact N-O 2.94Å; G313-Q315 PolarHBondContact O-N 2.91Å; Q315-Q335 CarbonylContact C-O 3.5Å; Q315-Q335 WeakPolarHBondContact CA-O 3.42Å; Q315-Q335 HydrophobicContact CG-CB 4.26Å
316	N	85.2	Confident	79.2	Confident	4 Å²	4	46.1 Å²	46.1	2%	0.021	25%	0.246	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	127.5	167	-58.3	-52.7	0	0	0	109.5	N296 N306 A324 Q325 N326 Q335 N336 Q337	N296-N316 WeakPolarHBondContact CB-OD1 3.43Å; N296-N316 PolarHBondContact ND2-OD1 2.85Å; N296-N316 CarbonylContact O-C 3.51Å; N296-N316 WeakPolarHBondContact O-CA 3.27Å; N306-N316 PolarHBondContact ND2-OD1 2.89Å; N316-A324 HydrophobicContact CB-CB 3.92Å; N316-Q325 PolarHBondContact ND2-O 2.87Å; N316-N326 PolarHBondContact ND2-OD1 2.84Å; N316-N326 VanDerWaalsContact ND2-OD1 3.12Å; N316-Q335 PolarHBondContact N-O 2.9Å; N316-N336 WeakPolarHBondContact CB-OD1 3.36Å; N316-N336 PolarHBondContact ND2-OD1 2.76Å; N316-N336 CarbonylContact O-C 3.56Å; N316-N336 WeakPolarHBondContact O-CA 3.4Å; N316-Q337 PolarHBondContact O-N 3.18Å
317	Q	83.3	Confident	79.3	Confident	70 Å²	70	49 Å²	49	33%	0.327	26%	0.259	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	138.8	-178.3	-55.4	-168.1	25	0	0	112.7	N296 Q297 A298 Q337	N296-Q317 PolarHBondContact O-N 3.38Å; Q297-Q317 WeakPolarHBondContact CA-O 3.4Å; Q297-Q317 HydrophobicContact CG-CB 4.42Å; A298-Q317 PolarHBondContact N-O 2.89Å; Q317-Q337 CarbonylContact C-O 3.55Å; Q317-Q337 WeakPolarHBondContact CA-O 3.32Å; Q317-Q337 HydrophobicContact CG-CB 4.38Å
318	G	72.9	Confident	79.2	Confident	22 Å²	22	47.2 Å²	47.2	23%	0.227	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-162.1	168.4	174	0	0	0	0	0	118.6	A298 Q337 A338 K339	A298-G318 WeakPolarHBondContact O-CA 3.36Å; G318-Q337 PolarHBondContact N-O 3.11Å; G318-A338 WeakPolarHBondContact O-CA 3.38Å; G318-K339 PolarHBondContact O-N 2.99Å
319	K	73.2	Confident	79	Confident	111 Å²	111	51.6 Å²	51.6	48%	0.483	27%	0.269	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.5	-46.1	175	-56.2	-172.2	-178.4	-172.3	0	111.9	A298 K299 K339 K340	A298-K319 PolarHBondContact O-N 3.44Å; K299-K319 WeakPolarHBondContact O-CB 3.24Å; K319-K339 HydrophobicContact CG-CD 4.33Å; K319-K339 WeakPolarHBondContact O-CB 3.32Å; K319-K340 PolarHBondContact O-N 2.91Å
320	K	72.3	Confident	79.2	Confident	124 Å²	124	49.4 Å²	49.4	54%	0.539	26%	0.259	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.2	136	161.7	-69.9	-172.9	176.7	-173.2	0	107.2	K299 K300 G301 K340	K299-K320 PolarHBondContact O-N 3.35Å; K300-K320 VanDerWaalsContact CA-O 3.31Å; K300-K320 WeakPolarHBondContact CA-O 3.42Å; K300-K320 HydrophobicContact CG-CB 4.25Å; G301-K320 PolarHBondContact N-O 3.03Å; K320-K340 WeakPolarHBondContact CA-O 3.36Å
321	G	65.5	Low	78.9	Confident	17 Å²	17	46.1 Å²	46.1	18%	0.175	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	179.4	149.3	171.3	0	0	0	0	0	113.7	G301 K340 G341	G301-G321 WeakPolarHBondContact O-CA 3.39Å; G321-K340 PolarHBondContact N-O 3Å; G321-G341 WeakPolarHBondContact O-CA 3.33Å
322	E	69.9	Low	79.2	Confident	64 Å²	64	47.9 Å²	47.9	30%	0.299	25%	0.253	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.8	147	-171.5	-73.4	126.4	-138.3	0	0	110.2	G301 E302 G303 K340 E342	G301-E322 PolarHBondContact O-N 3.16Å; E302-E322 CarbonylContact C-O 3.56Å; E302-E322 VanDerWaalsContact CA-O 3.31Å; E302-E322 WeakPolarHBondContact CA-O 3.36Å; E302-E322 HydrophobicContact CG-CB 3.92Å; G303-E322 PolarHBondContact N-O 2.92Å; E322-K340 IonicContact OE1-NZ 2.76Å; E322-E342 VanDerWaalsContact CA-O 3.31Å; E322-E342 WeakPolarHBondContact CA-O 3.37Å; E322-E342 HydrophobicContact CG-CB 4.07Å
323	G	69.2	Low	79.1	Confident	29 Å²	29	45.2 Å²	45.2	30%	0.299	25%	0.248	S	C	.	.			trans	68	35.8	174.7	0	0	0	0	0	115.9	E342 G343	G323-E342 PolarHBondContact N-O 2.86Å; G323-G343 WeakPolarHBondContact CA-O 3.27Å
324	A	83.3	Confident	79.5	Confident	22 Å²	22	45.1 Å²	45.1	18%	0.182	25%	0.245	C	C	.	.			trans	-75.5	123.4	174.3	0	0	0	0	0	111.2	A304 N316 N336 G344 Q345	A304-A324 CarbonylContact O-C 3.49Å; A304-A324 WeakPolarHBondContact O-CA 3.27Å; N316-A324 HydrophobicContact CB-CB 3.92Å; A324-N336 HydrophobicContact CB-CB 4.49Å; A324-G344 CarbonylContact O-C 3.57Å; A324-G344 WeakPolarHBondContact O-CA 3.37Å; A324-Q345 PolarHBondContact O-N 2.8Å
325	Q	87	Confident	79.7	Confident	41 Å²	41	46.2 Å²	46.2	19%	0.192	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	139.3	-173.4	-55.5	-179.1	-44	0	0	113.2	A304 Q305 N306 N316 Q345	A304-Q325 PolarHBondContact O-N 2.6Å; Q305-Q325 CarbonylContact C-O 3.6Å; Q305-Q325 WeakPolarHBondContact CA-O 3.45Å; Q305-Q325 HydrophobicContact CG-CB 4.28Å; N306-Q325 PolarHBondContact N-O 3.31Å; N316-Q325 PolarHBondContact ND2-O 2.87Å; Q325-Q345 CarbonylContact C-O 3.52Å; Q325-Q345 WeakPolarHBondContact CA-O 3.38Å; Q325-Q345 HydrophobicContact CG-CB 4.24Å
326	N	86.6	Confident	79.6	Confident	7 Å²	7	44.6 Å²	44.6	4%	0.037	24%	0.24	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.4	127.1	164.9	-57.9	-60.5	0	0	0	109.6	N306 N316 A334 Q335 N336 Q345 N346 Q347	N306-N326 WeakPolarHBondContact CB-OD1 3.45Å; N306-N326 PolarHBondContact ND2-OD1 2.86Å; N306-N326 CarbonylContact O-C 3.36Å; N306-N326 WeakPolarHBondContact O-CA 2.77Å; N316-N326 PolarHBondContact ND2-OD1 2.84Å; N316-N326 VanDerWaalsContact ND2-OD1 3.12Å; N326-A334 HydrophobicContact CB-CB 3.99Å; N326-Q335 PolarHBondContact ND2-O 3.37Å; N326-N336 PolarHBondContact ND2-OD1 2.98Å; N326-Q345 PolarHBondContact N-O 3.48Å; N326-N346 WeakPolarHBondContact CB-OD1 3.19Å; N326-N346 PolarHBondContact ND2-OD1 2.93Å; N326-N346 CarbonylContact O-C 3.53Å; N326-N346 WeakPolarHBondContact O-CA 3.45Å; N326-Q347 PolarHBondContact O-N 2.81Å
327	Q	86.2	Confident	79.5	Confident	67 Å²	67	47.4 Å²	47.4	31%	0.313	25%	0.253	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.9	135	-179.2	-57.2	-167.9	20.7	0	0	112	N306 Q307 A308 Q347	N306-Q327 PolarHBondContact O-N 2.86Å; Q307-Q327 WeakPolarHBondContact CA-O 3.31Å; Q307-Q327 HydrophobicContact CG-CB 4.43Å; A308-Q327 PolarHBondContact N-O 2.98Å; Q327-Q347 CarbonylContact C-O 3.51Å; Q327-Q347 WeakPolarHBondContact CA-O 2.96Å; Q327-Q347 HydrophobicContact CG-CB 4.38Å
328	S	82.7	Confident	79.3	Confident	28 Å²	28	45.4 Å²	45.4	20%	0.196	25%	0.249	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-151.6	167.2	177.3	68.1	0	0	0	0	116.5	A308 G331 Q347 A348 K349	A308-S328 WeakPolarHBondContact O-CA 2.96Å; A308-S328 WeakPolarHBondContact O-CB 3.31Å; S328-G331 WeakPolarHBondContact OG-CA 3.5Å; S328-G331 PolarHBondContact OG-N 3.09Å; S328-Q347 PolarHBondContact N-O 2.81Å; S328-A348 WeakPolarHBondContact O-CA 3Å; S328-K349 PolarHBondContact O-N 3.21Å
329	K	79.9	Confident	79.3	Confident	114 Å²	114	49.6 Å²	49.6	50%	0.496	26%	0.261	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.3	-54.1	165.4	-60.6	-174.8	179.9	-172.6	0	111.2	A308 K309 K349 K350	A308-K329 PolarHBondContact O-N 2.75Å; K309-K329 WeakPolarHBondContact O-CB 3.41Å; K309-K329 PolarHBondContact O-N 2.84Å; K329-K349 HydrophobicContact CG-CD 4.49Å; K329-K349 WeakPolarHBondContact O-CA 3.25Å; K329-K349 WeakPolarHBondContact O-CB 3.08Å; K329-K349 PolarHBondContact O-N 3.41Å; K329-K350 PolarHBondContact O-N 2.91Å
330	K	82.6	Confident	79.2	Confident	70 Å²	70	47.7 Å²	47.7	30%	0.304	25%	0.252	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.8	131.8	158.5	-165.4	-163.7	-173.3	-131.4	0	108.4	K309 K310 G311 E332 K350	K309-K330 PolarHBondContact O-N 3.3Å; K310-K330 WeakPolarHBondContact CA-O 3.42Å; G311-K330 PolarHBondContact N-O 3.33Å; K330-E332 WeakPolarHBondContact CE-OE1 3.43Å; K330-E332 IonicContact NZ-OE1 2.64Å; K330-E332 PolarHBondContact NZ-OE1 3.05Å; K330-E332 IonicContact NZ-OE2 3.49Å; K330-E332 PolarHBondContact NZ-OE2 2.8Å; K330-K350 WeakPolarHBondContact CA-O 3.44Å; K330-K350 HydrophobicContact CG-CB 4.45Å
331	G	74.3	Confident	78.8	Confident	8 Å²	8	42.2 Å²	42.2	8%	0.082	23%	0.23	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-141.5	132.9	-179.9	0	0	0	0	0	113.4	G311 S328 K350 G351 E352	G311-G331 VanDerWaalsContact O-CA 3.29Å; G311-G331 WeakPolarHBondContact O-CA 3.39Å; S328-G331 WeakPolarHBondContact OG-CA 3.5Å; S328-G331 PolarHBondContact OG-N 3.09Å; G331-K350 PolarHBondContact N-O 2.85Å; G331-G351 CarbonylContact O-C 3.53Å; G331-G351 VanDerWaalsContact O-CA 3.26Å; G331-G351 WeakPolarHBondContact O-CA 3.37Å; G331-E352 PolarHBondContact O-N 3.04Å
332	E	80.2	Confident	78.8	Confident	45 Å²	45	44.1 Å²	44.1	21%	0.21	24%	0.235	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	138	170.1	-89.1	113	-86.7	0	0	111	G311 E312 G313 K330 A334 E352	G311-E332 PolarHBondContact O-N 2.85Å; E312-E332 CarbonylContact C-O 3.55Å; E312-E332 WeakPolarHBondContact CA-O 3.39Å; E312-E332 HydrophobicContact CG-CB 3.97Å; G313-E332 PolarHBondContact N-O 3.49Å; K330-E332 WeakPolarHBondContact CE-OE1 3.43Å; K330-E332 IonicContact NZ-OE1 2.64Å; K330-E332 PolarHBondContact NZ-OE1 3.05Å; K330-E332 IonicContact NZ-OE2 3.49Å; K330-E332 PolarHBondContact NZ-OE2 2.8Å; E332-A334 PolarHBondContact O-N 2.78Å; E332-E352 CarbonylContact C-O 3.54Å; E332-E352 WeakPolarHBondContact CA-O 2.96Å; E332-E352 HydrophobicContact CG-CB 4.06Å
333	G	78.1	Confident	78.7	Confident	26 Å²	26	42.1 Å²	42.1	27%	0.268	23%	0.231	S	C	.	.	S	Bend	trans	67.7	30.5	167.6	0	0	0	0	0	116.6	E352	G333-E352 PolarHBondContact N-O 2.95Å
334	A	85.4	Confident	79.1	Confident	19 Å²	19	41.4 Å²	41.4	16%	0.157	23%	0.225	C	C	.	.			trans	-70.1	128	176.3	0	0	0	0	0	112	A314 N326 E332 A354 Q355	A314-A334 CarbonylContact O-C 3.53Å; A314-A334 VanDerWaalsContact O-CA 3.31Å; A314-A334 WeakPolarHBondContact O-CA 3.29Å; N326-A334 HydrophobicContact CB-CB 3.99Å; E332-A334 PolarHBondContact O-N 2.78Å; A334-A354 CarbonylContact O-C 3.53Å; A334-A354 VanDerWaalsContact O-CA 3.31Å; A334-A354 WeakPolarHBondContact O-CA 3.3Å; A334-Q355 PolarHBondContact O-N 3.37Å
335	Q	88.3	Confident	79.2	Confident	40 Å²	40	42.3 Å²	42.3	19%	0.187	23%	0.225	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	139.5	-176.5	-54.6	-171.5	0.8	0	0	113.8	A314 Q315 N316 N326 Q355	A314-Q335 PolarHBondContact O-N 2.87Å; Q315-Q335 CarbonylContact C-O 3.5Å; Q315-Q335 WeakPolarHBondContact CA-O 3.42Å; Q315-Q335 HydrophobicContact CG-CB 4.26Å; N316-Q335 PolarHBondContact N-O 2.9Å; N326-Q335 PolarHBondContact ND2-O 3.37Å; Q335-Q355 CarbonylContact C-O 3.57Å; Q335-Q355 VanDerWaalsContact CA-O 3.29Å; Q335-Q355 WeakPolarHBondContact CA-O 3.33Å; Q335-Q355 HydrophobicContact CG-CB 4.3Å
336	N	85.7	Confident	79.2	Confident	8 Å²	8	40.8 Å²	40.8	4%	0.043	22%	0.218	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-122	127.7	165.6	-58	-55.3	0	0	0	109.9	N316 A324 N326 Q345 N346 Q355 N356 Q357	N316-N336 WeakPolarHBondContact CB-OD1 3.36Å; N316-N336 PolarHBondContact ND2-OD1 2.76Å; N316-N336 CarbonylContact O-C 3.56Å; N316-N336 WeakPolarHBondContact O-CA 3.4Å; A324-N336 HydrophobicContact CB-CB 4.49Å; N326-N336 PolarHBondContact ND2-OD1 2.98Å; N336-Q345 PolarHBondContact ND2-O 2.91Å; N336-N346 PolarHBondContact ND2-OD1 3.33Å; N336-N346 VanDerWaalsContact ND2-OD1 3.15Å; N336-Q355 PolarHBondContact N-O 3.12Å; N336-N356 WeakPolarHBondContact CB-OD1 3.43Å; N336-N356 PolarHBondContact ND2-OD1 3.29Å; N336-N356 CarbonylContact O-C 3.54Å; N336-N356 WeakPolarHBondContact O-CA 3.43Å; N336-Q357 PolarHBondContact O-N 3.07Å
337	Q	84.2	Confident	79.1	Confident	64 Å²	64	43.6 Å²	43.6	30%	0.299	23%	0.231	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.2	123	-177.3	-55.9	-167	25.1	0	0	112.9	N316 Q317 G318 Q357	N316-Q337 PolarHBondContact O-N 3.18Å; Q317-Q337 CarbonylContact C-O 3.55Å; Q317-Q337 WeakPolarHBondContact CA-O 3.32Å; Q317-Q337 HydrophobicContact CG-CB 4.38Å; G318-Q337 PolarHBondContact N-O 3.11Å; Q337-Q357 CarbonylContact C-O 3.57Å; Q337-Q357 WeakPolarHBondContact CA-O 3.29Å; Q337-Q357 HydrophobicContact CG-CB 4.4Å
338	A	77.9	Confident	79	Confident	28 Å²	28	41.3 Å²	41.3	23%	0.231	22%	0.224	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	149.7	-175.9	0	0	0	0	0	114.2	G318 Q357 A358 K359	G318-A338 WeakPolarHBondContact O-CA 3.38Å; A338-Q357 PolarHBondContact N-O 2.94Å; A338-A358 WeakPolarHBondContact O-CA 3.42Å; A338-K359 PolarHBondContact O-N 2.83Å; A338-K359 VanDerWaalsContact O-N 3.09Å
339	K	72.8	Confident	78.7	Confident	110 Å²	110	45.5 Å²	45.5	48%	0.478	24%	0.238	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-89.3	-50.5	168.2	-58.7	-176.2	-176.9	-178	0	111.9	G318 K319 K359 K360	G318-K339 PolarHBondContact O-N 2.99Å; K319-K339 HydrophobicContact CG-CD 4.33Å; K319-K339 WeakPolarHBondContact O-CB 3.32Å; K339-K359 HydrophobicContact CG-CD 4.35Å; K339-K359 VanDerWaalsContact O-CB 3.32Å; K339-K359 WeakPolarHBondContact O-CB 3.35Å; K339-K360 PolarHBondContact O-N 3.13Å
340	K	71.5	Confident	78.7	Confident	71 Å²	71	43.6 Å²	43.6	31%	0.309	23%	0.23	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.2	139.2	150.7	-177.5	-166	175.4	-75.6	0	107.1	K319 K320 G321 E322 E342 K360	K319-K340 PolarHBondContact O-N 2.91Å; K320-K340 WeakPolarHBondContact CA-O 3.36Å; G321-K340 PolarHBondContact N-O 3Å; E322-K340 IonicContact OE1-NZ 2.76Å; K340-E342 WeakPolarHBondContact CE-OE1 3.44Å; K340-E342 IonicContact NZ-OE1 2.63Å; K340-E342 PolarHBondContact NZ-OE1 2.91Å; K340-E342 IonicContact NZ-OE2 3.99Å; K340-E342 PolarHBondContact NZ-OE2 3.48Å; K340-K360 VanDerWaalsContact CA-O 3.31Å; K340-K360 WeakPolarHBondContact CA-O 3.37Å
341	G	63.7	Low	78.2	Confident	8 Å²	8	40.6 Å²	40.6	8%	0.082	22%	0.219	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-177.4	151.7	168.1	0	0	0	0	0	113.5	G321 K360 G361	G321-G341 WeakPolarHBondContact O-CA 3.33Å; G341-K360 PolarHBondContact N-O 3.03Å; G341-G361 WeakPolarHBondContact O-CA 3.46Å
342	E	65.7	Low	78.4	Confident	57 Å²	57	42.6 Å²	42.6	27%	0.266	23%	0.226	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	148.4	177.5	-71.6	100.8	-111.1	0	0	110.8	E322 G323 K340 E362	E322-E342 VanDerWaalsContact CA-O 3.31Å; E322-E342 WeakPolarHBondContact CA-O 3.37Å; E322-E342 HydrophobicContact CG-CB 4.07Å; G323-E342 PolarHBondContact N-O 2.86Å; K340-E342 WeakPolarHBondContact CE-OE1 3.44Å; K340-E342 IonicContact NZ-OE1 2.63Å; K340-E342 PolarHBondContact NZ-OE1 2.91Å; K340-E342 IonicContact NZ-OE2 3.99Å; K340-E342 PolarHBondContact NZ-OE2 3.48Å; E342-E362 WeakPolarHBondContact CA-O 3.49Å; E342-E362 HydrophobicContact CG-CB 3.9Å
343	G	67.9	Low	78.2	Confident	22 Å²	22	41.7 Å²	41.7	23%	0.227	23%	0.229	C	C	.	.			trans	71.6	40.9	167.5	0	0	0	0	0	116.4	G323 E362 G363	G323-G343 WeakPolarHBondContact CA-O 3.27Å; G343-E362 PolarHBondContact N-O 3.16Å; G343-G363 WeakPolarHBondContact CA-O 3.41Å
344	G	77.6	Confident	78.5	Confident	15 Å²	15	41 Å²	41	16%	0.155	22%	0.221	C	C	.	.			trans	-74.7	120.6	170.1	0	0	0	0	0	111.5	A324 A364 Q365	A324-G344 CarbonylContact O-C 3.57Å; A324-G344 WeakPolarHBondContact O-CA 3.37Å; G344-A364 CarbonylContact O-C 3.55Å; G344-A364 WeakPolarHBondContact O-CA 3.32Å; G344-Q365 PolarHBondContact O-N 3.32Å
345	Q	85.9	Confident	78.6	Confident	41 Å²	41	42 Å²	42	19%	0.192	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-124.4	139.2	-173.8	-57.9	-175.3	-27.2	0	0	113.4	A324 Q325 N326 N336 Q365	A324-Q345 PolarHBondContact O-N 2.8Å; Q325-Q345 CarbonylContact C-O 3.52Å; Q325-Q345 WeakPolarHBondContact CA-O 3.38Å; Q325-Q345 HydrophobicContact CG-CB 4.24Å; N326-Q345 PolarHBondContact N-O 3.48Å; N336-Q345 PolarHBondContact ND2-O 2.91Å; Q345-Q365 CarbonylContact C-O 3.58Å; Q345-Q365 VanDerWaalsContact CA-O 3.27Å; Q345-Q365 WeakPolarHBondContact CA-O 3.31Å; Q345-Q365 HydrophobicContact CG-CB 4.29Å
346	N	85.9	Confident	78.4	Confident	8 Å²	8	40.5 Å²	40.5	4%	0.043	22%	0.215	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	131.1	166.2	-56.4	-64.6	0	0	0	110.6	N326 N336 A354 N356 Q365 N366 Q367	N326-N346 WeakPolarHBondContact CB-OD1 3.19Å; N326-N346 PolarHBondContact ND2-OD1 2.93Å; N326-N346 CarbonylContact O-C 3.53Å; N326-N346 WeakPolarHBondContact O-CA 3.45Å; N336-N346 PolarHBondContact ND2-OD1 3.33Å; N336-N346 VanDerWaalsContact ND2-OD1 3.15Å; N346-A354 HydrophobicContact CB-CB 4.07Å; N346-N356 PolarHBondContact ND2-OD1 2.85Å; N346-Q365 PolarHBondContact N-O 3.05Å; N346-N366 WeakPolarHBondContact CB-OD1 3.32Å; N346-N366 PolarHBondContact ND2-OD1 2.99Å; N346-N366 CarbonylContact O-C 3.5Å; N346-N366 WeakPolarHBondContact O-CA 3.36Å; N346-Q367 PolarHBondContact O-N 2.96Å
347	Q	85.5	Confident	78.3	Confident	66 Å²	66	43 Å²	43	31%	0.308	23%	0.227	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.2	132	-179.9	-56.3	-169.2	19.3	0	0	112.1	N326 Q327 S328 Q367	N326-Q347 PolarHBondContact O-N 2.81Å; Q327-Q347 CarbonylContact C-O 3.51Å; Q327-Q347 WeakPolarHBondContact CA-O 2.96Å; Q327-Q347 HydrophobicContact CG-CB 4.38Å; S328-Q347 PolarHBondContact N-O 2.81Å; Q347-Q367 CarbonylContact C-O 3.54Å; Q347-Q367 WeakPolarHBondContact CA-O 3.41Å; Q347-Q367 HydrophobicContact CG-CB 4.38Å
348	A	82.4	Confident	77.9	Confident	20 Å²	20	41 Å²	41	17%	0.165	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-146.3	154.9	-178.6	0	0	0	0	0	113.8	S328 Q367 A368 K369	S328-A348 WeakPolarHBondContact O-CA 3Å; A348-Q367 PolarHBondContact N-O 2.96Å; A348-A368 WeakPolarHBondContact O-CA 3.43Å; A348-K369 PolarHBondContact O-N 3.1Å
349	K	78.1	Confident	77.7	Confident	115 Å²	115	45.1 Å²	45.1	50%	0.5	23%	0.234	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-85.7	-51	164.6	-60.7	-170.3	-179.5	-170.8	0	111.1	S328 K329 K369 K370	S328-K349 PolarHBondContact O-N 3.21Å; K329-K349 HydrophobicContact CG-CD 4.49Å; K329-K349 WeakPolarHBondContact O-CA 3.25Å; K329-K349 WeakPolarHBondContact O-CB 3.08Å; K329-K349 PolarHBondContact O-N 3.41Å; K349-K369 WeakPolarHBondContact O-CB 3.49Å; K349-K369 PolarHBondContact O-N 2.92Å; K349-K370 PolarHBondContact O-N 2.93Å
350	K	80	Confident	77.6	Confident	75 Å²	75	44 Å²	44	33%	0.326	23%	0.229	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-115.5	127.6	157.4	-163	-159.5	-172.6	-144.7	0	107.7	K329 K330 G331 E352 K370	K329-K350 PolarHBondContact O-N 2.91Å; K330-K350 WeakPolarHBondContact CA-O 3.44Å; K330-K350 HydrophobicContact CG-CB 4.45Å; G331-K350 PolarHBondContact N-O 2.85Å; K350-E352 WeakPolarHBondContact CD-OE1 3.38Å; K350-E352 WeakPolarHBondContact CE-OE1 3.39Å; K350-E352 IonicContact NZ-OE1 2.76Å; K350-E352 PolarHBondContact NZ-OE1 2.8Å; K350-E352 IonicContact NZ-OE2 2.75Å; K350-K370 WeakPolarHBondContact CA-O 3.34Å; K350-K370 HydrophobicContact CG-CB 4.4Å
351	G	71.4	Confident	77.2	Confident	6 Å²	6	40.9 Å²	40.9	6%	0.062	22%	0.218	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-142.3	132.4	-177.7	0	0	0	0	0	113.2	G331 K370 G371 E372	G331-G351 CarbonylContact O-C 3.53Å; G331-G351 VanDerWaalsContact O-CA 3.26Å; G331-G351 WeakPolarHBondContact O-CA 3.37Å; G351-K370 PolarHBondContact N-O 2.97Å; G351-G371 VanDerWaalsContact O-CA 3.27Å; G351-G371 WeakPolarHBondContact O-CA 3.4Å; G351-E372 PolarHBondContact O-N 3.13Å; G351-E372 VanDerWaalsContact O-N 3.09Å
352	E	78	Confident	77.4	Confident	50 Å²	50	43.2 Å²	43.2	23%	0.234	23%	0.226	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-124.9	135.2	178.5	-71.7	144.1	-112.5	0	0	110.4	G331 E332 G333 K350 A354 E372	G331-E352 PolarHBondContact O-N 3.04Å; E332-E352 CarbonylContact C-O 3.54Å; E332-E352 WeakPolarHBondContact CA-O 2.96Å; E332-E352 HydrophobicContact CG-CB 4.06Å; G333-E352 PolarHBondContact N-O 2.95Å; K350-E352 WeakPolarHBondContact CD-OE1 3.38Å; K350-E352 WeakPolarHBondContact CE-OE1 3.39Å; K350-E352 IonicContact NZ-OE1 2.76Å; K350-E352 PolarHBondContact NZ-OE1 2.8Å; K350-E352 IonicContact NZ-OE2 2.75Å; E352-A354 PolarHBondContact O-N 3.03Å; E352-E372 WeakPolarHBondContact CA-O 3.35Å; E352-E372 HydrophobicContact CG-CB 4.03Å
353	G	75.8	Confident	77.6	Confident	26 Å²	26	41.7 Å²	41.7	27%	0.268	23%	0.226	S	C	.	.	S	Bend	trans	70.2	29.5	173.7	0	0	0	0	0	116.4	E372	G353-E372 PolarHBondContact N-O 3.3Å
354	A	84.6	Confident	78.2	Confident	13 Å²	13	41.8 Å²	41.8	11%	0.107	23%	0.225	C	C	.	.			trans	-70.9	128.6	176.1	0	0	0	0	0	112.1	A334 N346 E352 V374 Q375	A334-A354 CarbonylContact O-C 3.53Å; A334-A354 VanDerWaalsContact O-CA 3.31Å; A334-A354 WeakPolarHBondContact O-CA 3.3Å; N346-A354 HydrophobicContact CB-CB 4.07Å; E352-A354 PolarHBondContact O-N 3.03Å; A354-V374 CarbonylContact O-C 3.57Å; A354-V374 WeakPolarHBondContact O-CA 3.33Å; A354-Q375 PolarHBondContact O-N 3.27Å
355	Q	87.2	Confident	78.6	Confident	40 Å²	40	43.3 Å²	43.3	19%	0.187	23%	0.228	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-132.8	139.8	-176.1	-55.1	-169.3	6.5	0	0	114.4	A334 Q335 N336 Q375	A334-Q355 PolarHBondContact O-N 3.37Å; Q335-Q355 CarbonylContact C-O 3.57Å; Q335-Q355 VanDerWaalsContact CA-O 3.29Å; Q335-Q355 WeakPolarHBondContact CA-O 3.33Å; Q335-Q355 HydrophobicContact CG-CB 4.3Å; N336-Q355 PolarHBondContact N-O 3.12Å; Q355-Q375 CarbonylContact C-O 3.6Å; Q355-Q375 VanDerWaalsContact CA-O 3.27Å; Q355-Q375 WeakPolarHBondContact CA-O 3.32Å; Q355-Q375 HydrophobicContact CG-CB 4.28Å
356	N	84.9	Confident	78.6	Confident	7 Å²	7	41.6 Å²	41.6	4%	0.037	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	129.3	164.5	-57.4	-53.8	0	0	0	110.2	N336 N346 A364 Q365 N366 Q375 N376 Q377	N336-N356 WeakPolarHBondContact CB-OD1 3.43Å; N336-N356 PolarHBondContact ND2-OD1 3.29Å; N336-N356 CarbonylContact O-C 3.54Å; N336-N356 WeakPolarHBondContact O-CA 3.43Å; N346-N356 PolarHBondContact ND2-OD1 2.85Å; N356-A364 HydrophobicContact CB-CB 3.97Å; N356-Q365 PolarHBondContact ND2-O 2.9Å; N356-N366 PolarHBondContact ND2-ND2 3.41Å; N356-N366 PolarHBondContact ND2-OD1 3.39Å; N356-Q375 PolarHBondContact N-O 2.86Å; N356-N376 WeakPolarHBondContact CB-OD1 3.38Å; N356-N376 PolarHBondContact ND2-OD1 2.93Å; N356-N376 CarbonylContact O-C 3.54Å; N356-N376 WeakPolarHBondContact O-CA 3.42Å; N356-Q377 PolarHBondContact O-N 2.83Å
357	Q	82.9	Confident	78.5	Confident	61 Å²	61	44.8 Å²	44.8	29%	0.285	24%	0.235	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-130.3	124.8	-179.2	-55.9	-168.1	24.4	0	0	112.4	N336 Q337 A338 Q377	N336-Q357 PolarHBondContact O-N 3.07Å; Q337-Q357 CarbonylContact C-O 3.57Å; Q337-Q357 WeakPolarHBondContact CA-O 3.29Å; Q337-Q357 HydrophobicContact CG-CB 4.4Å; A338-Q357 PolarHBondContact N-O 2.94Å; Q357-Q377 WeakPolarHBondContact CA-O 3.44Å; Q357-Q377 HydrophobicContact CG-CB 4.41Å
358	A	76.6	Confident	78.3	Confident	23 Å²	23	42.3 Å²	42.3	19%	0.19	23%	0.225	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	142	-177.7	0	0	0	0	0	113.5	A338 Q377 A378 K379	A338-A358 WeakPolarHBondContact O-CA 3.42Å; A358-Q377 PolarHBondContact N-O 2.98Å; A358-A378 WeakPolarHBondContact O-CA 3.36Å; A358-K379 PolarHBondContact O-N 3.35Å
359	K	72.3	Confident	78.1	Confident	114 Å²	114	47 Å²	47	50%	0.496	24%	0.242	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-80.7	-51.1	166.8	-59.9	-167.1	179.7	-168.3	0	112	A338 K339 K379 K380	A338-K359 PolarHBondContact O-N 2.83Å; A338-K359 VanDerWaalsContact O-N 3.09Å; K339-K359 HydrophobicContact CG-CD 4.35Å; K339-K359 VanDerWaalsContact O-CB 3.32Å; K339-K359 WeakPolarHBondContact O-CB 3.35Å; K359-K379 HydrophobicContact CG-CD 4.47Å; K359-K379 CarbonylContact O-C 3.51Å; K359-K380 PolarHBondContact O-N 3.04Å
360	K	70.8	Confident	78.1	Confident	85 Å²	85	45.2 Å²	45.2	37%	0.37	23%	0.234	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.7	139.2	154.1	-172	-164.9	176.2	-140.9	0	107.7	K339 K340 G341 E362 K380	K339-K360 PolarHBondContact O-N 3.13Å; K340-K360 VanDerWaalsContact CA-O 3.31Å; K340-K360 WeakPolarHBondContact CA-O 3.37Å; G341-K360 PolarHBondContact N-O 3.03Å; K360-E362 WeakPolarHBondContact CE-OE1 3.48Å; K360-E362 IonicContact NZ-OE1 2.61Å; K360-E362 PolarHBondContact NZ-OE1 2.85Å; K360-K380 WeakPolarHBondContact CA-O 3.49Å; K360-K380 WeakPolarHBondContact CG-O 3.19Å
361	G	64.4	Low	77.6	Confident	7 Å²	7	41.7 Å²	41.7	7%	0.072	22%	0.219	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-178.7	168.8	172.1	0	0	0	0	0	112.8	G341 V382	G341-G361 WeakPolarHBondContact O-CA 3.46Å; G361-V382 PolarHBondContact O-N 2.74Å
362	E	67.6	Low	77.8	Confident	56 Å²	56	43.9 Å²	43.9	26%	0.262	23%	0.228	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-137.7	154.3	-174.7	-71	133.1	-130.8	0	0	109.4	E342 G343 K360 A364 V382 E383	E342-E362 WeakPolarHBondContact CA-O 3.49Å; E342-E362 HydrophobicContact CG-CB 3.9Å; G343-E362 PolarHBondContact N-O 3.16Å; K360-E362 WeakPolarHBondContact CE-OE1 3.48Å; K360-E362 IonicContact NZ-OE1 2.61Å; K360-E362 PolarHBondContact NZ-OE1 2.85Å; E362-A364 PolarHBondContact O-N 3.38Å; E362-V382 HydrophobicContact CG-CB 3.45Å; E362-V382 VanDerWaalsContact CG-CB 3.45Å; E362-V382 HydrophobicContact CG-CG1 3.86Å; E362-E383 WeakPolarHBondContact CA-O 3.37Å
363	G	68.8	Low	77.6	Confident	26 Å²	26	42.7 Å²	42.7	27%	0.268	23%	0.229	S	C	.	.			trans	67	34.6	167.1	0	0	0	0	0	117	G343 Q365 E383 G384	G343-G363 WeakPolarHBondContact CA-O 3.41Å; G363-Q365 PolarHBondContact O-N 3.47Å; G363-E383 PolarHBondContact N-O 2.88Å; G363-G384 CarbonylContact C-O 3.57Å; G363-G384 WeakPolarHBondContact CA-O 3.34Å
364	A	80.8	Confident	77.9	Confident	23 Å²	23	41.7 Å²	41.7	19%	0.19	22%	0.218	C	C	.	.			trans	-76	116.2	176.6	0	0	0	0	0	111.6	G344 N356 E362 G384 A385 Q386	G344-A364 CarbonylContact O-C 3.55Å; G344-A364 WeakPolarHBondContact O-CA 3.32Å; N356-A364 HydrophobicContact CB-CB 3.97Å; E362-A364 PolarHBondContact O-N 3.38Å; A364-G384 PolarHBondContact N-O 3.43Å; A364-A385 CarbonylContact O-C 3.58Å; A364-A385 VanDerWaalsContact O-CA 3.32Å; A364-A385 WeakPolarHBondContact O-CA 3.4Å; A364-Q386 PolarHBondContact O-N 2.72Å
365	Q	85.8	Confident	78	Confident	47 Å²	47	43.1 Å²	43.1	22%	0.22	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	141.4	-173.3	-61.6	-179.9	-36.7	0	0	113	G344 Q345 N346 N356 G363 Q386	G344-Q365 PolarHBondContact O-N 3.32Å; Q345-Q365 CarbonylContact C-O 3.58Å; Q345-Q365 VanDerWaalsContact CA-O 3.27Å; Q345-Q365 WeakPolarHBondContact CA-O 3.31Å; Q345-Q365 HydrophobicContact CG-CB 4.29Å; N346-Q365 PolarHBondContact N-O 3.05Å; N356-Q365 PolarHBondContact ND2-O 2.9Å; G363-Q365 PolarHBondContact O-N 3.47Å; Q365-Q386 CarbonylContact C-O 3.55Å; Q365-Q386 VanDerWaalsContact CA-O 3.31Å; Q365-Q386 WeakPolarHBondContact CA-O 3.4Å; Q365-Q386 HydrophobicContact CG-CB 4.33Å
366	N	86.1	Confident	77.9	Confident	6 Å²	6	41.4 Å²	41.4	3%	0.032	21%	0.214	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-131	132.9	169	-57.3	-64.4	0	0	0	110.2	N346 N356 V374 N376 Q386 N387 Q388	N346-N366 WeakPolarHBondContact CB-OD1 3.32Å; N346-N366 PolarHBondContact ND2-OD1 2.99Å; N346-N366 CarbonylContact O-C 3.5Å; N346-N366 WeakPolarHBondContact O-CA 3.36Å; N356-N366 PolarHBondContact ND2-ND2 3.41Å; N356-N366 PolarHBondContact ND2-OD1 3.39Å; N366-V374 HydrophobicContact CB-CG1 3.38Å; N366-V374 VanDerWaalsContact CG-CG1 3.45Å; N366-V374 VanDerWaalsContact ND2-CG1 3.29Å; N366-V374 WeakPolarHBondContact ND2-CG1 3.39Å; N366-N376 PolarHBondContact ND2-ND2 2.83Å; N366-N376 PolarHBondContact ND2-OD1 2.93Å; N366-Q386 PolarHBondContact N-O 3.19Å; N366-N387 PolarHBondContact ND2-OD1 3.47Å; N366-N387 CarbonylContact O-C 3.6Å; N366-N387 WeakPolarHBondContact O-CA 3.42Å; N366-Q388 PolarHBondContact O-N 2.9Å
367	Q	84.3	Confident	77.7	Confident	75 Å²	75	44 Å²	44	35%	0.35	23%	0.226	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.4	116.7	179.6	-55.7	-169.9	16	0	0	111	N346 Q347 A348 Q388	N346-Q367 PolarHBondContact O-N 2.96Å; Q347-Q367 CarbonylContact C-O 3.54Å; Q347-Q367 WeakPolarHBondContact CA-O 3.41Å; Q347-Q367 HydrophobicContact CG-CB 4.38Å; A348-Q367 PolarHBondContact N-O 2.96Å; Q367-Q388 WeakPolarHBondContact CA-O 3.27Å; Q367-Q388 HydrophobicContact CG-CB 4.41Å
368	A	81.2	Confident	77.4	Confident	13 Å²	13	42.2 Å²	42.2	11%	0.107	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-137.6	128.4	-177.5	0	0	0	0	0	112.4	A348 Q388 G389 K390	A348-A368 WeakPolarHBondContact O-CA 3.43Å; A368-Q388 PolarHBondContact N-O 3.48Å; A368-G389 WeakPolarHBondContact O-CA 3.46Å; A368-K390 PolarHBondContact O-N 2.95Å
369	K	78.7	Confident	77.1	Confident	118 Å²	118	46.7 Å²	46.7	51%	0.513	24%	0.237	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-69.4	-46.7	177.5	-62.1	-172.4	-179.5	-174.2	0	111.3	A348 K349 K390 K391	A348-K369 PolarHBondContact O-N 3.1Å; K349-K369 WeakPolarHBondContact O-CB 3.49Å; K349-K369 PolarHBondContact O-N 2.92Å; K369-K390 WeakPolarHBondContact O-CA 3.37Å; K369-K390 VanDerWaalsContact O-CB 3.24Å; K369-K390 WeakPolarHBondContact O-CB 3.35Å; K369-K390 PolarHBondContact O-N 3.2Å; K369-K391 PolarHBondContact O-N 2.9Å
370	K	78	Confident	76.9	Confident	78 Å²	78	48.6 Å²	48.6	34%	0.339	25%	0.245	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	127.1	152.5	-166.7	-166.8	-173.6	-152.6	0	107.8	K349 K350 G351 E372 K391 E393	K349-K370 PolarHBondContact O-N 2.93Å; K350-K370 WeakPolarHBondContact CA-O 3.34Å; K350-K370 HydrophobicContact CG-CB 4.4Å; G351-K370 PolarHBondContact N-O 2.97Å; K370-E372 WeakPolarHBondContact CE-OE1 3.2Å; K370-E372 IonicContact NZ-OE1 2.68Å; K370-E372 PolarHBondContact NZ-OE1 2.97Å; K370-K391 WeakPolarHBondContact CA-O 3.36Å; K370-K391 HydrophobicContact CG-CB 4.35Å; K370-E393 WeakPolarHBondContact CE-OE1 3.36Å; K370-E393 IonicContact NZ-OE1 2.88Å
371	G	69.1	Low	76.2	Confident	1 Å²	1	45 Å²	45	1%	0.01	23%	0.232	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-136.2	138.3	-178.7	0	0	0	0	0	113.1	G351 K391 G392 E393	G351-G371 VanDerWaalsContact O-CA 3.27Å; G351-G371 WeakPolarHBondContact O-CA 3.4Å; G371-K391 PolarHBondContact N-O 2.92Å; G371-G392 WeakPolarHBondContact O-CA 3.34Å; G371-E393 PolarHBondContact O-N 3.34Å
372	E	76	Confident	75.6	Confident	52 Å²	52	47.7 Å²	47.7	24%	0.243	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-134.9	135	-179.9	-59	167.8	-132.9	0	0	109.6	G351 E352 G353 K370 V374 E393	G351-E372 PolarHBondContact O-N 3.13Å; G351-E372 VanDerWaalsContact O-N 3.09Å; E352-E372 WeakPolarHBondContact CA-O 3.35Å; E352-E372 HydrophobicContact CG-CB 4.03Å; G353-E372 PolarHBondContact N-O 3.3Å; K370-E372 WeakPolarHBondContact CE-OE1 3.2Å; K370-E372 IonicContact NZ-OE1 2.68Å; K370-E372 PolarHBondContact NZ-OE1 2.97Å; E372-V374 PolarHBondContact O-N 3.41Å; E372-E393 WeakPolarHBondContact CA-O 3.38Å; E372-E393 HydrophobicContact CG-CB 4.15Å; E372-E393 HydrophobicContact CG-CG 4.43Å
373	G	73.3	Confident	75.2	Confident	25 Å²	25	50.1 Å²	50.1	26%	0.258	26%	0.259	S	S	.	.	S	Bend	trans	69.5	29.1	174.6	0	0	0	0	0	115.9	E393	G373-E393 PolarHBondContact N-O 2.88Å
374	V	82.6	Confident	75	Confident	6 Å²	6	50 Å²	50	4%	0.036	26%	0.258	C	S	.	.			trans	-73.9	132.1	-179.3	-178.8	0	0	0	0	111.3	A354 N366 E372 N387 N395 Q396	A354-V374 CarbonylContact O-C 3.57Å; A354-V374 WeakPolarHBondContact O-CA 3.33Å; N366-V374 HydrophobicContact CB-CG1 3.38Å; N366-V374 VanDerWaalsContact CG-CG1 3.45Å; N366-V374 VanDerWaalsContact ND2-CG1 3.29Å; N366-V374 WeakPolarHBondContact ND2-CG1 3.39Å; E372-V374 PolarHBondContact O-N 3.41Å; V374-N387 WeakPolarHBondContact CG1-OD1 3.14Å; V374-N395 CarbonylContact O-C 3.52Å; V374-N395 WeakPolarHBondContact O-CA 3.47Å; V374-Q396 PolarHBondContact O-N 2.93Å
375	Q	85.9	Confident	74.9	Confident	42 Å²	42	50.1 Å²	50.1	20%	0.196	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.3	137	-176.8	-53.2	-170.6	15.7	0	0	115.2	A354 Q355 N356 Q396	A354-Q375 PolarHBondContact O-N 3.27Å; Q355-Q375 CarbonylContact C-O 3.6Å; Q355-Q375 VanDerWaalsContact CA-O 3.27Å; Q355-Q375 WeakPolarHBondContact CA-O 3.32Å; Q355-Q375 HydrophobicContact CG-CB 4.28Å; N356-Q375 PolarHBondContact N-O 2.86Å; Q375-Q396 CarbonylContact C-O 3.54Å; Q375-Q396 VanDerWaalsContact CA-O 3.3Å; Q375-Q396 WeakPolarHBondContact CA-O 3.34Å; Q375-Q396 HydrophobicContact CG-CB 4.29Å
376	N	84.9	Confident	74.9	Confident	5 Å²	5	49.9 Å²	49.9	3%	0.027	26%	0.257	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	131	164.2	-61.5	-51.8	0	0	0	110.4	N356 N366 A385 N387 Q396 N397 Q398	N356-N376 WeakPolarHBondContact CB-OD1 3.38Å; N356-N376 PolarHBondContact ND2-OD1 2.93Å; N356-N376 CarbonylContact O-C 3.54Å; N356-N376 WeakPolarHBondContact O-CA 3.42Å; N366-N376 PolarHBondContact ND2-ND2 2.83Å; N366-N376 PolarHBondContact ND2-OD1 2.93Å; N376-A385 HydrophobicContact CB-CB 4.08Å; N376-N387 PolarHBondContact ND2-OD1 2.65Å; N376-Q396 PolarHBondContact N-O 3.28Å; N376-N397 WeakPolarHBondContact CB-OD1 3.3Å; N376-N397 PolarHBondContact ND2-OD1 3.49Å; N376-N397 CarbonylContact O-C 3.53Å; N376-N397 WeakPolarHBondContact O-CA 3Å; N376-Q398 PolarHBondContact O-N 2.88Å
377	Q	81.9	Confident	74.8	Confident	61 Å²	61	49.6 Å²	49.6	29%	0.285	26%	0.256	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	122.8	-179.3	-56.9	-169	19.2	0	0	112.9	N356 Q357 A358 Q398	N356-Q377 PolarHBondContact O-N 2.83Å; Q357-Q377 WeakPolarHBondContact CA-O 3.44Å; Q357-Q377 HydrophobicContact CG-CB 4.41Å; A358-Q377 PolarHBondContact N-O 2.98Å; Q377-Q398 CarbonylContact C-O 3.49Å; Q377-Q398 WeakPolarHBondContact CA-O 3.46Å; Q377-Q398 HydrophobicContact CG-CB 4.42Å
378	A	75.9	Confident	74.8	Confident	23 Å²	23	49.4 Å²	49.4	19%	0.19	26%	0.255	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	128.2	-177.8	0	0	0	0	0	113.4	A358 Q398 A399 K400	A358-A378 WeakPolarHBondContact O-CA 3.36Å; A378-Q398 PolarHBondContact N-O 2.9Å; A378-A399 WeakPolarHBondContact O-CA 3.38Å; A378-K400 PolarHBondContact O-N 3.02Å
379	K	71.6	Confident	74.7	Confident	118 Å²	118	49.9 Å²	49.9	51%	0.513	26%	0.261	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.9	-24.6	179.3	-62.2	-177.9	-177.7	174.5	0	114.1	A358 K359 K400	A358-K379 PolarHBondContact O-N 3.35Å; K359-K379 HydrophobicContact CG-CD 4.47Å; K359-K379 CarbonylContact O-C 3.51Å; K379-K400 HydrophobicContact CB-CD 4.49Å; K379-K400 WeakPolarHBondContact O-CB 3.31Å
380	K	66.6	Low	74.8	Confident	153 Å²	153	49.8 Å²	49.8	67%	0.665	26%	0.261	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-150.6	80.4	166.1	-71.6	-174.2	178.1	-177.4	0	106.8	K359 K360	K359-K380 PolarHBondContact O-N 3.04Å; K360-K380 WeakPolarHBondContact CA-O 3.49Å; K360-K380 WeakPolarHBondContact CG-O 3.19Å
381	G	57.3	Low	74.8	Confident	10 Å²	10	48.9 Å²	48.9	10%	0.103	26%	0.257	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.7	148.1	177.4	0	0	0	0	0	111.4	K401 G402	G381-K401 WeakPolarHBondContact CA-O 3.48Å; G381-K401 PolarHBondContact N-O 3.15Å; G381-G402 WeakPolarHBondContact O-CA 3.25Å
382	V	51.5	Low	74.7	Confident	64 Å²	64	49 Å²	49	39%	0.388	26%	0.258	S	S	.	.			trans	-104.8	174.3	140.4	173.6	0	0	0	0	105.4	G361 E362	G361-V382 PolarHBondContact O-N 2.74Å; E362-V382 HydrophobicContact CG-CB 3.45Å; E362-V382 VanDerWaalsContact CG-CB 3.45Å; E362-V382 HydrophobicContact CG-CG1 3.86Å
383	E	59.1	Low	74.6	Confident	107 Å²	107	48.7 Å²	48.7	50%	0.5	26%	0.257	S	S	.	.	S	Bend	trans	-24.4	157.8	-170.2	-67.7	149.5	-113.1	0	0	121.7	E362 G363 E403	E362-E383 WeakPolarHBondContact CA-O 3.37Å; G363-E383 PolarHBondContact N-O 2.88Å; E383-E403 HydrophobicContact CG-CB 4.32Å; E383-E403 HydrophobicContact CG-CG 4.34Å
384	G	65.1	Low	74.5	Confident	24 Å²	24	49.8 Å²	49.8	25%	0.247	26%	0.263	C	S	.	.			trans	93.3	28	144.9	0	0	0	0	0	118.1	G363 A364 Q386	G363-G384 CarbonylContact C-O 3.57Å; G363-G384 WeakPolarHBondContact CA-O 3.34Å; A364-G384 PolarHBondContact N-O 3.43Å; G384-Q386 PolarHBondContact O-N 2.82Å
385	A	79	Confident	74.4	Confident	24 Å²	24	49.9 Å²	49.9	20%	0.198	26%	0.264	C	S	.	.			trans	-73.7	108.6	168.4	0	0	0	0	0	110.7	A364 N376 G405 Q406	A364-A385 CarbonylContact O-C 3.58Å; A364-A385 VanDerWaalsContact O-CA 3.32Å; A364-A385 WeakPolarHBondContact O-CA 3.4Å; N376-A385 HydrophobicContact CB-CB 4.08Å; A385-G405 CarbonylContact O-C 3.52Å; A385-G405 WeakPolarHBondContact O-CA 3.39Å; A385-Q406 PolarHBondContact O-N 2.97Å
386	Q	84.3	Confident	74.4	Confident	42 Å²	42	50 Å²	50	20%	0.196	26%	0.264	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.9	130.1	-173.1	-59.3	-179.1	-47.8	0	0	112.8	A364 Q365 N366 G384 Q406	A364-Q386 PolarHBondContact O-N 2.72Å; Q365-Q386 CarbonylContact C-O 3.55Å; Q365-Q386 VanDerWaalsContact CA-O 3.31Å; Q365-Q386 WeakPolarHBondContact CA-O 3.4Å; Q365-Q386 HydrophobicContact CG-CB 4.33Å; N366-Q386 PolarHBondContact N-O 3.19Å; G384-Q386 PolarHBondContact O-N 2.82Å; Q386-Q406 WeakPolarHBondContact CA-O 3.1Å; Q386-Q406 HydrophobicContact CG-CB 4.26Å
387	N	85.2	Confident	74.4	Confident	1 Å²	1	50.1 Å²	50.1	1%	0.005	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	123.5	170	-55.3	-50.1	0	0	0	110.3	N366 V374 N376 N395 N397 Q406 N407 Q408	N366-N387 PolarHBondContact ND2-OD1 3.47Å; N366-N387 CarbonylContact O-C 3.6Å; N366-N387 WeakPolarHBondContact O-CA 3.42Å; V374-N387 WeakPolarHBondContact CG1-OD1 3.14Å; N376-N387 PolarHBondContact ND2-OD1 2.65Å; N387-N395 HydrophobicContact CB-CB 4.43Å; N387-N397 PolarHBondContact ND2-ND2 2.68Å; N387-N397 PolarHBondContact ND2-OD1 2.81Å; N387-Q406 PolarHBondContact N-O 3.28Å; N387-N407 PolarHBondContact ND2-OD1 3.34Å; N387-N407 CarbonylContact O-C 3.46Å; N387-N407 WeakPolarHBondContact O-CA 3.4Å; N387-Q408 PolarHBondContact O-N 2.82Å
388	Q	84.7	Confident	74.4	Confident	70 Å²	70	50.3 Å²	50.3	33%	0.327	27%	0.266	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	147	-178	-58.4	-171.6	9.7	0	0	112.7	N366 Q367 A368 Q408	N366-Q388 PolarHBondContact O-N 2.9Å; Q367-Q388 WeakPolarHBondContact CA-O 3.27Å; Q367-Q388 HydrophobicContact CG-CB 4.41Å; A368-Q388 PolarHBondContact N-O 3.48Å; Q388-Q408 CarbonylContact C-O 3.56Å; Q388-Q408 VanDerWaalsContact CA-O 3.26Å; Q388-Q408 WeakPolarHBondContact CA-O 3.27Å; Q388-Q408 HydrophobicContact CG-CB 4.5Å
389	G	79.3	Confident	74.4	Confident	24 Å²	24	50.3 Å²	50.3	25%	0.247	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-174.8	-171.7	177	0	0	0	0	0	118.3	A368 Q408 T409	A368-G389 WeakPolarHBondContact O-CA 3.46Å; G389-Q408 PolarHBondContact N-O 3.03Å; G389-T409 WeakPolarHBondContact O-CA 3.3Å
390	K	79.6	Confident	74.3	Confident	116 Å²	116	49.8 Å²	49.8	50%	0.504	26%	0.264	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.2	-59.4	166.5	-57.1	-174.1	178	-174.8	0	111.3	A368 K369 K410 K411	A368-K390 PolarHBondContact O-N 2.95Å; K369-K390 WeakPolarHBondContact O-CA 3.37Å; K369-K390 VanDerWaalsContact O-CB 3.24Å; K369-K390 WeakPolarHBondContact O-CB 3.35Å; K369-K390 PolarHBondContact O-N 3.2Å; K390-K410 HydrophobicContact CG-CD 4.41Å; K390-K410 CarbonylContact O-C 3.56Å; K390-K410 WeakPolarHBondContact O-CA 3.39Å; K390-K410 WeakPolarHBondContact O-CB 3.05Å; K390-K410 PolarHBondContact O-N 2.97Å; K390-K411 PolarHBondContact O-N 3.4Å
391	K	78	Confident	74.5	Confident	59 Å²	59	49.3 Å²	49.3	26%	0.257	26%	0.261	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	131	164.3	-163.4	-166.7	-175.8	-156.8	0	108.9	K369 K370 G371 E393 K411 E413	K369-K391 PolarHBondContact O-N 2.9Å; K370-K391 WeakPolarHBondContact CA-O 3.36Å; K370-K391 HydrophobicContact CG-CB 4.35Å; G371-K391 PolarHBondContact N-O 2.92Å; K391-E393 HydrophobicContact CD-CG 4.41Å; K391-E393 VanDerWaalsContact CD-OE1 3.32Å; K391-E393 WeakPolarHBondContact CD-OE1 3.44Å; K391-E393 WeakPolarHBondContact CE-OE1 3.35Å; K391-E393 IonicContact NZ-OE1 2.83Å; K391-E393 PolarHBondContact NZ-OE1 2.86Å; K391-E393 IonicContact NZ-OE2 3.64Å; K391-E393 PolarHBondContact NZ-OE2 2.83Å; K391-K411 WeakPolarHBondContact CA-O 3.19Å; K391-K411 HydrophobicContact CG-CB 4.42Å; K391-E413 WeakPolarHBondContact CE-OE1 3.3Å; K391-E413 IonicContact NZ-OE1 3.93Å; K391-E413 PolarHBondContact NZ-OE1 2.92Å; K391-E413 IonicContact NZ-OE2 2.84Å; K391-E413 PolarHBondContact NZ-OE2 2.81Å; K391-E413 VanDerWaalsContact NZ-OE2 3.1Å
392	G	67.5	Low	74.8	Confident	4 Å²	4	49.6 Å²	49.6	4%	0.041	26%	0.264	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.7	133.9	176	0	0	0	0	0	111.7	G371 K411 G412 E413	G371-G392 WeakPolarHBondContact O-CA 3.34Å; G392-K411 PolarHBondContact N-O 3.34Å; G392-G412 WeakPolarHBondContact O-CA 3.47Å; G392-E413 PolarHBondContact O-N 2.95Å
393	E	73.1	Confident	75.3	Confident	45 Å²	45	50.9 Å²	50.9	21%	0.21	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.4	129.5	-178.7	-54.8	176.4	-131.8	0	0	109.5	K370 G371 E372 G373 K391 N395 E413	K370-E393 WeakPolarHBondContact CE-OE1 3.36Å; K370-E393 IonicContact NZ-OE1 2.88Å; G371-E393 PolarHBondContact O-N 3.34Å; E372-E393 WeakPolarHBondContact CA-O 3.38Å; E372-E393 HydrophobicContact CG-CB 4.15Å; E372-E393 HydrophobicContact CG-CG 4.43Å; G373-E393 PolarHBondContact N-O 2.88Å; K391-E393 HydrophobicContact CD-CG 4.41Å; K391-E393 VanDerWaalsContact CD-OE1 3.32Å; K391-E393 WeakPolarHBondContact CD-OE1 3.44Å; K391-E393 WeakPolarHBondContact CE-OE1 3.35Å; K391-E393 IonicContact NZ-OE1 2.83Å; K391-E393 PolarHBondContact NZ-OE1 2.86Å; K391-E393 IonicContact NZ-OE2 3.64Å; K391-E393 PolarHBondContact NZ-OE2 2.83Å; E393-N395 VanDerWaalsContact C-N 3.33Å; E393-N395 PolarHBondContact O-N 2.82Å; E393-E413 WeakPolarHBondContact CA-O 3.44Å; E393-E413 HydrophobicContact CG-CB 4.35Å
394	A	71.1	Confident	75.6	Confident	47 Å²	47	46.5 Å²	46.5	39%	0.388	25%	0.25	S	C	.	.	S	Bend	trans	56.5	34.3	179.6	0	0	0	0	0	116	Q396 E413	A394-Q396 WeakPolarHBondContact O-CG 3.36Å; A394-Q396 PolarHBondContact O-N 2.9Å; A394-E413 PolarHBondContact N-O 2.81Å
395	N	81.5	Confident	76.1	Confident	9 Å²	9	45.7 Å²	45.7	5%	0.048	24%	0.242	C	C	.	.			trans	-62.4	124.5	171.8	-70.4	-2.1	0	0	0	110.9	V374 N387 E393 P415 Q416	V374-N395 CarbonylContact O-C 3.52Å; V374-N395 WeakPolarHBondContact O-CA 3.47Å; N387-N395 HydrophobicContact CB-CB 4.43Å; E393-N395 VanDerWaalsContact C-N 3.33Å; E393-N395 PolarHBondContact O-N 2.82Å; N395-P415 HydrophobicContact CB-CB 4.48Å; N395-P415 CarbonylContact O-C 3.58Å; N395-P415 WeakPolarHBondContact O-CA 3.31Å; N395-Q416 PolarHBondContact O-N 2.88Å
396	Q	85.9	Confident	76.3	Confident	45 Å²	45	47.2 Å²	47.2	21%	0.21	24%	0.244	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	134.3	-179.6	-53.9	-167.4	16.7	0	0	113.5	V374 Q375 N376 A394 Q416	V374-Q396 PolarHBondContact O-N 2.93Å; Q375-Q396 CarbonylContact C-O 3.54Å; Q375-Q396 VanDerWaalsContact CA-O 3.3Å; Q375-Q396 WeakPolarHBondContact CA-O 3.34Å; Q375-Q396 HydrophobicContact CG-CB 4.29Å; N376-Q396 PolarHBondContact N-O 3.28Å; A394-Q396 WeakPolarHBondContact O-CG 3.36Å; A394-Q396 PolarHBondContact O-N 2.9Å; Q396-Q416 CarbonylContact C-O 3.59Å; Q396-Q416 WeakPolarHBondContact CA-O 3.34Å; Q396-Q416 HydrophobicContact CG-CB 4.33Å
397	N	85.3	Confident	76.3	Confident	7 Å²	7	45.2 Å²	45.2	4%	0.037	24%	0.235	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	127.2	164.1	-57.9	-54.6	0	0	0	110.2	N376 N387 G405 N407 Q416 N417 Q418	N376-N397 WeakPolarHBondContact CB-OD1 3.3Å; N376-N397 PolarHBondContact ND2-OD1 3.49Å; N376-N397 CarbonylContact O-C 3.53Å; N376-N397 WeakPolarHBondContact O-CA 3Å; N387-N397 PolarHBondContact ND2-ND2 2.68Å; N387-N397 PolarHBondContact ND2-OD1 2.81Å; N397-G405 WeakPolarHBondContact ND2-CA 3.33Å; N397-N407 PolarHBondContact ND2-ND2 2.94Å; N397-N407 PolarHBondContact ND2-OD1 3.21Å; N397-Q416 PolarHBondContact N-O 3.11Å; N397-N417 WeakPolarHBondContact CB-OD1 3.45Å; N397-N417 PolarHBondContact ND2-OD1 2.91Å; N397-N417 CarbonylContact O-C 3.49Å; N397-N417 WeakPolarHBondContact O-CA 3.31Å; N397-Q418 PolarHBondContact O-N 3.31Å
398	Q	80.8	Confident	76.3	Confident	64 Å²	64	48.5 Å²	48.5	30%	0.299	25%	0.251	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.7	116.5	-179.2	-56.7	-168.2	18.9	0	0	112.2	N376 Q377 A378 Q418	N376-Q398 PolarHBondContact O-N 2.88Å; Q377-Q398 CarbonylContact C-O 3.49Å; Q377-Q398 WeakPolarHBondContact CA-O 3.46Å; Q377-Q398 HydrophobicContact CG-CB 4.42Å; A378-Q398 PolarHBondContact N-O 2.9Å; Q398-Q418 CarbonylContact C-O 3.52Å; Q398-Q418 WeakPolarHBondContact CA-O 3.43Å; Q398-Q418 HydrophobicContact CG-CB 4.4Å
399	A	75.5	Confident	76.1	Confident	24 Å²	24	45.7 Å²	45.7	20%	0.198	24%	0.238	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-130.6	120.1	-176.3	0	0	0	0	0	113.1	A378 Q418 G419 K420	A378-A399 WeakPolarHBondContact O-CA 3.38Å; A399-Q418 PolarHBondContact N-O 3.14Å; A399-G419 WeakPolarHBondContact O-CA 3.38Å; A399-K420 PolarHBondContact O-N 3.46Å
400	K	71.3	Confident	76.1	Confident	107 Å²	107	50 Å²	50	47%	0.465	25%	0.25	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.9	-32	179.1	-65.3	-175.7	-177.4	-176.3	0	113.3	A378 K379 K420	A378-K400 PolarHBondContact O-N 3.02Å; K379-K400 HydrophobicContact CB-CD 4.49Å; K379-K400 WeakPolarHBondContact O-CB 3.31Å; K400-K420 WeakPolarHBondContact O-CB 3.37Å
401	K	70.1	Confident	76.2	Confident	142 Å²	142	47.5 Å²	47.5	62%	0.617	24%	0.239	S	C	*	.	E	Extended strand (participates in β ladder)	trans	-151.2	142.5	167.8	-169.8	-164.7	176.6	-164	0	106.1	G381 K421	G381-K401 WeakPolarHBondContact CA-O 3.48Å; G381-K401 PolarHBondContact N-O 3.15Å; K401-K421 WeakPolarHBondContact CA-O 3.48Å
402	G	63.6	Low	76.1	Confident	16 Å²	16	44.8 Å²	44.8	17%	0.165	23%	0.228	C	C	.	.	S	Bend	trans	138.6	170.4	178.1	0	0	0	0	0	111	G381 K421 G422	G381-G402 WeakPolarHBondContact O-CA 3.25Å; G402-K421 PolarHBondContact N-O 2.9Å; G402-G422 WeakPolarHBondContact O-CA 3.38Å
403	E	61.7	Low	76.6	Confident	92 Å²	92	46.8 Å²	46.8	43%	0.43	24%	0.236	S	C	.	.	S	Bend	trans	-68.3	159	170.9	-68.8	-173.1	-154.8	0	0	112.3	E383	E383-E403 HydrophobicContact CG-CB 4.32Å; E383-E403 HydrophobicContact CG-CG 4.34Å
404	G	65.8	Low	76.7	Confident	15 Å²	15	46 Å²	46	16%	0.155	24%	0.241	C	C	.	.	P	Polyproline II helix	trans	-76.2	147.8	-165.5	0	0	0	0	0	114.2	E423	G404-E423 WeakPolarHBondContact CA-O 3.46Å; G404-E423 PolarHBondContact N-O 3.43Å
405	G	75.2	Confident	77.2	Confident	7 Å²	7	44 Å²	44	7%	0.072	22%	0.224	C	C	.	.	P	Polyproline II helix	trans	-70.5	136.8	173.5	0	0	0	0	0	112.2	A385 N397 N417 Q426	A385-G405 CarbonylContact O-C 3.52Å; A385-G405 WeakPolarHBondContact O-CA 3.39Å; N397-G405 WeakPolarHBondContact ND2-CA 3.33Å; G405-N417 VanDerWaalsContact O-CG 3.27Å; G405-N417 PolarHBondContact O-ND2 2.8Å; G405-N417 PolarHBondContact O-OD1 2.73Å; G405-Q426 PolarHBondContact O-N 3.44Å
406	Q	83.4	Confident	77.4	Confident	55 Å²	55	45.9 Å²	45.9	26%	0.257	23%	0.232	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-98	141.5	175.8	-57.3	178.6	-6.3	0	0	110.2	A385 Q386 N387 Q426	A385-Q406 PolarHBondContact O-N 2.97Å; Q386-Q406 WeakPolarHBondContact CA-O 3.1Å; Q386-Q406 HydrophobicContact CG-CB 4.26Å; N387-Q406 PolarHBondContact N-O 3.28Å; Q406-Q426 WeakPolarHBondContact CA-O 3.21Å; Q406-Q426 HydrophobicContact CG-CB 4.45Å
407	N	84.6	Confident	77.4	Confident	1 Å²	1	44 Å²	44	1%	0.005	22%	0.223	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.4	133.2	169.2	-55.9	-85.9	0	0	0	109.3	N387 N397 N417 Q426 K427 Q428	N387-N407 PolarHBondContact ND2-OD1 3.34Å; N387-N407 CarbonylContact O-C 3.46Å; N387-N407 WeakPolarHBondContact O-CA 3.4Å; N397-N407 PolarHBondContact ND2-ND2 2.94Å; N397-N407 PolarHBondContact ND2-OD1 3.21Å; N407-N417 PolarHBondContact ND2-ND2 3.11Å; N407-N417 PolarHBondContact ND2-OD1 2.84Å; N407-Q426 PolarHBondContact N-O 2.98Å; N407-Q426 VanDerWaalsContact N-O 3.16Å; N407-K427 HydrophobicContact CB-CG 4.46Å; N407-K427 WeakPolarHBondContact O-CA 3.4Å; N407-Q428 PolarHBondContact O-N 3.34Å
408	Q	83.8	Confident	77.2	Confident	70 Å²	70	47 Å²	47	33%	0.327	24%	0.237	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-140	112.2	-179.2	-57.4	-173.2	8	0	0	112.2	N387 Q388 G389 Q428	N387-Q408 PolarHBondContact O-N 2.82Å; Q388-Q408 CarbonylContact C-O 3.56Å; Q388-Q408 VanDerWaalsContact CA-O 3.26Å; Q388-Q408 WeakPolarHBondContact CA-O 3.27Å; Q388-Q408 HydrophobicContact CG-CB 4.5Å; G389-Q408 PolarHBondContact N-O 3.03Å; Q408-Q428 WeakPolarHBondContact CA-O 3.27Å; Q408-Q428 HydrophobicContact CG-CB 4.38Å
409	T	80.9	Confident	76.9	Confident	11 Å²	11	45.1 Å²	45.1	7%	0.067	24%	0.236	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-138.3	177.8	-177.9	75.1	0	0	0	0	112.8	G389 K411 G412 D429 K430	G389-T409 WeakPolarHBondContact O-CA 3.3Å; T409-K411 PolarHBondContact OG1-O 2.84Å; T409-G412 WeakPolarHBondContact OG1-CA 3.32Å; T409-G412 PolarHBondContact OG1-N 2.93Å; T409-D429 WeakPolarHBondContact CA-OD1 3.44Å; T409-D429 VanDerWaalsContact CB-OD1 3.29Å; T409-D429 WeakPolarHBondContact CB-OD1 3.42Å; T409-D429 PolarHBondContact N-OD1 3.08Å; T409-D429 WeakPolarHBondContact O-CA 3.28Å; T409-D429 VanDerWaalsContact OG1-CG 3.27Å; T409-D429 PolarHBondContact OG1-OD1 3.12Å; T409-K430 PolarHBondContact O-N 3.05Å
410	K	80	Confident	76.7	Confident	114 Å²	114	49.2 Å²	49.2	50%	0.496	25%	0.249	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	-37.6	169.1	-57.5	-171.8	-178.2	-172	0	111.4	K390 K430 K431	K390-K410 HydrophobicContact CG-CD 4.41Å; K390-K410 CarbonylContact O-C 3.56Å; K390-K410 WeakPolarHBondContact O-CA 3.39Å; K390-K410 WeakPolarHBondContact O-CB 3.05Å; K390-K410 PolarHBondContact O-N 2.97Å; K410-K430 WeakPolarHBondContact O-CB 3.37Å; K410-K430 PolarHBondContact O-N 3.12Å; K410-K431 PolarHBondContact O-N 2.93Å; K410-K431 VanDerWaalsContact O-N 3.09Å
411	K	81.1	Confident	76.6	Confident	63 Å²	63	47.7 Å²	47.7	27%	0.274	24%	0.242	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-132.4	125.2	163.1	-171.6	-178.5	-161.6	-106.9	0	108.8	K390 K391 G392 T409 E413 K431 E433	K390-K411 PolarHBondContact O-N 3.4Å; K391-K411 WeakPolarHBondContact CA-O 3.19Å; K391-K411 HydrophobicContact CG-CB 4.42Å; G392-K411 PolarHBondContact N-O 3.34Å; T409-K411 PolarHBondContact OG1-O 2.84Å; K411-E413 VanDerWaalsContact CD-OE1 3.24Å; K411-E413 WeakPolarHBondContact CD-OE1 3.4Å; K411-E413 WeakPolarHBondContact CE-OE1 3.2Å; K411-E413 IonicContact NZ-OE1 2.83Å; K411-E413 PolarHBondContact NZ-OE1 3.31Å; K411-E413 IonicContact NZ-OE2 2.62Å; K411-E413 PolarHBondContact NZ-OE2 3.17Å; K411-K431 WeakPolarHBondContact CA-O 3.48Å; K411-K431 HydrophobicContact CG-CB 4.37Å; K411-E433 WeakPolarHBondContact CE-OE1 3.41Å; K411-E433 WeakPolarHBondContact CE-OE2 3.44Å; K411-E433 IonicContact NZ-OE1 2.91Å; K411-E433 PolarHBondContact NZ-OE1 2.88Å; K411-E433 IonicContact NZ-OE2 2.6Å; K411-E433 PolarHBondContact NZ-OE2 3.23Å
412	G	75.7	Confident	76.2	Confident	2 Å²	2	41.8 Å²	41.8	2%	0.021	22%	0.221	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.9	124.9	179.2	0	0	0	0	0	111.5	G392 T409 K431 E433	G392-G412 WeakPolarHBondContact O-CA 3.47Å; T409-G412 WeakPolarHBondContact OG1-CA 3.32Å; T409-G412 PolarHBondContact OG1-N 2.93Å; G412-K431 PolarHBondContact N-O 2.81Å; G412-E433 PolarHBondContact O-N 2.83Å
413	E	78.7	Confident	76.1	Confident	46 Å²	46	45.2 Å²	45.2	22%	0.215	23%	0.233	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	124.1	177.7	-77.6	142.3	-106.5	0	0	110.4	K391 G392 E393 A394 K411 E433	K391-E413 WeakPolarHBondContact CE-OE1 3.3Å; K391-E413 IonicContact NZ-OE1 3.93Å; K391-E413 PolarHBondContact NZ-OE1 2.92Å; K391-E413 IonicContact NZ-OE2 2.84Å; K391-E413 PolarHBondContact NZ-OE2 2.81Å; K391-E413 VanDerWaalsContact NZ-OE2 3.1Å; G392-E413 PolarHBondContact O-N 2.95Å; E393-E413 WeakPolarHBondContact CA-O 3.44Å; E393-E413 HydrophobicContact CG-CB 4.35Å; A394-E413 PolarHBondContact N-O 2.81Å; K411-E413 VanDerWaalsContact CD-OE1 3.24Å; K411-E413 WeakPolarHBondContact CD-OE1 3.4Å; K411-E413 WeakPolarHBondContact CE-OE1 3.2Å; K411-E413 IonicContact NZ-OE1 2.83Å; K411-E413 PolarHBondContact NZ-OE1 3.31Å; K411-E413 IonicContact NZ-OE2 2.62Å; K411-E413 PolarHBondContact NZ-OE2 3.17Å; E413-E433 WeakPolarHBondContact CA-O 3.38Å; E413-E433 HydrophobicContact CG-CB 3.99Å
414	G	75.7	Confident	76.3	Confident	30 Å²	30	42.3 Å²	42.3	31%	0.309	23%	0.225	S	C	.	.	S	Bend	trans	60.9	30.9	-179.8	0	0	0	0	0	117.9	Q416 E433	G414-Q416 PolarHBondContact O-N 3.14Å; G414-E433 PolarHBondContact N-O 3.11Å
415	P	80.8	Confident	76.8	Confident	4 Å²	4	42.2 Å²	42.2	3%	0.026	22%	0.223	C	C	.	.			trans	-69.8	121.2	-179.3	29.4	-34.8	0	0	0	111.8	N395 K427 A435 Q436	N395-P415 HydrophobicContact CB-CB 4.48Å; N395-P415 CarbonylContact O-C 3.58Å; N395-P415 WeakPolarHBondContact O-CA 3.31Å; P415-K427 HydrophobicContact CB-CD 4.12Å; P415-K427 HydrophobicContact CG-CD 3.86Å; P415-K427 WeakPolarHBondContact O-CE 3.5Å; P415-K427 PolarHBondContact O-NZ 2.9Å; P415-A435 HydrophobicContact CG-CB 4.13Å; P415-Q436 PolarHBondContact O-N 2.62Å
416	Q	85.8	Confident	77.2	Confident	48 Å²	48	44.6 Å²	44.6	22%	0.224	23%	0.232	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-110.1	137.8	-176.8	-59.1	-165	-4.9	0	0	113.2	N395 Q396 N397 G414 Q436	N395-Q416 PolarHBondContact O-N 2.88Å; Q396-Q416 CarbonylContact C-O 3.59Å; Q396-Q416 WeakPolarHBondContact CA-O 3.34Å; Q396-Q416 HydrophobicContact CG-CB 4.33Å; N397-Q416 PolarHBondContact N-O 3.11Å; G414-Q416 PolarHBondContact O-N 3.14Å; Q416-Q436 CarbonylContact C-O 3.52Å; Q416-Q436 WeakPolarHBondContact CA-O 3.32Å; Q416-Q436 HydrophobicContact CG-CB 4.36Å
417	N	84.9	Confident	77.3	Confident	5 Å²	5	42 Å²	42	3%	0.027	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	129.9	164.3	-64	-39.7	0	0	0	108.2	N397 G405 N407 A425 Q426 K427 Q436 N437 Q438	N397-N417 WeakPolarHBondContact CB-OD1 3.45Å; N397-N417 PolarHBondContact ND2-OD1 2.91Å; N397-N417 CarbonylContact O-C 3.49Å; N397-N417 WeakPolarHBondContact O-CA 3.31Å; G405-N417 VanDerWaalsContact O-CG 3.27Å; G405-N417 PolarHBondContact O-ND2 2.8Å; G405-N417 PolarHBondContact O-OD1 2.73Å; N407-N417 PolarHBondContact ND2-ND2 3.11Å; N407-N417 PolarHBondContact ND2-OD1 2.84Å; N417-A425 HydrophobicContact CB-CB 4.04Å; N417-Q426 PolarHBondContact ND2-O 3.24Å; N417-K427 PolarHBondContact ND2-NZ 2.85Å; N417-Q436 PolarHBondContact N-O 2.85Å; N417-N437 WeakPolarHBondContact CB-OD1 3.4Å; N417-N437 PolarHBondContact ND2-OD1 2.87Å; N417-N437 CarbonylContact O-C 3.54Å; N417-N437 WeakPolarHBondContact O-CA 2.91Å; N417-Q438 PolarHBondContact O-N 3.06Å
418	Q	82	Confident	77.3	Confident	70 Å²	70	45.7 Å²	45.7	33%	0.327	24%	0.237	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.2	131.8	-179.6	-56	-169.6	19.6	0	0	111.8	N397 Q398 A399 Q438	N397-Q418 PolarHBondContact O-N 3.31Å; Q398-Q418 CarbonylContact C-O 3.52Å; Q398-Q418 WeakPolarHBondContact CA-O 3.43Å; Q398-Q418 HydrophobicContact CG-CB 4.4Å; A399-Q418 PolarHBondContact N-O 3.14Å; Q418-Q438 CarbonylContact C-O 3.59Å; Q418-Q438 WeakPolarHBondContact CA-O 3.34Å
419	G	73.6	Confident	77.2	Confident	26 Å²	26	42.7 Å²	42.7	27%	0.268	22%	0.223	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-157.5	156.1	176.8	0	0	0	0	0	117.8	A399 Q438 G439 K440	A399-G419 WeakPolarHBondContact O-CA 3.38Å; G419-Q438 PolarHBondContact N-O 3.44Å; G419-G439 CarbonylContact O-C 3.53Å; G419-G439 WeakPolarHBondContact O-CA 3.48Å; G419-K440 PolarHBondContact O-N 2.82Å
420	K	72.2	Confident	77.4	Confident	110 Å²	110	47.6 Å²	47.6	48%	0.478	24%	0.244	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-89.6	-44.6	-176.6	-54	-175.3	179.5	-175	0	113.1	A399 K400 K440 K441	A399-K420 PolarHBondContact O-N 3.46Å; K400-K420 WeakPolarHBondContact O-CB 3.37Å; K420-K440 HydrophobicContact CB-CD 4.42Å; K420-K440 WeakPolarHBondContact O-CB 3.32Å; K420-K441 PolarHBondContact O-N 2.84Å
421	K	68.8	Low	77.7	Confident	74 Å²	74	45.1 Å²	45.1	32%	0.322	23%	0.233	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-136.1	129.5	158.7	-163.7	-139.1	179.1	-124.3	0	108.1	K401 G402 E423 K441 E443	K401-K421 WeakPolarHBondContact CA-O 3.48Å; G402-K421 PolarHBondContact N-O 2.9Å; K421-E423 IonicContact NZ-OE1 2.64Å; K421-E423 PolarHBondContact NZ-OE1 2.94Å; K421-K441 WeakPolarHBondContact CA-O 3.37Å; K421-K441 HydrophobicContact CB-CB 4.27Å; K421-K441 HydrophobicContact CG-CB 3.77Å; K421-K441 HydrophobicContact CG-CD 4.08Å; K421-E443 VanDerWaalsContact CE-OE2 3.26Å; K421-E443 WeakPolarHBondContact CE-OE2 3.35Å; K421-E443 IonicContact NZ-OE1 2.84Å; K421-E443 IonicContact NZ-OE2 2.92Å; K421-E443 PolarHBondContact NZ-OE2 2.88Å
422	G	62.2	Low	77.7	Confident	18 Å²	18	42.3 Å²	42.3	19%	0.186	22%	0.221	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-175.3	146.3	176.8	0	0	0	0	0	112.6	G402 K441 E443	G402-G422 WeakPolarHBondContact O-CA 3.38Å; G422-K441 PolarHBondContact N-O 2.97Å; G422-K441 VanDerWaalsContact N-O 3.11Å; G422-E443 PolarHBondContact O-N 3.25Å; G422-E443 VanDerWaalsContact O-N 3.17Å
423	E	62	Low	78.1	Confident	88 Å²	88	44 Å²	44	41%	0.411	23%	0.228	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-92.4	159.2	175.7	-70.1	136.9	-115.7	0	0	110.3	G404 K421 A425 E443	G404-E423 WeakPolarHBondContact CA-O 3.46Å; G404-E423 PolarHBondContact N-O 3.43Å; K421-E423 IonicContact NZ-OE1 2.64Å; K421-E423 PolarHBondContact NZ-OE1 2.94Å; E423-A425 PolarHBondContact O-N 2.87Å; E423-E443 CarbonylContact C-O 3.53Å; E423-E443 VanDerWaalsContact CA-O 3.23Å; E423-E443 WeakPolarHBondContact CA-O 3.01Å; E423-E443 HydrophobicContact CG-CB 3.76Å
424	A	64.7	Low	78.3	Confident	31 Å²	31	43.4 Å²	43.4	26%	0.256	24%	0.235	S	C	.	.			trans	55.7	45.6	162.7	0	0	0	0	0	118.1	Q426 E443	A424-Q426 PolarHBondContact O-N 2.83Å; A424-E443 PolarHBondContact N-O 2.95Å
425	A	76.6	Confident	78.8	Confident	14 Å²	14	42 Å²	42	12%	0.116	22%	0.22	C	C	.	.			trans	-73.2	109.1	166.5	0	0	0	0	0	110.7	N417 E423 T445 S446	N417-A425 HydrophobicContact CB-CB 4.04Å; E423-A425 PolarHBondContact O-N 2.87Å; A425-T445 HydrophobicContact CB-CG2 3.94Å; A425-T445 CarbonylContact O-C 3.52Å; A425-T445 WeakPolarHBondContact O-CA 3.35Å; A425-S446 PolarHBondContact O-N 3.36Å
426	Q	84.1	Confident	79.2	Confident	56 Å²	56	43.8 Å²	43.8	26%	0.262	23%	0.228	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	151	-173.8	-60.6	-169.7	25.3	0	0	113.7	G405 Q406 N407 N417 A424 Q428 S446	G405-Q426 PolarHBondContact O-N 3.44Å; Q406-Q426 WeakPolarHBondContact CA-O 3.21Å; Q406-Q426 HydrophobicContact CG-CB 4.45Å; N407-Q426 PolarHBondContact N-O 2.98Å; N407-Q426 VanDerWaalsContact N-O 3.16Å; N417-Q426 PolarHBondContact ND2-O 3.24Å; A424-Q426 PolarHBondContact O-N 2.83Å; Q426-Q428 VanDerWaalsContact OE1-NE2 3.09Å; Q426-S446 CarbonylContact C-O 3.5Å; Q426-S446 WeakPolarHBondContact CA-O 3.33Å
427	K	85.6	Confident	79.3	Confident	0 Å²	0	41.6 Å²	41.6	0%	0	22%	0.218	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-139.7	131.3	166.4	-49.9	-175	-150.9	-71.2	0	110.2	N407 P415 N417 A435 Q436 N437 S446 N447 Q448	N407-K427 HydrophobicContact CB-CG 4.46Å; N407-K427 WeakPolarHBondContact O-CA 3.4Å; P415-K427 HydrophobicContact CB-CD 4.12Å; P415-K427 HydrophobicContact CG-CD 3.86Å; P415-K427 WeakPolarHBondContact O-CE 3.5Å; P415-K427 PolarHBondContact O-NZ 2.9Å; N417-K427 PolarHBondContact ND2-NZ 2.85Å; K427-A435 HydrophobicContact CD-CB 3.64Å; K427-Q436 VanDerWaalsContact CE-O 3.27Å; K427-Q436 WeakPolarHBondContact CE-O 3.41Å; K427-Q436 PolarHBondContact NZ-O 3.39Å; K427-N437 WeakPolarHBondContact CE-OD1 3.44Å; K427-N437 PolarHBondContact NZ-OD1 2.88Å; K427-S446 PolarHBondContact N-O 3.42Å; K427-N447 VanDerWaalsContact CD-OD1 3.3Å; K427-N447 WeakPolarHBondContact CD-OD1 3.45Å; K427-N447 VanDerWaalsContact CE-OD1 3.27Å; K427-N447 WeakPolarHBondContact CE-OD1 3.44Å; K427-N447 WeakPolarHBondContact CG-OD1 3.35Å; K427-Q448 PolarHBondContact O-N 2.91Å
428	Q	84.2	Confident	79.3	Confident	80 Å²	80	44.5 Å²	44.5	37%	0.374	23%	0.231	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-135	94	-178.2	-57.1	-173.1	17.5	0	0	110.4	N407 Q408 Q426 Q448	N407-Q428 PolarHBondContact O-N 3.34Å; Q408-Q428 WeakPolarHBondContact CA-O 3.27Å; Q408-Q428 HydrophobicContact CG-CB 4.38Å; Q426-Q428 VanDerWaalsContact OE1-NE2 3.09Å; Q428-Q448 WeakPolarHBondContact CA-O 3.23Å
429	D	82.6	Confident	79.1	Confident	6 Å²	6	42 Å²	42	3%	0.032	22%	0.224	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-126.3	148.9	-177.1	-45.3	-70.7	0	0	0	112.3	T409 I432 Q448 G449	T409-D429 WeakPolarHBondContact CA-OD1 3.44Å; T409-D429 VanDerWaalsContact CB-OD1 3.29Å; T409-D429 WeakPolarHBondContact CB-OD1 3.42Å; T409-D429 PolarHBondContact N-OD1 3.08Å; T409-D429 WeakPolarHBondContact O-CA 3.28Å; T409-D429 VanDerWaalsContact OG1-CG 3.27Å; T409-D429 PolarHBondContact OG1-OD1 3.12Å; D429-I432 HydrophobicContact CB-CG1 3.66Å; D429-Q448 PolarHBondContact N-O 2.89Å; D429-Q448 VanDerWaalsContact N-O 3.13Å; D429-G449 WeakPolarHBondContact O-CA 3.35Å
430	K	84.4	Confident	79.4	Confident	115 Å²	115	46 Å²	46	50%	0.5	24%	0.235	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-69.4	-38.5	178.4	-58.8	-172.6	-179.6	-172.3	0	112.1	T409 K410 K450 K451	T409-K430 PolarHBondContact O-N 3.05Å; K410-K430 WeakPolarHBondContact O-CB 3.37Å; K410-K430 PolarHBondContact O-N 3.12Å; K430-K450 WeakPolarHBondContact O-CB 3.24Å; K430-K450 PolarHBondContact O-N 2.89Å; K430-K450 VanDerWaalsContact O-N 3.16Å; K430-K451 PolarHBondContact O-N 2.84Å
431	K	85.8	Confident	79.6	Confident	62 Å²	62	45.1 Å²	45.1	27%	0.27	23%	0.231	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	127.5	161.2	-171.6	-179.4	-177.8	-141.3	0	109.3	K410 K411 G412 E433 K451	K410-K431 PolarHBondContact O-N 2.93Å; K410-K431 VanDerWaalsContact O-N 3.09Å; K411-K431 WeakPolarHBondContact CA-O 3.48Å; K411-K431 HydrophobicContact CG-CB 4.37Å; G412-K431 PolarHBondContact N-O 2.81Å; K431-E433 WeakPolarHBondContact CD-OE1 3.49Å; K431-E433 VanDerWaalsContact CE-CD 3.47Å; K431-E433 WeakPolarHBondContact CE-OE1 3.12Å; K431-E433 VanDerWaalsContact CG-OE1 3.25Å; K431-E433 WeakPolarHBondContact CG-OE1 3.34Å; K431-E433 IonicContact NZ-OE1 2.81Å; K431-E433 PolarHBondContact NZ-OE1 3.29Å; K431-E433 IonicContact NZ-OE2 2.65Å; K431-E433 PolarHBondContact NZ-OE2 3.11Å; K431-K451 WeakPolarHBondContact CA-O 3.39Å; K431-K451 HydrophobicContact CB-CB 4.37Å; K431-K451 HydrophobicContact CG-CB 3.95Å
432	I	81.2	Confident	79.8	Confident	4 Å²	4	42.4 Å²	42.4	2%	0.021	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	130.2	174.1	-61.9	173.2	0	0	0	109.1	D429 A435 N447 Q448 K451 G452 E453	D429-I432 HydrophobicContact CB-CG1 3.66Å; I432-A435 HydrophobicContact CG2-CB 3.35Å; I432-N447 HydrophobicContact CD1-CB 4.47Å; I432-Q448 WeakPolarHBondContact CD1-O 3.35Å; I432-K451 PolarHBondContact N-O 2.9Å; I432-G452 CarbonylContact O-C 3.57Å; I432-G452 WeakPolarHBondContact O-CA 3.45Å; I432-E453 PolarHBondContact O-N 3.29Å
433	E	83.6	Confident	80.3	Confident	37 Å²	37	43.1 Å²	43.1	17%	0.173	22%	0.219	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	124.8	166.2	-81.2	130.5	-89.4	0	0	109.8	K411 G412 E413 G414 K431 A435 E453	K411-E433 WeakPolarHBondContact CE-OE1 3.41Å; K411-E433 WeakPolarHBondContact CE-OE2 3.44Å; K411-E433 IonicContact NZ-OE1 2.91Å; K411-E433 PolarHBondContact NZ-OE1 2.88Å; K411-E433 IonicContact NZ-OE2 2.6Å; K411-E433 PolarHBondContact NZ-OE2 3.23Å; G412-E433 PolarHBondContact O-N 2.83Å; E413-E433 WeakPolarHBondContact CA-O 3.38Å; E413-E433 HydrophobicContact CG-CB 3.99Å; G414-E433 PolarHBondContact N-O 3.11Å; K431-E433 WeakPolarHBondContact CD-OE1 3.49Å; K431-E433 VanDerWaalsContact CE-CD 3.47Å; K431-E433 WeakPolarHBondContact CE-OE1 3.12Å; K431-E433 VanDerWaalsContact CG-OE1 3.25Å; K431-E433 WeakPolarHBondContact CG-OE1 3.34Å; K431-E433 IonicContact NZ-OE1 2.81Å; K431-E433 PolarHBondContact NZ-OE1 3.29Å; K431-E433 IonicContact NZ-OE2 2.65Å; K431-E433 PolarHBondContact NZ-OE2 3.11Å; E433-A435 PolarHBondContact O-N 2.63Å; E433-E453 HydrophobicContact CG-CB 4.46Å
434	G	83	Confident	80.9	Confident	34 Å²	34	40.8 Å²	40.8	35%	0.351	22%	0.219	S	C	.	.	S	Bend	trans	65.6	28.8	170.4	0	0	0	0	0	115.7	Q436 E453	G434-Q436 PolarHBondContact O-N 2.83Å; G434-E453 PolarHBondContact N-O 3.5Å
435	A	87.4	Confident	81.9	Confident	0 Å²	0	39.6 Å²	39.6	0%	0	21%	0.208	C	C	.	.			trans	-62.5	131	176.9	0	0	0	0	0	112.3	P415 K427 I432 E433 A455 Q456	P415-A435 HydrophobicContact CG-CB 4.13Å; K427-A435 HydrophobicContact CD-CB 3.64Å; I432-A435 HydrophobicContact CG2-CB 3.35Å; E433-A435 PolarHBondContact O-N 2.63Å; A435-A455 HydrophobicContact CB-CB 4.41Å; A435-A455 CarbonylContact O-C 3.56Å; A435-A455 WeakPolarHBondContact O-CA 3.32Å; A435-Q456 PolarHBondContact O-N 2.81Å
436	Q	88.3	Confident	82.4	Confident	42 Å²	42	39.3 Å²	39.3	20%	0.196	21%	0.205	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	131.9	176.6	-63.1	-173.4	-24.7	0	0	113	P415 Q416 N417 K427 G434 Q456	P415-Q436 PolarHBondContact O-N 2.62Å; Q416-Q436 CarbonylContact C-O 3.52Å; Q416-Q436 WeakPolarHBondContact CA-O 3.32Å; Q416-Q436 HydrophobicContact CG-CB 4.36Å; N417-Q436 PolarHBondContact N-O 2.85Å; K427-Q436 VanDerWaalsContact CE-O 3.27Å; K427-Q436 WeakPolarHBondContact CE-O 3.41Å; K427-Q436 PolarHBondContact NZ-O 3.39Å; G434-Q436 PolarHBondContact O-N 2.83Å; Q436-Q456 CarbonylContact C-O 3.59Å; Q436-Q456 WeakPolarHBondContact CA-O 2.99Å; Q436-Q456 HydrophobicContact CG-CB 4.37Å
437	N	87.3	Confident	82.6	Confident	2 Å²	2	36.8 Å²	36.8	1%	0.011	19%	0.193	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-118	125	163.1	-57.5	-53.9	0	0	0	108.5	N417 K427 T445 N447 Q456 N457 Q458	N417-N437 WeakPolarHBondContact CB-OD1 3.4Å; N417-N437 PolarHBondContact ND2-OD1 2.87Å; N417-N437 CarbonylContact O-C 3.54Å; N417-N437 WeakPolarHBondContact O-CA 2.91Å; K427-N437 WeakPolarHBondContact CE-OD1 3.44Å; K427-N437 PolarHBondContact NZ-OD1 2.88Å; N437-T445 HydrophobicContact CB-CG2 4.27Å; N437-N447 PolarHBondContact ND2-ND2 3.38Å; N437-N447 PolarHBondContact ND2-OD1 2.86Å; N437-Q456 PolarHBondContact N-O 2.91Å; N437-N457 WeakPolarHBondContact CB-OD1 3.39Å; N437-N457 PolarHBondContact ND2-OD1 2.84Å; N437-N457 CarbonylContact O-C 3.54Å; N437-N457 WeakPolarHBondContact O-CA 3.36Å; N437-Q458 PolarHBondContact O-N 3.43Å
438	Q	85.1	Confident	82.7	Confident	65 Å²	65	39.7 Å²	39.7	30%	0.304	21%	0.207	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.3	138.9	-177.9	-56.8	-169.4	21.4	0	0	112.2	N417 Q418 G419 Q458	N417-Q438 PolarHBondContact O-N 3.06Å; Q418-Q438 CarbonylContact C-O 3.59Å; Q418-Q438 WeakPolarHBondContact CA-O 3.34Å; G419-Q438 PolarHBondContact N-O 3.44Å; Q438-Q458 CarbonylContact C-O 3.54Å; Q438-Q458 WeakPolarHBondContact CA-O 3.27Å; Q438-Q458 HydrophobicContact CG-CB 4.35Å
439	G	79	Confident	82.8	Confident	18 Å²	18	36.9 Å²	36.9	19%	0.186	20%	0.2	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-163.5	172.8	171.1	0	0	0	0	0	118	G419 Q458 G459 K460	G419-G439 CarbonylContact O-C 3.53Å; G419-G439 WeakPolarHBondContact O-CA 3.48Å; G439-Q458 PolarHBondContact N-O 2.97Å; G439-G459 WeakPolarHBondContact O-CA 3.45Å; G439-K460 PolarHBondContact O-N 2.91Å
440	K	79.6	Confident	82.9	Confident	111 Å²	111	42.2 Å²	42.2	48%	0.483	22%	0.222	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-80.2	-47.8	168.6	-55	-174.1	177.9	-171.3	0	110.3	G419 K420 K460 K461	G419-K440 PolarHBondContact O-N 2.82Å; K420-K440 HydrophobicContact CB-CD 4.42Å; K420-K440 WeakPolarHBondContact O-CB 3.32Å; K440-K460 HydrophobicContact CG-CD 4.45Å; K440-K460 WeakPolarHBondContact O-CB 3.34Å; K440-K460 PolarHBondContact O-N 3.06Å; K440-K461 PolarHBondContact O-N 3.48Å
441	K	77.2	Confident	83	Confident	91 Å²	91	42.7 Å²	42.7	40%	0.396	23%	0.225	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-124.4	86.9	168.3	-79.3	-165	165.4	-145.3	0	111	K420 K421 G422 K461	K420-K441 PolarHBondContact O-N 2.84Å; K421-K441 WeakPolarHBondContact CA-O 3.37Å; K421-K441 HydrophobicContact CB-CB 4.27Å; K421-K441 HydrophobicContact CG-CB 3.77Å; K421-K441 HydrophobicContact CG-CD 4.08Å; G422-K441 PolarHBondContact N-O 2.97Å; G422-K441 VanDerWaalsContact N-O 3.11Å; K441-K461 VanDerWaalsContact CA-O 3.31Å; K441-K461 WeakPolarHBondContact CA-O 3.4Å; K441-K461 HydrophobicContact CG-CB 4.39Å
442	P	73.1	Confident	82.8	Confident	16 Å²	16	40.5 Å²	40.5	10%	0.104	22%	0.219	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-90.5	124.3	165.5	32.6	-25.5	0	0	0	110.1	T445 K461 G462 E463	P442-T445 HydrophobicContact CB-CG2 3.67Å; P442-K461 WeakPolarHBondContact CD-O 3.36Å; P442-G462 WeakPolarHBondContact O-CA 3.42Å; P442-E463 PolarHBondContact O-N 2.77Å
443	E	72.6	Confident	83	Confident	34 Å²	34	44.8 Å²	44.8	16%	0.159	24%	0.239	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	125.5	177	-73.8	140.5	-137.8	0	0	106.8	K421 G422 E423 A424	K421-E443 VanDerWaalsContact CE-OE2 3.26Å; K421-E443 WeakPolarHBondContact CE-OE2 3.35Å; K421-E443 IonicContact NZ-OE1 2.84Å; K421-E443 IonicContact NZ-OE2 2.92Å; K421-E443 PolarHBondContact NZ-OE2 2.88Å; G422-E443 PolarHBondContact O-N 3.25Å; G422-E443 VanDerWaalsContact O-N 3.17Å; E423-E443 CarbonylContact C-O 3.53Å; E423-E443 VanDerWaalsContact CA-O 3.23Å; E423-E443 WeakPolarHBondContact CA-O 3.01Å; E423-E443 HydrophobicContact CG-CB 3.76Å; A424-E443 PolarHBondContact N-O 2.95Å
444	G	73.6	Confident	83	Confident	39 Å²	39	44.3 Å²	44.3	40%	0.402	24%	0.244	S	C	.	.	S	Bend	trans	68.6	36.8	174.7	0	0	0	0	0	117.8	E463 G464	G444-E463 PolarHBondContact N-O 2.92Å; G444-G464 WeakPolarHBondContact CA-O 2.9Å
445	T	85.1	Confident	83.2	Confident	6 Å²	6	43.1 Å²	43.1	4%	0.037	23%	0.231	C	C	.	.			trans	-80.5	126.6	-178.9	63.1	0	0	0	0	112.4	A425 N437 P442 A465 Q466	A425-T445 HydrophobicContact CB-CG2 3.94Å; A425-T445 CarbonylContact O-C 3.52Å; A425-T445 WeakPolarHBondContact O-CA 3.35Å; N437-T445 HydrophobicContact CB-CG2 4.27Å; P442-T445 HydrophobicContact CB-CG2 3.67Å; T445-A465 CarbonylContact O-C 3.55Å; T445-A465 WeakPolarHBondContact O-CA 3.35Å; T445-Q466 PolarHBondContact O-N 2.91Å
446	S	87.8	Confident	83.4	Confident	8 Å²	8	45.1 Å²	45.1	6%	0.056	24%	0.24	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.6	127.7	-172.7	-158.9	0	0	0	0	112.9	A425 Q426 K427 Q448 Q466	A425-S446 PolarHBondContact O-N 3.36Å; Q426-S446 CarbonylContact C-O 3.5Å; Q426-S446 WeakPolarHBondContact CA-O 3.33Å; K427-S446 PolarHBondContact N-O 3.42Å; S446-Q448 PolarHBondContact OG-NE2 2.83Å; S446-Q448 VanDerWaalsContact OG-NE2 3.1Å; S446-Q466 WeakPolarHBondContact CA-O 3.41Å; S446-Q466 PolarHBondContact OG-OE1 2.79Å
447	N	88.6	Confident	83.4	Confident	2 Å²	2	43.3 Å²	43.3	1%	0.011	23%	0.232	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	121.8	169.8	-55.8	-56.6	0	0	0	109.4	K427 I432 N437 A455 N457 Q466 N467 Q468	K427-N447 VanDerWaalsContact CD-OD1 3.3Å; K427-N447 WeakPolarHBondContact CD-OD1 3.45Å; K427-N447 VanDerWaalsContact CE-OD1 3.27Å; K427-N447 WeakPolarHBondContact CE-OD1 3.44Å; K427-N447 WeakPolarHBondContact CG-OD1 3.35Å; I432-N447 HydrophobicContact CD1-CB 4.47Å; N437-N447 PolarHBondContact ND2-ND2 3.38Å; N437-N447 PolarHBondContact ND2-OD1 2.86Å; N447-A455 HydrophobicContact CB-CB 4.37Å; N447-N457 PolarHBondContact ND2-OD1 3.22Å; N447-Q466 PolarHBondContact N-O 2.95Å; N447-N467 PolarHBondContact ND2-OD1 3.38Å; N447-N467 CarbonylContact O-C 3.56Å; N447-N467 WeakPolarHBondContact O-CA 3.41Å; N447-Q468 PolarHBondContact O-N 3.19Å
448	Q	88.1	Confident	83.4	Confident	62 Å²	62	46.2 Å²	46.2	29%	0.29	25%	0.245	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.8	133.9	-173.7	-54.5	-171	8.6	0	0	112.5	K427 Q428 D429 I432 S446 Q468	K427-Q448 PolarHBondContact O-N 2.91Å; Q428-Q448 WeakPolarHBondContact CA-O 3.23Å; D429-Q448 PolarHBondContact N-O 2.89Å; D429-Q448 VanDerWaalsContact N-O 3.13Å; I432-Q448 WeakPolarHBondContact CD1-O 3.35Å; S446-Q448 PolarHBondContact OG-NE2 2.83Å; S446-Q448 VanDerWaalsContact OG-NE2 3.1Å; Q448-Q468 WeakPolarHBondContact CA-O 3.32Å; Q448-Q468 HydrophobicContact CG-CB 4.24Å; Q448-Q468 HydrophobicContact CG-CG 4.5Å
449	G	84.6	Confident	83.1	Confident	21 Å²	21	43.8 Å²	43.8	22%	0.216	24%	0.238	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-163.3	-178.4	178.5	0	0	0	0	0	116.8	D429 Q468 S469	D429-G449 WeakPolarHBondContact O-CA 3.35Å; G449-Q468 PolarHBondContact N-O 2.83Å; G449-S469 WeakPolarHBondContact O-CA 3.37Å
450	K	86.6	Confident	83.2	Confident	117 Å²	117	48.4 Å²	48.4	51%	0.509	25%	0.253	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.8	-45.2	171.4	-63.2	-170.4	179.9	-171.8	0	111.1	K430 K470 K471	K430-K450 WeakPolarHBondContact O-CB 3.24Å; K430-K450 PolarHBondContact O-N 2.89Å; K430-K450 VanDerWaalsContact O-N 3.16Å; K450-K470 WeakPolarHBondContact O-CA 3.47Å; K450-K470 VanDerWaalsContact O-CB 3.3Å; K450-K470 WeakPolarHBondContact O-CB 3.44Å; K450-K470 PolarHBondContact O-N 2.82Å; K450-K470 VanDerWaalsContact O-N 3.11Å; K450-K471 PolarHBondContact O-N 3.38Å
451	K	85.9	Confident	83.1	Confident	126 Å²	126	48.7 Å²	48.7	55%	0.548	25%	0.254	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.6	137.4	166.9	-69.1	-175.7	178.8	-175.4	0	108.4	K430 K431 I432 K471	K430-K451 PolarHBondContact O-N 2.84Å; K431-K451 WeakPolarHBondContact CA-O 3.39Å; K431-K451 HydrophobicContact CB-CB 4.37Å; K431-K451 HydrophobicContact CG-CB 3.95Å; I432-K451 PolarHBondContact N-O 2.9Å; K451-K471 CarbonylContact C-O 3.59Å; K451-K471 WeakPolarHBondContact CA-O 3.3Å
452	G	81.8	Confident	82.7	Confident	15 Å²	15	44.8 Å²	44.8	16%	0.155	24%	0.24	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-145.6	136.7	177.1	0	0	0	0	0	112.3	I432 K471 G472 E473	I432-G452 CarbonylContact O-C 3.57Å; I432-G452 WeakPolarHBondContact O-CA 3.45Å; G452-K471 PolarHBondContact N-O 3.36Å; G452-G472 CarbonylContact O-C 3.57Å; G452-G472 VanDerWaalsContact O-CA 3.31Å; G452-G472 WeakPolarHBondContact O-CA 3.31Å; G452-E473 PolarHBondContact O-N 3.26Å
453	E	84.9	Confident	82.7	Confident	95 Å²	95	47.8 Å²	47.8	44%	0.444	25%	0.253	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.1	126.5	-172.1	-165.3	177.3	144.6	0	0	109.5	I432 E433 G434 A455 E473	I432-E453 PolarHBondContact O-N 3.29Å; E433-E453 HydrophobicContact CG-CB 4.46Å; G434-E453 PolarHBondContact N-O 3.5Å; E453-A455 PolarHBondContact O-N 2.98Å; E453-E473 CarbonylContact C-O 3.59Å; E453-E473 WeakPolarHBondContact CA-O 3.39Å; E453-E473 HydrophobicContact CG-CB 4.43Å
454	G	83.2	Confident	82.7	Confident	27 Å²	27	47.6 Å²	47.6	28%	0.278	26%	0.26	S	S	.	.	S	Bend	trans	64	33.1	176.8	0	0	0	0	0	115.1	Q456 E473	G454-Q456 PolarHBondContact O-N 3.22Å; G454-E473 PolarHBondContact N-O 2.81Å
455	A	88.4	Confident	83.3	Confident	8 Å²	8	46.6 Å²	46.6	7%	0.066	25%	0.248	C	C	.	.			trans	-76.1	120	178.5	0	0	0	0	0	111.4	A435 N447 E453 A475 Q476	A435-A455 HydrophobicContact CB-CB 4.41Å; A435-A455 CarbonylContact O-C 3.56Å; A435-A455 WeakPolarHBondContact O-CA 3.32Å; N447-A455 HydrophobicContact CB-CB 4.37Å; E453-A455 PolarHBondContact O-N 2.98Å; A455-A475 CarbonylContact O-C 3.55Å; A455-A475 WeakPolarHBondContact O-CA 3.25Å; A455-Q476 PolarHBondContact O-N 3.44Å
456	Q	90	Very high	83.5	Confident	43 Å²	43	48.9 Å²	48.9	20%	0.201	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	127.8	-173.5	-59.2	-177.4	-47.1	0	0	113	A435 Q436 N437 G454 Q476	A435-Q456 PolarHBondContact O-N 2.81Å; Q436-Q456 CarbonylContact C-O 3.59Å; Q436-Q456 WeakPolarHBondContact CA-O 2.99Å; Q436-Q456 HydrophobicContact CG-CB 4.37Å; N437-Q456 PolarHBondContact N-O 2.91Å; G454-Q456 PolarHBondContact O-N 3.22Å; Q456-Q476 CarbonylContact C-O 3.5Å; Q456-Q476 WeakPolarHBondContact CA-O 3.46Å; Q456-Q476 HydrophobicContact CG-CB 4.28Å
457	N	88.9	Confident	83.6	Confident	4 Å²	4	48.8 Å²	48.8	2%	0.021	26%	0.257	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	127.3	169	-58.3	-47.2	0	0	0	109.5	N437 N447 A465 Q466 N467 Q476 N477 Q478	N437-N457 WeakPolarHBondContact CB-OD1 3.39Å; N437-N457 PolarHBondContact ND2-OD1 2.84Å; N437-N457 CarbonylContact O-C 3.54Å; N437-N457 WeakPolarHBondContact O-CA 3.36Å; N447-N457 PolarHBondContact ND2-OD1 3.22Å; N457-A465 HydrophobicContact CB-CB 3.99Å; N457-Q466 PolarHBondContact ND2-O 2.77Å; N457-N467 PolarHBondContact ND2-ND2 2.91Å; N457-N467 PolarHBondContact ND2-OD1 2.99Å; N457-N467 VanDerWaalsContact ND2-OD1 3.14Å; N457-Q476 PolarHBondContact N-O 2.79Å; N457-N477 WeakPolarHBondContact CB-OD1 3.35Å; N457-N477 PolarHBondContact ND2-OD1 3.19Å; N457-N477 CarbonylContact O-C 3.53Å; N457-N477 WeakPolarHBondContact O-CA 3.49Å; N457-Q478 PolarHBondContact O-N 3.48Å
458	Q	86.6	Confident	83.6	Confident	62 Å²	62	51.5 Å²	51.5	29%	0.29	27%	0.27	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	131.6	-176.4	-56.9	-167.9	13.7	0	0	113.6	N437 Q438 G439 Q478	N437-Q458 PolarHBondContact O-N 3.43Å; Q438-Q458 CarbonylContact C-O 3.54Å; Q438-Q458 WeakPolarHBondContact CA-O 3.27Å; Q438-Q458 HydrophobicContact CG-CB 4.35Å; G439-Q458 PolarHBondContact N-O 2.97Å; Q458-Q478 CarbonylContact C-O 3.56Å; Q458-Q478 WeakPolarHBondContact CA-O 3.31Å; Q458-Q478 HydrophobicContact CG-CB 4.33Å
459	G	80.7	Confident	83.6	Confident	15 Å²	15	49.8 Å²	49.8	16%	0.155	27%	0.265	C	S	.	.			trans	-139	158.8	-174.9	0	0	0	0	0	115.5	G439 Q478 A479 K480	G439-G459 WeakPolarHBondContact O-CA 3.45Å; G459-Q478 PolarHBondContact N-O 2.92Å; G459-A479 WeakPolarHBondContact O-CA 3.4Å; G459-K480 PolarHBondContact O-N 2.85Å
460	K	80.6	Confident	83.7	Confident	114 Å²	114	54.1 Å²	54.1	50%	0.496	28%	0.278	S	S	.	.	S	Bend	trans	-95.4	-45.3	164.6	-62.9	-168	-178.9	-169	0	112.1	G439 K440 K480 K481	G439-K460 PolarHBondContact O-N 2.91Å; K440-K460 HydrophobicContact CG-CD 4.45Å; K440-K460 WeakPolarHBondContact O-CB 3.34Å; K440-K460 PolarHBondContact O-N 3.06Å; K460-K480 WeakPolarHBondContact O-CB 3.44Å; K460-K480 PolarHBondContact O-N 2.87Å; K460-K481 PolarHBondContact O-N 3.47Å
461	K	76.8	Confident	83.7	Confident	117 Å²	117	52.3 Å²	52.3	51%	0.509	27%	0.27	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.8	113	160.3	-64.4	-167.9	175.9	-171	0	105.4	K440 K441 P442 K481	K440-K461 PolarHBondContact O-N 3.48Å; K441-K461 VanDerWaalsContact CA-O 3.31Å; K441-K461 WeakPolarHBondContact CA-O 3.4Å; K441-K461 HydrophobicContact CG-CB 4.39Å; P442-K461 WeakPolarHBondContact CD-O 3.36Å; K461-K481 VanDerWaalsContact CA-O 3.26Å; K461-K481 WeakPolarHBondContact CA-O 3.32Å; K461-K481 HydrophobicContact CG-CB 4.3Å
462	G	69	Low	83.5	Confident	10 Å²	10	46.8 Å²	46.8	10%	0.103	25%	0.248	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-146.5	144	-174.7	0	0	0	0	0	112.6	P442 K481 G482 E483	P442-G462 WeakPolarHBondContact O-CA 3.42Å; G462-K481 PolarHBondContact N-O 3.19Å; G462-G482 WeakPolarHBondContact O-CA 3.3Å; G462-E483 PolarHBondContact O-N 2.86Å
463	E	72.5	Confident	83.6	Confident	78 Å²	78	49.8 Å²	49.8	36%	0.364	26%	0.258	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	139.2	-169.3	-76.7	127.8	-130.3	0	0	110	P442 G444 E483	P442-E463 PolarHBondContact O-N 2.77Å; G444-E463 PolarHBondContact N-O 2.92Å; E463-E483 WeakPolarHBondContact CA-O 3.18Å; E463-E483 HydrophobicContact CG-CB 4.31Å
464	G	73.2	Confident	83.5	Confident	30 Å²	30	46.3 Å²	46.3	31%	0.309	25%	0.248	S	C	.	.			trans	68.7	41.2	174.3	0	0	0	0	0	115.4	G444 E483 G484	G444-G464 WeakPolarHBondContact CA-O 2.9Å; G464-E483 PolarHBondContact N-O 3.31Å; G464-E483 VanDerWaalsContact N-O 3.11Å; G464-G484 WeakPolarHBondContact CA-O 3.3Å
465	A	86.1	Confident	83.7	Confident	19 Å²	19	45.8 Å²	45.8	16%	0.157	24%	0.241	C	C	.	.			trans	-82.3	117.5	178.1	0	0	0	0	0	111.3	T445 N457 N477 G484 G485 Q486	T445-A465 CarbonylContact O-C 3.55Å; T445-A465 WeakPolarHBondContact O-CA 3.35Å; N457-A465 HydrophobicContact CB-CB 3.99Å; A465-N477 HydrophobicContact CB-CB 4.4Å; A465-G484 PolarHBondContact N-O 2.87Å; A465-G485 CarbonylContact O-C 3.41Å; A465-Q486 PolarHBondContact O-N 3.42Å
466	Q	89.2	Confident	83.8	Confident	53 Å²	53	47.2 Å²	47.2	25%	0.248	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	140.7	-173.4	-64.5	-172.9	-24.2	0	0	113.5	T445 S446 N447 N457 Q486	T445-Q466 PolarHBondContact O-N 2.91Å; S446-Q466 WeakPolarHBondContact CA-O 3.41Å; S446-Q466 PolarHBondContact OG-OE1 2.79Å; N447-Q466 PolarHBondContact N-O 2.95Å; N457-Q466 PolarHBondContact ND2-O 2.77Å; Q466-Q486 CarbonylContact C-O 3.49Å; Q466-Q486 WeakPolarHBondContact CA-O 3.26Å; Q466-Q486 HydrophobicContact CG-CB 4.27Å
467	N	90.2	Very high	83.7	Confident	7 Å²	7	45.5 Å²	45.5	4%	0.037	24%	0.239	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	125	162.5	-58.8	-60.7	0	0	0	109.5	N447 N457 A475 N477 Q486 N487 Q488	N447-N467 PolarHBondContact ND2-OD1 3.38Å; N447-N467 CarbonylContact O-C 3.56Å; N447-N467 WeakPolarHBondContact O-CA 3.41Å; N457-N467 PolarHBondContact ND2-ND2 2.91Å; N457-N467 PolarHBondContact ND2-OD1 2.99Å; N457-N467 VanDerWaalsContact ND2-OD1 3.14Å; N467-A475 HydrophobicContact CB-CB 4.01Å; N467-N477 PolarHBondContact ND2-OD1 2.93Å; N467-N477 VanDerWaalsContact ND2-OD1 3.11Å; N467-Q486 PolarHBondContact N-O 2.87Å; N467-N487 WeakPolarHBondContact CB-OD1 3.31Å; N467-N487 PolarHBondContact ND2-OD1 2.99Å; N467-N487 CarbonylContact O-C 3.56Å; N467-N487 WeakPolarHBondContact O-CA 2.99Å; N467-Q488 PolarHBondContact O-N 2.91Å
468	Q	88.8	Confident	83.6	Confident	59 Å²	59	48.3 Å²	48.3	28%	0.276	25%	0.252	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.7	133.9	-178.5	-55.1	-169.8	16.6	0	0	112.2	N447 Q448 G449 Q488	N447-Q468 PolarHBondContact O-N 3.19Å; Q448-Q468 WeakPolarHBondContact CA-O 3.32Å; Q448-Q468 HydrophobicContact CG-CB 4.24Å; Q448-Q468 HydrophobicContact CG-CG 4.5Å; G449-Q468 PolarHBondContact N-O 2.83Å; Q468-Q488 CarbonylContact C-O 3.56Å; Q468-Q488 WeakPolarHBondContact CA-O 3.2Å; Q468-Q488 HydrophobicContact CG-CB 4.36Å
469	S	88	Confident	83.4	Confident	26 Å²	26	46.5 Å²	46.5	18%	0.182	25%	0.248	C	C	.	.			trans	-150.1	167.4	-175.9	68.7	0	0	0	0	114.4	G449 K471 G472 Q488 A489	G449-S469 WeakPolarHBondContact O-CA 3.37Å; S469-K471 WeakPolarHBondContact CB-O 3.39Å; S469-G472 VanDerWaalsContact OG-CA 3.25Å; S469-G472 WeakPolarHBondContact OG-CA 3.37Å; S469-G472 PolarHBondContact OG-N 3.44Å; S469-Q488 PolarHBondContact N-O 2.89Å; S469-Q488 PolarHBondContact OG-O 2.83Å; S469-A489 WeakPolarHBondContact O-CA 3.44Å
470	K	86.1	Confident	83.3	Confident	112 Å²	112	51 Å²	51	49%	0.487	26%	0.263	S	S	.	.	S	Bend	trans	-93.8	-51.3	163.3	-60	-173.1	-179.9	-172.6	0	111.3	K450 K490 K491	K450-K470 WeakPolarHBondContact O-CA 3.47Å; K450-K470 VanDerWaalsContact O-CB 3.3Å; K450-K470 WeakPolarHBondContact O-CB 3.44Å; K450-K470 PolarHBondContact O-N 2.82Å; K450-K470 VanDerWaalsContact O-N 3.11Å; K470-K490 WeakPolarHBondContact O-CA 3.39Å; K470-K490 WeakPolarHBondContact O-CB 3.35Å; K470-K490 PolarHBondContact O-N 2.91Å; K470-K490 VanDerWaalsContact O-N 3.13Å; K470-K491 PolarHBondContact O-N 3.06Å
471	K	86.7	Confident	83	Confident	79 Å²	79	49 Å²	49	34%	0.343	25%	0.254	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	126.6	155.9	-164.2	-152.6	174.1	-151.2	0	108.4	K450 K451 G452 S469 E473 K491	K450-K471 PolarHBondContact O-N 3.38Å; K451-K471 CarbonylContact C-O 3.59Å; K451-K471 WeakPolarHBondContact CA-O 3.3Å; G452-K471 PolarHBondContact N-O 3.36Å; S469-K471 WeakPolarHBondContact CB-O 3.39Å; K471-E473 IonicContact NZ-OE2 2.61Å; K471-E473 PolarHBondContact NZ-OE2 3.44Å; K471-K491 CarbonylContact C-O 3.55Å; K471-K491 VanDerWaalsContact CA-O 3.31Å; K471-K491 WeakPolarHBondContact CA-O 3.2Å; K471-K491 HydrophobicContact CG-CB 4.39Å
472	G	81.5	Confident	82.5	Confident	9 Å²	9	43.8 Å²	43.8	9%	0.093	23%	0.234	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-126.3	146.4	177.5	0	0	0	0	0	111.9	G452 S469 K491 G492 E493	G452-G472 CarbonylContact O-C 3.57Å; G452-G472 VanDerWaalsContact O-CA 3.31Å; G452-G472 WeakPolarHBondContact O-CA 3.31Å; S469-G472 VanDerWaalsContact OG-CA 3.25Å; S469-G472 WeakPolarHBondContact OG-CA 3.37Å; S469-G472 PolarHBondContact OG-N 3.44Å; G472-K491 PolarHBondContact N-O 3.4Å; G472-G492 WeakPolarHBondContact O-CA 3.38Å; G472-E493 PolarHBondContact O-N 3.27Å
473	E	84.1	Confident	82.4	Confident	78 Å²	78	46.3 Å²	46.3	36%	0.364	24%	0.243	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-146.3	132.4	177.3	-160.2	161.3	156.2	0	0	110.6	G452 E453 G454 K471 A475 E493	G452-E473 PolarHBondContact O-N 3.26Å; E453-E473 CarbonylContact C-O 3.59Å; E453-E473 WeakPolarHBondContact CA-O 3.39Å; E453-E473 HydrophobicContact CG-CB 4.43Å; G454-E473 PolarHBondContact N-O 2.81Å; K471-E473 IonicContact NZ-OE2 2.61Å; K471-E473 PolarHBondContact NZ-OE2 3.44Å; E473-A475 PolarHBondContact O-N 2.86Å; E473-E493 CarbonylContact C-O 3.55Å; E473-E493 VanDerWaalsContact CA-O 3.3Å; E473-E493 WeakPolarHBondContact CA-O 3.27Å; E473-E493 HydrophobicContact CG-CB 4.23Å
474	G	82.7	Confident	82.2	Confident	23 Å²	23	43.5 Å²	43.5	24%	0.237	24%	0.235	C	C	.	.	S	Bend	trans	62.5	33.2	174.6	0	0	0	0	0	115.3	E493	G474-E493 PolarHBondContact N-O 3.37Å
475	A	88.5	Confident	82.5	Confident	15 Å²	15	42.8 Å²	42.8	12%	0.124	23%	0.228	C	C	.	.			trans	-73.5	126.6	176.4	0	0	0	0	0	111	A455 N467 E473 A495 Q496	A455-A475 CarbonylContact O-C 3.55Å; A455-A475 WeakPolarHBondContact O-CA 3.25Å; N467-A475 HydrophobicContact CB-CB 4.01Å; E473-A475 PolarHBondContact O-N 2.86Å; A475-A495 CarbonylContact O-C 3.58Å; A475-A495 WeakPolarHBondContact O-CA 3.37Å; A475-Q496 PolarHBondContact O-N 2.83Å
476	Q	90.1	Very high	82.5	Confident	39 Å²	39	44 Å²	44	18%	0.182	23%	0.23	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-132	131.8	-173.4	-58	-177.6	-11.1	0	0	112.9	A455 Q456 N457 Q496	A455-Q476 PolarHBondContact O-N 3.44Å; Q456-Q476 CarbonylContact C-O 3.5Å; Q456-Q476 WeakPolarHBondContact CA-O 3.46Å; Q456-Q476 HydrophobicContact CG-CB 4.28Å; N457-Q476 PolarHBondContact N-O 2.79Å; Q476-Q496 CarbonylContact C-O 3.58Å; Q476-Q496 WeakPolarHBondContact CA-O 3.06Å; Q476-Q496 HydrophobicContact CG-CB 4.27Å
477	N	88.5	Confident	82.5	Confident	7 Å²	7	41.9 Å²	41.9	4%	0.037	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-115.7	126.7	166.2	-57.3	-54.9	0	0	0	109.5	N457 A465 N467 N487 Q496 N497 Q498	N457-N477 WeakPolarHBondContact CB-OD1 3.35Å; N457-N477 PolarHBondContact ND2-OD1 3.19Å; N457-N477 CarbonylContact O-C 3.53Å; N457-N477 WeakPolarHBondContact O-CA 3.49Å; A465-N477 HydrophobicContact CB-CB 4.4Å; N467-N477 PolarHBondContact ND2-OD1 2.93Å; N467-N477 VanDerWaalsContact ND2-OD1 3.11Å; N477-N487 PolarHBondContact ND2-ND2 3.21Å; N477-N487 PolarHBondContact ND2-OD1 3.5Å; N477-N487 VanDerWaalsContact ND2-OD1 3.11Å; N477-Q496 PolarHBondContact N-O 3.47Å; N477-N497 WeakPolarHBondContact CB-OD1 3.28Å; N477-N497 PolarHBondContact ND2-OD1 2.99Å; N477-N497 CarbonylContact O-C 3.57Å; N477-N497 WeakPolarHBondContact O-CA 3.35Å; N477-Q498 PolarHBondContact O-N 3.22Å
478	Q	86.3	Confident	82.3	Confident	62 Å²	62	44.5 Å²	44.5	29%	0.29	23%	0.233	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	127.5	-178.4	-55.6	-171.3	17.1	0	0	112.2	N457 Q458 G459 Q498	N457-Q478 PolarHBondContact O-N 3.48Å; Q458-Q478 CarbonylContact C-O 3.56Å; Q458-Q478 WeakPolarHBondContact CA-O 3.31Å; Q458-Q478 HydrophobicContact CG-CB 4.33Å; G459-Q478 PolarHBondContact N-O 2.92Å; Q478-Q498 CarbonylContact C-O 3.6Å; Q478-Q498 WeakPolarHBondContact CA-O 3.3Å; Q478-Q498 HydrophobicContact CG-CB 4.34Å
479	A	82.4	Confident	82.1	Confident	25 Å²	25	42.6 Å²	42.6	21%	0.207	23%	0.227	C	C	.	.			trans	-136.9	159.2	-177.3	0	0	0	0	0	112.9	G459 Q498 A499 K500	G459-A479 WeakPolarHBondContact O-CA 3.4Å; A479-Q498 PolarHBondContact N-O 3.42Å; A479-A499 WeakPolarHBondContact O-CA 3.3Å; A479-K500 PolarHBondContact O-N 3.31Å
480	K	77.8	Confident	81.8	Confident	110 Å²	110	47 Å²	47	48%	0.478	24%	0.243	S	C	.	.	S	Bend	trans	-96	-53.3	168	-59.5	-173.4	-178.6	-174.7	0	111.2	G459 K460 K500 K501	G459-K480 PolarHBondContact O-N 2.85Å; K460-K480 WeakPolarHBondContact O-CB 3.44Å; K460-K480 PolarHBondContact O-N 2.87Å; K480-K500 WeakPolarHBondContact O-CA 3.29Å; K480-K500 VanDerWaalsContact O-CB 3.26Å; K480-K500 WeakPolarHBondContact O-CB 3.46Å; K480-K500 PolarHBondContact O-N 3.13Å; K480-K501 PolarHBondContact O-N 3.27Å
481	K	75.2	Confident	81.6	Confident	70 Å²	70	45.2 Å²	45.2	30%	0.304	24%	0.235	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	146.1	148.3	-174.1	-173.7	179.3	-77.6	0	107.5	K460 K461 G462 E483 K501	K460-K481 PolarHBondContact O-N 3.47Å; K461-K481 VanDerWaalsContact CA-O 3.26Å; K461-K481 WeakPolarHBondContact CA-O 3.32Å; K461-K481 HydrophobicContact CG-CB 4.3Å; G462-K481 PolarHBondContact N-O 3.19Å; K481-E483 IonicContact NZ-OE1 3.61Å; K481-E483 PolarHBondContact NZ-OE1 2.86Å; K481-E483 IonicContact NZ-OE2 2.64Å; K481-E483 PolarHBondContact NZ-OE2 2.84Å; K481-K501 VanDerWaalsContact CA-O 3.29Å; K481-K501 WeakPolarHBondContact CA-O 3.3Å
482	G	65.5	Low	81	Confident	9 Å²	9	41.8 Å²	41.8	9%	0.093	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-179.8	154.1	166	0	0	0	0	0	114	G462 K501 G502 E503	G462-G482 WeakPolarHBondContact O-CA 3.3Å; G482-K501 PolarHBondContact N-O 3.18Å; G482-G502 WeakPolarHBondContact O-CA 3.34Å; G482-E503 PolarHBondContact O-N 3.2Å
483	E	66.1	Low	80.9	Confident	62 Å²	62	43.1 Å²	43.1	29%	0.29	23%	0.226	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	148.5	178	-75	96.2	-94.5	0	0	110.6	G462 E463 G464 K481 E503	G462-E483 PolarHBondContact O-N 2.86Å; E463-E483 WeakPolarHBondContact CA-O 3.18Å; E463-E483 HydrophobicContact CG-CB 4.31Å; G464-E483 PolarHBondContact N-O 3.31Å; G464-E483 VanDerWaalsContact N-O 3.11Å; K481-E483 IonicContact NZ-OE1 3.61Å; K481-E483 PolarHBondContact NZ-OE1 2.86Å; K481-E483 IonicContact NZ-OE2 2.64Å; K481-E483 PolarHBondContact NZ-OE2 2.84Å; E483-E503 WeakPolarHBondContact CA-O 3.41Å; E483-E503 HydrophobicContact CG-CB 4.16Å
484	G	69	Low	80.6	Confident	20 Å²	20	40.5 Å²	40.5	21%	0.206	22%	0.22	C	C	.	.			trans	70.6	46.3	167.5	0	0	0	0	0	115.8	G464 A465 E503 G504	G464-G484 WeakPolarHBondContact CA-O 3.3Å; A465-G484 PolarHBondContact N-O 2.87Å; G484-E503 PolarHBondContact N-O 2.87Å; G484-G504 WeakPolarHBondContact CA-O 3.38Å
485	G	79.5	Confident	80.7	Confident	14 Å²	14	40.1 Å²	40.1	14%	0.144	22%	0.215	C	C	.	.			trans	-78.8	116.3	167.9	0	0	0	0	0	110.8	A465 A505 Q506	A465-G485 CarbonylContact O-C 3.41Å; G485-A505 CarbonylContact O-C 3.57Å; G485-A505 WeakPolarHBondContact O-CA 3.43Å; G485-Q506 PolarHBondContact O-N 3.07Å
486	Q	87.1	Confident	80.6	Confident	45 Å²	45	41.2 Å²	41.2	21%	0.21	22%	0.217	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-121.3	130.9	-172.9	-60.8	-178.1	-32.5	0	0	112.3	A465 Q466 N467 Q506	A465-Q486 PolarHBondContact O-N 3.42Å; Q466-Q486 CarbonylContact C-O 3.49Å; Q466-Q486 WeakPolarHBondContact CA-O 3.26Å; Q466-Q486 HydrophobicContact CG-CB 4.27Å; N467-Q486 PolarHBondContact N-O 2.87Å; Q486-Q506 CarbonylContact C-O 3.55Å; Q486-Q506 VanDerWaalsContact CA-O 3.27Å; Q486-Q506 WeakPolarHBondContact CA-O 3.35Å; Q486-Q506 HydrophobicContact CG-CB 4.28Å
487	N	87.9	Confident	80.4	Confident	8 Å²	8	39.8 Å²	39.8	4%	0.043	21%	0.211	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-123.7	128.4	168.5	-56.5	-61.9	0	0	0	110.5	N467 N477 A495 N497 Q506 N507 Q508	N467-N487 WeakPolarHBondContact CB-OD1 3.31Å; N467-N487 PolarHBondContact ND2-OD1 2.99Å; N467-N487 CarbonylContact O-C 3.56Å; N467-N487 WeakPolarHBondContact O-CA 2.99Å; N477-N487 PolarHBondContact ND2-ND2 3.21Å; N477-N487 PolarHBondContact ND2-OD1 3.5Å; N477-N487 VanDerWaalsContact ND2-OD1 3.11Å; N487-A495 HydrophobicContact CB-CB 4.07Å; N487-N497 PolarHBondContact ND2-OD1 2.95Å; N487-Q506 PolarHBondContact N-O 3.4Å; N487-N507 WeakPolarHBondContact CB-OD1 3.29Å; N487-N507 PolarHBondContact ND2-OD1 3.44Å; N487-N507 CarbonylContact O-C 3.51Å; N487-N507 VanDerWaalsContact O-CA 3.31Å; N487-N507 WeakPolarHBondContact O-CA 3.37Å; N487-Q508 PolarHBondContact O-N 2.91Å
488	Q	86.2	Confident	80.1	Confident	63 Å²	63	42.4 Å²	42.4	29%	0.294	22%	0.223	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	134	-179.1	-57.7	-170.5	11.1	0	0	112.4	N467 Q468 S469 Q508	N467-Q488 PolarHBondContact O-N 2.91Å; Q468-Q488 CarbonylContact C-O 3.56Å; Q468-Q488 WeakPolarHBondContact CA-O 3.2Å; Q468-Q488 HydrophobicContact CG-CB 4.36Å; S469-Q488 PolarHBondContact N-O 2.89Å; S469-Q488 PolarHBondContact OG-O 2.83Å; Q488-Q508 CarbonylContact C-O 3.37Å; Q488-Q508 WeakPolarHBondContact CA-O 3.27Å; Q488-Q508 HydrophobicContact CG-CB 4.32Å
489	A	85.1	Confident	79.7	Confident	19 Å²	19	40.4 Å²	40.4	16%	0.157	22%	0.217	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-148	157.3	-178.3	0	0	0	0	0	113.2	S469 Q508 A509 K510	S469-A489 WeakPolarHBondContact O-CA 3.44Å; A489-Q508 PolarHBondContact N-O 3.42Å; A489-A509 WeakPolarHBondContact O-CA 3.43Å; A489-K510 PolarHBondContact O-N 2.6Å
490	K	81.3	Confident	79.2	Confident	118 Å²	118	44.7 Å²	44.7	51%	0.513	23%	0.231	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-90.2	-45.8	164.7	-62.5	-168.6	179.5	-169.8	0	111.5	K470 K510 K511	K470-K490 WeakPolarHBondContact O-CA 3.39Å; K470-K490 WeakPolarHBondContact O-CB 3.35Å; K470-K490 PolarHBondContact O-N 2.91Å; K470-K490 VanDerWaalsContact O-N 3.13Å; K490-K510 WeakPolarHBondContact O-CB 3.37Å; K490-K510 PolarHBondContact O-N 2.61Å; K490-K511 PolarHBondContact O-N 3.09Å
491	K	81.5	Confident	78.9	Confident	75 Å²	75	43.6 Å²	43.6	33%	0.326	23%	0.226	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	126.1	156.8	-164.4	-164.5	-172.5	-114.5	0	107.9	K470 K471 G472 E493 K511	K470-K491 PolarHBondContact O-N 3.06Å; K471-K491 CarbonylContact C-O 3.55Å; K471-K491 VanDerWaalsContact CA-O 3.31Å; K471-K491 WeakPolarHBondContact CA-O 3.2Å; K471-K491 HydrophobicContact CG-CB 4.39Å; G472-K491 PolarHBondContact N-O 3.4Å; K491-E493 WeakPolarHBondContact CD-OE1 3.3Å; K491-E493 WeakPolarHBondContact CE-OE1 3.49Å; K491-E493 WeakPolarHBondContact CG-OE1 3.35Å; K491-E493 IonicContact NZ-OE1 2.63Å; K491-E493 PolarHBondContact NZ-OE1 3.44Å; K491-E493 IonicContact NZ-OE2 3.75Å; K491-E493 PolarHBondContact NZ-OE2 3.4Å; K491-K511 CarbonylContact C-O 3.59Å; K491-K511 VanDerWaalsContact CA-O 3.28Å; K491-K511 WeakPolarHBondContact CA-O 3.44Å; K491-K511 HydrophobicContact CG-CB 4.43Å
492	G	75.3	Confident	78.3	Confident	7 Å²	7	40.6 Å²	40.6	7%	0.072	22%	0.216	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-141.2	123.5	-175.5	0	0	0	0	0	113.4	G472 K511 G512 E513	G472-G492 WeakPolarHBondContact O-CA 3.38Å; G492-K511 PolarHBondContact N-O 3.2Å; G492-G512 CarbonylContact O-C 3.58Å; G492-G512 WeakPolarHBondContact O-CA 2.97Å; G492-E513 PolarHBondContact O-N 2.94Å; G492-E513 VanDerWaalsContact O-N 3.14Å
493	E	79.3	Confident	78.4	Confident	36 Å²	36	42.8 Å²	42.8	17%	0.168	22%	0.223	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	140.5	173.8	-76	103.1	-100	0	0	111.4	G472 E473 G474 K491 A495 E513	G472-E493 PolarHBondContact O-N 3.27Å; E473-E493 CarbonylContact C-O 3.55Å; E473-E493 VanDerWaalsContact CA-O 3.3Å; E473-E493 WeakPolarHBondContact CA-O 3.27Å; E473-E493 HydrophobicContact CG-CB 4.23Å; G474-E493 PolarHBondContact N-O 3.37Å; K491-E493 WeakPolarHBondContact CD-OE1 3.3Å; K491-E493 WeakPolarHBondContact CE-OE1 3.49Å; K491-E493 WeakPolarHBondContact CG-OE1 3.35Å; K491-E493 IonicContact NZ-OE1 2.63Å; K491-E493 PolarHBondContact NZ-OE1 3.44Å; K491-E493 IonicContact NZ-OE2 3.75Å; K491-E493 PolarHBondContact NZ-OE2 3.4Å; E493-A495 PolarHBondContact O-N 3.33Å; E493-E513 WeakPolarHBondContact CA-O 2.94Å; E493-E513 HydrophobicContact CG-CB 4.3Å
494	G	77.5	Confident	78.5	Confident	24 Å²	24	41 Å²	41	25%	0.247	22%	0.222	C	C	.	.	S	Bend	trans	68.2	32.1	167.9	0	0	0	0	0	116.6	E513 G514	G494-E513 PolarHBondContact N-O 3.02Å; G494-G514 WeakPolarHBondContact CA-O 3.26Å
495	A	84.7	Confident	79	Confident	15 Å²	15	41 Å²	41	12%	0.124	22%	0.22	C	C	.	.			trans	-74.7	126.8	177.7	0	0	0	0	0	111.9	A475 N487 E493 V515 Q516	A475-A495 CarbonylContact O-C 3.58Å; A475-A495 WeakPolarHBondContact O-CA 3.37Å; N487-A495 HydrophobicContact CB-CB 4.07Å; E493-A495 PolarHBondContact O-N 3.33Å; A495-V515 CarbonylContact O-C 3.54Å; A495-V515 WeakPolarHBondContact O-CA 3.03Å; A495-Q516 PolarHBondContact O-N 3.43Å
496	Q	86.8	Confident	79.1	Confident	38 Å²	38	42.5 Å²	42.5	18%	0.178	22%	0.223	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.2	140	-175.8	-53.3	-168.5	-3.9	0	0	114.2	A475 Q476 N477 Q516	A475-Q496 PolarHBondContact O-N 2.83Å; Q476-Q496 CarbonylContact C-O 3.58Å; Q476-Q496 WeakPolarHBondContact CA-O 3.06Å; Q476-Q496 HydrophobicContact CG-CB 4.27Å; N477-Q496 PolarHBondContact N-O 3.47Å; Q496-Q516 CarbonylContact C-O 3.58Å; Q496-Q516 VanDerWaalsContact CA-O 3.25Å; Q496-Q516 WeakPolarHBondContact CA-O 3.29Å; Q496-Q516 HydrophobicContact CG-CB 4.21Å
497	N	84.9	Confident	78.9	Confident	8 Å²	8	40.6 Å²	40.6	4%	0.043	21%	0.214	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	129.1	165.1	-58.4	-54.4	0	0	0	110	N477 N487 A505 N507 Q516 N517 Q518	N477-N497 WeakPolarHBondContact CB-OD1 3.28Å; N477-N497 PolarHBondContact ND2-OD1 2.99Å; N477-N497 CarbonylContact O-C 3.57Å; N477-N497 WeakPolarHBondContact O-CA 3.35Å; N487-N497 PolarHBondContact ND2-OD1 2.95Å; N497-A505 HydrophobicContact CB-CB 3.97Å; N497-N507 PolarHBondContact ND2-ND2 3.38Å; N497-N507 PolarHBondContact ND2-OD1 2.94Å; N497-Q516 PolarHBondContact N-O 3.37Å; N497-N517 WeakPolarHBondContact CB-OD1 3.43Å; N497-N517 PolarHBondContact ND2-OD1 2.84Å; N497-N517 CarbonylContact O-C 3.57Å; N497-N517 WeakPolarHBondContact O-CA 3.46Å; N497-Q518 PolarHBondContact O-N 3.08Å
498	Q	82.3	Confident	78.5	Confident	62 Å²	62	43.4 Å²	43.4	29%	0.29	23%	0.227	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-130.2	126.9	-178.4	-56.5	-171.5	17.7	0	0	112.1	N477 Q478 A479 Q518	N477-Q498 PolarHBondContact O-N 3.22Å; Q478-Q498 CarbonylContact C-O 3.6Å; Q478-Q498 WeakPolarHBondContact CA-O 3.3Å; Q478-Q498 HydrophobicContact CG-CB 4.34Å; A479-Q498 PolarHBondContact N-O 3.42Å; Q498-Q518 CarbonylContact C-O 3.52Å; Q498-Q518 WeakPolarHBondContact CA-O 3.35Å; Q498-Q518 HydrophobicContact CG-CB 4.39Å
499	A	78.2	Confident	78.2	Confident	21 Å²	21	41.2 Å²	41.2	17%	0.174	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-132.5	160.3	-179.7	0	0	0	0	0	113.2	A479 Q518 A519 K520	A479-A499 WeakPolarHBondContact O-CA 3.3Å; A499-Q518 PolarHBondContact N-O 2.97Å; A499-A519 HydrophobicContact CB-CB 4.04Å; A499-A519 VanDerWaalsContact O-CA 3.29Å; A499-A519 WeakPolarHBondContact O-CA 3.09Å; A499-K520 PolarHBondContact O-N 2.83Å
500	K	72.3	Confident	77.7	Confident	115 Å²	115	45.8 Å²	45.8	50%	0.5	24%	0.236	S	C	.	.	S	Bend	trans	-95.7	-40.3	161.9	-59.7	-168.2	177.8	-167.4	0	112.3	A479 K480 K520 K521	A479-K500 PolarHBondContact O-N 3.31Å; K480-K500 WeakPolarHBondContact O-CA 3.29Å; K480-K500 VanDerWaalsContact O-CB 3.26Å; K480-K500 WeakPolarHBondContact O-CB 3.46Å; K480-K500 PolarHBondContact O-N 3.13Å; K500-K520 CarbonylContact O-C 3.53Å; K500-K521 PolarHBondContact O-N 2.98Å
501	K	70.8	Confident	77.3	Confident	86 Å²	86	43.7 Å²	43.7	37%	0.374	23%	0.227	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.5	137.7	152.6	-163.5	-145.8	-178.8	-127.2	0	108.5	K480 K481 G482 E503 K521	K480-K501 PolarHBondContact O-N 3.27Å; K481-K501 VanDerWaalsContact CA-O 3.29Å; K481-K501 WeakPolarHBondContact CA-O 3.3Å; G482-K501 PolarHBondContact N-O 3.18Å; K501-E503 VanDerWaalsContact CE-OE1 3.26Å; K501-E503 WeakPolarHBondContact CE-OE1 3.35Å; K501-E503 IonicContact NZ-OE1 2.62Å; K501-E503 PolarHBondContact NZ-OE1 2.92Å; K501-E503 IonicContact NZ-OE2 2.96Å; K501-E503 PolarHBondContact NZ-OE2 3.29Å; K501-K521 VanDerWaalsContact CA-O 3.25Å; K501-K521 WeakPolarHBondContact CA-O 3.41Å; K501-K521 VanDerWaalsContact CG-O 3.29Å; K501-K521 WeakPolarHBondContact CG-O 3.36Å
502	G	64.3	Low	76.5	Confident	8 Å²	8	40.4 Å²	40.4	8%	0.082	22%	0.215	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-174.4	159.2	172.9	0	0	0	0	0	113.7	G482 G522	G482-G502 WeakPolarHBondContact O-CA 3.34Å; G502-G522 CarbonylContact O-C 3.53Å
503	E	67.3	Low	76.3	Confident	54 Å²	54	42.4 Å²	42.4	25%	0.252	22%	0.222	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-130.4	154.7	-176.3	-69.8	104	-97.4	0	0	110.1	G482 E483 G484 K501 E524	G482-E503 PolarHBondContact O-N 3.2Å; E483-E503 WeakPolarHBondContact CA-O 3.41Å; E483-E503 HydrophobicContact CG-CB 4.16Å; G484-E503 PolarHBondContact N-O 2.87Å; K501-E503 VanDerWaalsContact CE-OE1 3.26Å; K501-E503 WeakPolarHBondContact CE-OE1 3.35Å; K501-E503 IonicContact NZ-OE1 2.62Å; K501-E503 PolarHBondContact NZ-OE1 2.92Å; K501-E503 IonicContact NZ-OE2 2.96Å; K501-E503 PolarHBondContact NZ-OE2 3.29Å; E503-E524 WeakPolarHBondContact CA-O 3.36Å; E503-E524 HydrophobicContact CG-CB 4.08Å
504	G	68.2	Low	75.8	Confident	25 Å²	25	42 Å²	42	26%	0.258	23%	0.227	S	C	.	.			trans	70.9	36.2	170.1	0	0	0	0	0	116.4	G484 Q506 E524 G525	G484-G504 WeakPolarHBondContact CA-O 3.38Å; G504-Q506 PolarHBondContact O-N 2.84Å; G504-E524 PolarHBondContact N-O 3.46Å; G504-G525 WeakPolarHBondContact CA-O 3.26Å
505	A	77.8	Confident	75.8	Confident	20 Å²	20	41.7 Å²	41.7	17%	0.165	22%	0.221	C	C	.	.			trans	-79.1	111.8	177.1	0	0	0	0	0	111.6	G485 N497 A526 Q527	G485-A505 CarbonylContact O-C 3.57Å; G485-A505 WeakPolarHBondContact O-CA 3.43Å; N497-A505 HydrophobicContact CB-CB 3.97Å; A505-A526 HydrophobicContact CB-CB 4.41Å; A505-A526 CarbonylContact O-C 3.58Å; A505-A526 WeakPolarHBondContact O-CA 3.26Å; A505-Q527 PolarHBondContact O-N 3.3Å
506	Q	81.7	Confident	75.5	Confident	45 Å²	45	43.1 Å²	43.1	21%	0.21	23%	0.225	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-115	135.6	-172.5	-58.3	179.1	-40.6	0	0	112.8	G485 Q486 N487 G504 Q527	G485-Q506 PolarHBondContact O-N 3.07Å; Q486-Q506 CarbonylContact C-O 3.55Å; Q486-Q506 VanDerWaalsContact CA-O 3.27Å; Q486-Q506 WeakPolarHBondContact CA-O 3.35Å; Q486-Q506 HydrophobicContact CG-CB 4.28Å; N487-Q506 PolarHBondContact N-O 3.4Å; G504-Q506 PolarHBondContact O-N 2.84Å; Q506-Q527 CarbonylContact C-O 3.55Å; Q506-Q527 VanDerWaalsContact CA-O 3.27Å; Q506-Q527 WeakPolarHBondContact CA-O 3.26Å; Q506-Q527 HydrophobicContact CG-CB 4.28Å
507	N	83.5	Confident	75.1	Confident	6 Å²	6	41.4 Å²	41.4	3%	0.032	22%	0.217	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.2	130.5	170.1	-55.9	-66.4	0	0	0	110.4	N487 N497 V515 N517 Q527 N528 Q529	N487-N507 WeakPolarHBondContact CB-OD1 3.29Å; N487-N507 PolarHBondContact ND2-OD1 3.44Å; N487-N507 CarbonylContact O-C 3.51Å; N487-N507 VanDerWaalsContact O-CA 3.31Å; N487-N507 WeakPolarHBondContact O-CA 3.37Å; N497-N507 PolarHBondContact ND2-ND2 3.38Å; N497-N507 PolarHBondContact ND2-OD1 2.94Å; N507-V515 HydrophobicContact CB-CG1 3.65Å; N507-V515 VanDerWaalsContact ND2-CG1 3.3Å; N507-V515 WeakPolarHBondContact ND2-CG1 3.29Å; N507-N517 PolarHBondContact ND2-ND2 2.96Å; N507-N517 PolarHBondContact ND2-OD1 3.26Å; N507-Q527 PolarHBondContact N-O 3.31Å; N507-N528 PolarHBondContact ND2-OD1 3.36Å; N507-N528 CarbonylContact O-C 3.56Å; N507-N528 VanDerWaalsContact O-CA 3.29Å; N507-N528 WeakPolarHBondContact O-CA 3.27Å; N507-Q529 PolarHBondContact O-N 3.22Å
508	Q	80.5	Confident	74.7	Confident	67 Å²	67	43.8 Å²	43.8	31%	0.313	23%	0.228	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.7	116.3	179.8	-56.4	-171.6	6	0	0	110.9	N487 Q488 A489 Q529	N487-Q508 PolarHBondContact O-N 2.91Å; Q488-Q508 CarbonylContact C-O 3.37Å; Q488-Q508 WeakPolarHBondContact CA-O 3.27Å; Q488-Q508 HydrophobicContact CG-CB 4.32Å; A489-Q508 PolarHBondContact N-O 3.42Å; Q508-Q529 CarbonylContact C-O 3.54Å; Q508-Q529 WeakPolarHBondContact CA-O 3.25Å; Q508-Q529 HydrophobicContact CG-CB 4.29Å
509	A	78.9	Confident	74.2	Confident	17 Å²	17	41.3 Å²	41.3	14%	0.14	22%	0.218	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-138.1	118.3	-177.8	0	0	0	0	0	111.5	A489 Q529 G530	A489-A509 WeakPolarHBondContact O-CA 3.43Å; A509-Q529 PolarHBondContact N-O 2.93Å; A509-G530 WeakPolarHBondContact O-CA 3.29Å
510	K	74	Confident	73.6	Confident	115 Å²	115	46.1 Å²	46.1	50%	0.5	24%	0.235	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-65.1	-44.4	-179.2	-66	-171.9	179.7	-174.7	0	111.9	A489 K490 K531 K532	A489-K510 PolarHBondContact O-N 2.6Å; K490-K510 WeakPolarHBondContact O-CB 3.37Å; K490-K510 PolarHBondContact O-N 2.61Å; K510-K531 WeakPolarHBondContact O-CA 3.25Å; K510-K531 VanDerWaalsContact O-CB 3.3Å; K510-K531 WeakPolarHBondContact O-CB 3.01Å; K510-K531 PolarHBondContact O-N 3.01Å; K510-K531 VanDerWaalsContact O-N 3.08Å; K510-K532 PolarHBondContact O-N 2.86Å
511	K	73	Confident	73.2	Confident	74 Å²	74	47.9 Å²	47.9	32%	0.322	24%	0.243	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-115.8	137.1	151.5	-168.8	-167.5	-172.2	-129.4	0	108.2	K490 K491 G492 E513 K532	K490-K511 PolarHBondContact O-N 3.09Å; K491-K511 CarbonylContact C-O 3.59Å; K491-K511 VanDerWaalsContact CA-O 3.28Å; K491-K511 WeakPolarHBondContact CA-O 3.44Å; K491-K511 HydrophobicContact CG-CB 4.43Å; G492-K511 PolarHBondContact N-O 3.2Å; K511-E513 WeakPolarHBondContact CE-OE1 3.4Å; K511-E513 IonicContact NZ-OE1 3.1Å; K511-E513 PolarHBondContact NZ-OE1 2.99Å; K511-E513 IonicContact NZ-OE2 2.85Å; K511-K532 VanDerWaalsContact CA-O 3.27Å; K511-K532 WeakPolarHBondContact CA-O 3.28Å; K511-K532 HydrophobicContact CG-CB 4.44Å
512	G	66.4	Low	72.3	Confident	6 Å²	6	44.1 Å²	44.1	6%	0.062	23%	0.229	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-169.1	157.6	169.7	0	0	0	0	0	115.8	G492 K532 G533 E534	G492-G512 CarbonylContact O-C 3.58Å; G492-G512 WeakPolarHBondContact O-CA 2.97Å; G512-K532 PolarHBondContact N-O 2.98Å; G512-K532 VanDerWaalsContact N-O 3.12Å; G512-G533 WeakPolarHBondContact O-CA 2.96Å; G512-E534 PolarHBondContact O-N 3.46Å
513	E	69.9	Low	71.8	Confident	49 Å²	49	44.1 Å²	44.1	23%	0.229	23%	0.227	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-135.6	146	-171.6	-72.5	129.3	-124.7	0	0	110.1	G492 E493 G494 K511 E534	G492-E513 PolarHBondContact O-N 2.94Å; G492-E513 VanDerWaalsContact O-N 3.14Å; E493-E513 WeakPolarHBondContact CA-O 2.94Å; E493-E513 HydrophobicContact CG-CB 4.3Å; G494-E513 PolarHBondContact N-O 3.02Å; K511-E513 WeakPolarHBondContact CE-OE1 3.4Å; K511-E513 IonicContact NZ-OE1 3.1Å; K511-E513 PolarHBondContact NZ-OE1 2.99Å; K511-E513 IonicContact NZ-OE2 2.85Å; E513-E534 HydrophobicContact CG-CB 4.2Å
514	G	68.8	Low	71.2	Confident	27 Å²	27	45.1 Å²	45.1	28%	0.278	23%	0.232	S	C	.	.	E	Extended strand (participates in β ladder)	trans	71	35	171.2	0	0	0	0	0	115.4	G494 E534 A535	G494-G514 WeakPolarHBondContact CA-O 3.26Å; G514-E534 PolarHBondContact N-O 3.34Å; G514-A535 VanDerWaalsContact CA-O 3.27Å; G514-A535 WeakPolarHBondContact CA-O 2.94Å; G514-A535 PolarHBondContact N-O 3.13Å
515	V	76.8	Confident	70.8	Confident	18 Å²	18	45.7 Å²	45.7	11%	0.109	24%	0.238	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-73.4	137.3	176.1	179	0	0	0	0	110.1	A495 N507 N528 A535 N536 Q537	A495-V515 CarbonylContact O-C 3.54Å; A495-V515 WeakPolarHBondContact O-CA 3.03Å; N507-V515 HydrophobicContact CB-CG1 3.65Å; N507-V515 VanDerWaalsContact ND2-CG1 3.3Å; N507-V515 WeakPolarHBondContact ND2-CG1 3.29Å; V515-N528 WeakPolarHBondContact CG1-OD1 3.41Å; V515-A535 PolarHBondContact N-O 2.81Å; V515-N536 HydrophobicContact CB-CB 4.32Å; V515-N536 CarbonylContact O-C 3.46Å; V515-N536 WeakPolarHBondContact O-CA 3.48Å; V515-N536 PolarHBondContact O-OD1 2.68Å; V515-Q537 PolarHBondContact O-N 2.62Å
516	Q	78.9	Confident	70.5	Confident	44 Å²	44	44.8 Å²	44.8	21%	0.206	23%	0.23	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-139.3	133.4	178.7	-53.8	-169.2	1.6	0	0	114	A495 Q496 N497 Q537	A495-Q516 PolarHBondContact O-N 3.43Å; Q496-Q516 CarbonylContact C-O 3.58Å; Q496-Q516 VanDerWaalsContact CA-O 3.25Å; Q496-Q516 WeakPolarHBondContact CA-O 3.29Å; Q496-Q516 HydrophobicContact CG-CB 4.21Å; N497-Q516 PolarHBondContact N-O 3.37Å; Q516-Q537 CarbonylContact C-O 3.58Å; Q516-Q537 VanDerWaalsContact CA-O 3.28Å; Q516-Q537 WeakPolarHBondContact CA-O 3.39Å; Q516-Q537 HydrophobicContact CG-CB 4.27Å
517	N	78.7	Confident	70.1	Confident	3 Å²	3	44.9 Å²	44.9	2%	0.016	23%	0.231	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	126.5	165.5	-53.1	-71.9	0	0	0	109.6	N497 N507 A526 N528 Q537 N538 Q539	N497-N517 WeakPolarHBondContact CB-OD1 3.43Å; N497-N517 PolarHBondContact ND2-OD1 2.84Å; N497-N517 CarbonylContact O-C 3.57Å; N497-N517 WeakPolarHBondContact O-CA 3.46Å; N507-N517 PolarHBondContact ND2-ND2 2.96Å; N507-N517 PolarHBondContact ND2-OD1 3.26Å; N517-A526 HydrophobicContact CB-CB 4.49Å; N517-N528 PolarHBondContact ND2-ND2 3.39Å; N517-N528 VanDerWaalsContact ND2-ND2 3.19Å; N517-N528 PolarHBondContact ND2-OD1 2.93Å; N517-Q537 PolarHBondContact N-O 2.93Å; N517-N538 PolarHBondContact ND2-OD1 2.64Å; N517-N538 CarbonylContact O-C 3.41Å; N517-N538 WeakPolarHBondContact O-CA 3.39Å; N517-Q539 PolarHBondContact O-N 2.78Å
518	Q	76.6	Confident	69.7	Low	57 Å²	57	45 Å²	45	27%	0.266	23%	0.231	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.2	127.1	-178.2	-54.5	-173.5	13.3	0	0	111.4	N497 Q498 A499 Q539	N497-Q518 PolarHBondContact O-N 3.08Å; Q498-Q518 CarbonylContact C-O 3.52Å; Q498-Q518 WeakPolarHBondContact CA-O 3.35Å; Q498-Q518 HydrophobicContact CG-CB 4.39Å; A499-Q518 PolarHBondContact N-O 2.97Å; Q518-Q539 CarbonylContact C-O 3.57Å; Q518-Q539 WeakPolarHBondContact CA-O 3.36Å; Q518-Q539 HydrophobicContact CB-CB 4.5Å; Q518-Q539 HydrophobicContact CG-CB 4.24Å; Q518-Q539 HydrophobicContact CG-CG 4.47Å
519	A	70.9	Confident	69.4	Low	11 Å²	11	44.9 Å²	44.9	9%	0.091	23%	0.231	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-144.6	157.4	167.1	0	0	0	0	0	116.3	A499 G522 V523 Q539 K541	A499-A519 HydrophobicContact CB-CB 4.04Å; A499-A519 VanDerWaalsContact O-CA 3.29Å; A499-A519 WeakPolarHBondContact O-CA 3.09Å; A519-G522 VanDerWaalsContact CB-O 3.25Å; A519-G522 WeakPolarHBondContact CB-O 3.36Å; A519-V523 HydrophobicContact CB-CG2 3.49Å; A519-V523 VanDerWaalsContact CB-CG2 3.49Å; A519-Q539 PolarHBondContact N-O 2.82Å; A519-K541 PolarHBondContact O-N 2.86Å
520	K	66.2	Low	68.8	Low	122 Å²	122	45 Å²	45	53%	0.53	23%	0.233	S	C	.	.	S	Bend	trans	-94.8	-17.3	-175.6	-56.7	-167.6	-174.9	-168.6	0	114	A499 K500	A499-K520 PolarHBondContact O-N 2.83Å; K500-K520 CarbonylContact O-C 3.53Å
521	K	63.6	Low	68.4	Low	151 Å²	151	45.2 Å²	45.2	66%	0.657	23%	0.234	S	C	*	.	S	Bend	trans	-158.5	123.6	170.3	-66.1	-172	179.2	-174.4	0	109.1	K500 K501	K500-K521 PolarHBondContact O-N 2.98Å; K501-K521 VanDerWaalsContact CA-O 3.25Å; K501-K521 WeakPolarHBondContact CA-O 3.41Å; K501-K521 VanDerWaalsContact CG-O 3.29Å; K501-K521 WeakPolarHBondContact CG-O 3.36Å
522	G	53.5	Low	68	Low	8 Å²	8	45.8 Å²	45.8	8%	0.082	24%	0.237	C	C	.	.			trans	74.5	125.8	-175.6	0	0	0	0	0	112.1	G502 A519 E524 K542	G502-G522 CarbonylContact O-C 3.53Å; A519-G522 VanDerWaalsContact CB-O 3.25Å; A519-G522 WeakPolarHBondContact CB-O 3.36Å; G522-E524 WeakPolarHBondContact CA-OE1 3.22Å; G522-K542 PolarHBondContact N-O 2.81Å
523	V	52.8	Low	67.6	Low	8 Å²	8	46 Å²	46	5%	0.048	24%	0.239	C	C	.	.			trans	-138.8	34.2	163.3	-173	0	0	0	0	107.2	A519 G525 A526 A540	A519-V523 HydrophobicContact CB-CG2 3.49Å; A519-V523 VanDerWaalsContact CB-CG2 3.49Å; V523-G525 PolarHBondContact O-N 3.24Å; V523-A526 HydrophobicContact CG1-CB 3.44Å; V523-A526 VanDerWaalsContact CG1-CB 3.44Å; V523-A526 PolarHBondContact O-N 3.03Å; V523-A540 HydrophobicContact CB-CB 4.09Å; V523-A540 HydrophobicContact CG2-CB 3.55Å
524	E	55.7	Low	67.1	Low	74 Å²	74	46.9 Å²	46.9	35%	0.346	24%	0.243	S	C	.	.	T	Hydrogen-bonded Turn	trans	-59.3	129.9	175.8	-72.3	113.3	-109.9	0	0	109.2	E503 G504 G522 A526 E544	E503-E524 WeakPolarHBondContact CA-O 3.36Å; E503-E524 HydrophobicContact CG-CB 4.08Å; G504-E524 PolarHBondContact N-O 3.46Å; G522-E524 WeakPolarHBondContact CA-OE1 3.22Å; E524-A526 PolarHBondContact O-N 3.1Å; E524-E544 HydrophobicContact CG-CB 4.32Å; E524-E544 HydrophobicContact CG-CG 4.17Å
525	G	59.7	Low	66.7	Low	38 Å²	38	47.6 Å²	47.6	39%	0.392	25%	0.246	S	C	.	.	T	Hydrogen-bonded Turn	trans	69	24.2	178.8	0	0	0	0	0	116.6	G504 V523 Q527	G504-G525 WeakPolarHBondContact CA-O 3.26Å; V523-G525 PolarHBondContact O-N 3.24Å; G525-Q527 PolarHBondContact O-N 3.36Å
526	A	71.2	Confident	66.3	Low	1 Å²	1	47.6 Å²	47.6	1%	0.008	25%	0.246	C	C	.	.			trans	-67.6	126.6	164.6	0	0	0	0	0	110.4	A505 N517 V523 E524 G546 Q547	A505-A526 HydrophobicContact CB-CB 4.41Å; A505-A526 CarbonylContact O-C 3.58Å; A505-A526 WeakPolarHBondContact O-CA 3.26Å; N517-A526 HydrophobicContact CB-CB 4.49Å; V523-A526 HydrophobicContact CG1-CB 3.44Å; V523-A526 VanDerWaalsContact CG1-CB 3.44Å; V523-A526 PolarHBondContact O-N 3.03Å; E524-A526 PolarHBondContact O-N 3.1Å; A526-G546 CarbonylContact O-C 3.5Å; A526-G546 WeakPolarHBondContact O-CA 3.26Å; A526-Q547 PolarHBondContact O-N 2.92Å
527	Q	73.3	Confident	66	Low	47 Å²	47	47.5 Å²	47.5	22%	0.22	25%	0.245	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-132.5	122.8	-174.9	-62.5	179.7	-44.9	0	0	111.5	A505 Q506 N507 G525 Q547	A505-Q527 PolarHBondContact O-N 3.3Å; Q506-Q527 CarbonylContact C-O 3.55Å; Q506-Q527 VanDerWaalsContact CA-O 3.27Å; Q506-Q527 WeakPolarHBondContact CA-O 3.26Å; Q506-Q527 HydrophobicContact CG-CB 4.28Å; N507-Q527 PolarHBondContact N-O 3.31Å; G525-Q527 PolarHBondContact O-N 3.36Å; Q527-Q547 WeakPolarHBondContact CA-O 3.26Å; Q527-Q547 HydrophobicContact CG-CB 4.31Å
528	N	75.4	Confident	65.7	Low	7 Å²	7	47.7 Å²	47.7	4%	0.037	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120	122	177.4	-48.5	-80.4	0	0	0	110.3	N507 V515 N517 N536 N538 Q547 N548 Q549	N507-N528 PolarHBondContact ND2-OD1 3.36Å; N507-N528 CarbonylContact O-C 3.56Å; N507-N528 VanDerWaalsContact O-CA 3.29Å; N507-N528 WeakPolarHBondContact O-CA 3.27Å; V515-N528 WeakPolarHBondContact CG1-OD1 3.41Å; N517-N528 PolarHBondContact ND2-ND2 3.39Å; N517-N528 VanDerWaalsContact ND2-ND2 3.19Å; N517-N528 PolarHBondContact ND2-OD1 2.93Å; N528-N536 VanDerWaalsContact CB-ND2 3.3Å; N528-N536 WeakPolarHBondContact CB-ND2 3.4Å; N528-N536 PolarHBondContact ND2-ND2 2.69Å; N528-N538 PolarHBondContact ND2-OD1 3.35Å; N528-Q547 PolarHBondContact N-O 2.88Å; N528-N548 WeakPolarHBondContact CB-OD1 3.29Å; N528-N548 PolarHBondContact ND2-OD1 3.35Å; N528-N548 CarbonylContact O-C 3.52Å; N528-N548 WeakPolarHBondContact O-CA 3.34Å; N528-Q549 PolarHBondContact O-N 3.36Å
529	Q	73.1	Confident	65.4	Low	66 Å²	66	47.8 Å²	47.8	31%	0.308	25%	0.247	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-125.1	139	-173	-59	-176.6	0.3	0	0	112.5	N507 Q508 A509 Q549	N507-Q529 PolarHBondContact O-N 3.22Å; Q508-Q529 CarbonylContact C-O 3.54Å; Q508-Q529 WeakPolarHBondContact CA-O 3.25Å; Q508-Q529 HydrophobicContact CG-CB 4.29Å; A509-Q529 PolarHBondContact N-O 2.93Å; Q529-Q549 CarbonylContact C-O 3.54Å; Q529-Q549 VanDerWaalsContact CA-O 3.3Å; Q529-Q549 WeakPolarHBondContact CA-O 3.24Å; Q529-Q549 HydrophobicContact CG-CB 4.38Å
530	G	66.3	Low	65.1	Low	18 Å²	18	47.8 Å²	47.8	19%	0.186	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-165.5	175.5	176.7	0	0	0	0	0	116.2	A509 Q549 K551	A509-G530 WeakPolarHBondContact O-CA 3.29Å; G530-Q549 PolarHBondContact N-O 3.1Å; G530-K551 PolarHBondContact O-N 2.96Å
531	K	65.1	Low	64.9	Low	120 Å²	120	47.9 Å²	47.9	52%	0.522	25%	0.247	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-102.2	-40.9	172.6	-61.9	-170.8	175.6	-170.1	0	112.7	K510 K551 K552	K510-K531 WeakPolarHBondContact O-CA 3.25Å; K510-K531 VanDerWaalsContact O-CB 3.3Å; K510-K531 WeakPolarHBondContact O-CB 3.01Å; K510-K531 PolarHBondContact O-N 3.01Å; K510-K531 VanDerWaalsContact O-N 3.08Å; K531-K551 HydrophobicContact CG-CD 4.41Å; K531-K552 PolarHBondContact O-N 3.08Å; K531-K552 VanDerWaalsContact O-N 3.12Å
532	K	65.1	Low	64.6	Low	86 Å²	86	47.6 Å²	47.6	37%	0.374	25%	0.246	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	136.5	165.8	-164.1	-160.8	-174.9	-134.1	0	109.6	K510 K511 G512 E534 K552	K510-K532 PolarHBondContact O-N 2.86Å; K511-K532 VanDerWaalsContact CA-O 3.27Å; K511-K532 WeakPolarHBondContact CA-O 3.28Å; K511-K532 HydrophobicContact CG-CB 4.44Å; G512-K532 PolarHBondContact N-O 2.98Å; G512-K532 VanDerWaalsContact N-O 3.12Å; K532-E534 VanDerWaalsContact CE-OE1 3.31Å; K532-E534 WeakPolarHBondContact CE-OE1 3.33Å; K532-E534 IonicContact NZ-OE1 2.69Å; K532-E534 PolarHBondContact NZ-OE1 2.92Å; K532-K552 WeakPolarHBondContact CA-O 3.39Å
533	G	58.7	Low	64.6	Low	11 Å²	11	47.4 Å²	47.4	11%	0.113	25%	0.245	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-167.7	163	170.4	0	0	0	0	0	113.8	G512 G553 E554	G512-G533 WeakPolarHBondContact O-CA 2.96Å; G533-G553 WeakPolarHBondContact O-CA 3.29Å; G533-E554 PolarHBondContact O-N 3.24Å
534	E	59.1	Low	64.7	Low	67 Å²	67	52 Å²	52	31%	0.313	27%	0.265	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.1	151.6	-176.1	-74.2	133.4	-129.3	0	0	108.6	G512 E513 G514 K532 E554	G512-E534 PolarHBondContact O-N 3.46Å; E513-E534 HydrophobicContact CG-CB 4.2Å; G514-E534 PolarHBondContact N-O 3.34Å; K532-E534 VanDerWaalsContact CE-OE1 3.31Å; K532-E534 WeakPolarHBondContact CE-OE1 3.33Å; K532-E534 IonicContact NZ-OE1 2.69Å; K532-E534 PolarHBondContact NZ-OE1 2.92Å; E534-E554 HydrophobicContact CG-CG 4.17Å
535	A	60.5	Low	64.7	Low	42 Å²	42	49.5 Å²	49.5	35%	0.347	26%	0.259	S	S	.	.	E	Extended strand (participates in β ladder)	trans	40.9	82.8	178.6	0	0	0	0	0	117	G514 V515 E554	G514-A535 VanDerWaalsContact CA-O 3.27Å; G514-A535 WeakPolarHBondContact CA-O 2.94Å; G514-A535 PolarHBondContact N-O 3.13Å; V515-A535 PolarHBondContact N-O 2.81Å; A535-E554 PolarHBondContact N-OE2 3.31Å
536	N	68.2	Low	64.7	Low	19 Å²	19	47.8 Å²	47.8	10%	0.102	24%	0.242	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-107	128.8	167.9	173	27.7	0	0	0	110.6	V515 N528 N548 P556 Q557	V515-N536 HydrophobicContact CB-CB 4.32Å; V515-N536 CarbonylContact O-C 3.46Å; V515-N536 WeakPolarHBondContact O-CA 3.48Å; V515-N536 PolarHBondContact O-OD1 2.68Å; N528-N536 VanDerWaalsContact CB-ND2 3.3Å; N528-N536 WeakPolarHBondContact CB-ND2 3.4Å; N528-N536 PolarHBondContact ND2-ND2 2.69Å; N536-N548 PolarHBondContact ND2-OD1 2.64Å; N536-P556 HydrophobicContact CB-CB 4.18Å; N536-P556 CarbonylContact O-C 3.53Å; N536-P556 WeakPolarHBondContact O-CA 3.4Å; N536-P556 VanDerWaalsContact O-CB 3.26Å; N536-P556 WeakPolarHBondContact O-CB 3.4Å; N536-Q557 PolarHBondContact O-N 2.84Å
537	Q	72.2	Confident	64.3	Low	42 Å²	42	51 Å²	51	20%	0.196	26%	0.257	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	122.9	-175.2	-59	-168.4	-11.6	0	0	113.5	V515 Q516 N517 Q557	V515-Q537 PolarHBondContact O-N 2.62Å; Q516-Q537 CarbonylContact C-O 3.58Å; Q516-Q537 VanDerWaalsContact CA-O 3.28Å; Q516-Q537 WeakPolarHBondContact CA-O 3.39Å; Q516-Q537 HydrophobicContact CG-CB 4.27Å; N517-Q537 PolarHBondContact N-O 2.93Å; Q537-Q557 VanDerWaalsContact CA-O 3.3Å; Q537-Q557 WeakPolarHBondContact CA-O 2.78Å; Q537-Q557 HydrophobicContact CG-CB 4.34Å
538	N	72.9	Confident	63.9	Low	7 Å²	7	48.8 Å²	48.8	4%	0.037	25%	0.246	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	113.9	169.4	-50.6	-70.3	0	0	0	110.2	N517 N528 Q557 N558 Q559	N517-N538 PolarHBondContact ND2-OD1 2.64Å; N517-N538 CarbonylContact O-C 3.41Å; N517-N538 WeakPolarHBondContact O-CA 3.39Å; N528-N538 PolarHBondContact ND2-OD1 3.35Å; N538-Q557 PolarHBondContact N-O 3.37Å; N538-Q557 VanDerWaalsContact N-O 3.08Å; N538-N558 WeakPolarHBondContact CB-OD1 3.36Å; N538-N558 PolarHBondContact ND2-OD1 3.25Å; N538-N558 VanDerWaalsContact O-CA 3.29Å; N538-N558 WeakPolarHBondContact O-CA 3.39Å; N538-Q559 PolarHBondContact O-N 3.24Å
539	Q	70	Confident	63.3	Low	58 Å²	58	51.6 Å²	51.6	27%	0.271	26%	0.259	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.6	111.5	-178.3	-56.4	-170	12.5	0	0	111.1	N517 Q518 A519 Q559	N517-Q539 PolarHBondContact O-N 2.78Å; Q518-Q539 CarbonylContact C-O 3.57Å; Q518-Q539 WeakPolarHBondContact CA-O 3.36Å; Q518-Q539 HydrophobicContact CB-CB 4.5Å; Q518-Q539 HydrophobicContact CG-CB 4.24Å; Q518-Q539 HydrophobicContact CG-CG 4.47Å; A519-Q539 PolarHBondContact N-O 2.82Å; Q539-Q559 CarbonylContact C-O 3.45Å; Q539-Q559 WeakPolarHBondContact CA-O 3.49Å; Q539-Q559 HydrophobicContact CG-CB 4.35Å
540	A	65.1	Low	62.7	Low	12 Å²	12	49.4 Å²	49.4	10%	0.099	25%	0.25	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	115.3	-172.9	0	0	0	0	0	111.9	V523 K542 Q559 G560	V523-A540 HydrophobicContact CB-CB 4.09Å; V523-A540 HydrophobicContact CG2-CB 3.55Å; A540-K542 VanDerWaalsContact C-N 3.28Å; A540-K542 PolarHBondContact O-N 2.86Å; A540-Q559 PolarHBondContact N-O 2.87Å; A540-G560 WeakPolarHBondContact O-CA 3.35Å
541	K	61.4	Low	62.3	Low	123 Å²	123	54.3 Å²	54.3	54%	0.535	27%	0.267	S	S	.	.	S	Bend	trans	-68.8	-25.1	178.2	-67.6	-166.9	178.1	-167.9	0	113.7	A519 K561	A519-K541 PolarHBondContact O-N 2.86Å; K541-K561 WeakPolarHBondContact O-CB 3.48Å
542	K	58	Low	62	Low	145 Å²	145	54.3 Å²	54.3	63%	0.63	27%	0.267	S	S	*	.	S	Bend	trans	-163.4	129.3	168.3	-177.1	-165.1	178	-165.6	0	106.9	G522 A540	G522-K542 PolarHBondContact N-O 2.81Å; A540-K542 VanDerWaalsContact C-N 3.28Å; A540-K542 PolarHBondContact O-N 2.86Å
543	G	53.8	Low	61.7	Low	5 Å²	5	50.6 Å²	50.6	5%	0.052	25%	0.252	C	S	.	.	B	Isolated β-bridge	trans	160.1	172.2	175.3	0	0	0	0	0	111
544	E	54.3	Low	61.7	Low	104 Å²	104	55 Å²	55	49%	0.486	27%	0.27	S	S	.	.	P	Polyproline II helix	trans	-67.6	160.2	172.5	-64	177.9	-174.9	0	0	112	E524	E524-E544 HydrophobicContact CG-CB 4.32Å; E524-E544 HydrophobicContact CG-CG 4.17Å
545	G	55.7	Low	61.7	Low	21 Å²	21	52.2 Å²	52.2	22%	0.216	26%	0.259	C	S	.	.	P	Polyproline II helix	trans	-79.3	137	178.9	0	0	0	0	0	112.5	E564	G545-E564 VanDerWaalsContact CA-O 3.24Å; G545-E564 WeakPolarHBondContact CA-O 3.4Å; G545-E564 PolarHBondContact N-O 3.34Å
546	G	59.2	Low	61.9	Low	2 Å²	2	50.3 Å²	50.3	2%	0.021	24%	0.243	C	C	.	.	P	Polyproline II helix	trans	-63.9	138.7	175.7	0	0	0	0	0	112.4	A526 N548 A566	A526-G546 CarbonylContact O-C 3.5Å; A526-G546 WeakPolarHBondContact O-CA 3.26Å; G546-N548 PolarHBondContact O-ND2 2.99Å; G546-A566 VanDerWaalsContact O-CB 3.31Å; G546-A566 WeakPolarHBondContact O-CB 3.43Å
547	Q	63.3	Low	61.7	Low	69 Å²	69	52.1 Å²	52.1	32%	0.322	25%	0.251	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.9	138.6	174.6	-61.5	174	-14.5	0	0	110.1	A526 Q527 N528	A526-Q547 PolarHBondContact O-N 2.92Å; Q527-Q547 WeakPolarHBondContact CA-O 3.26Å; Q527-Q547 HydrophobicContact CG-CB 4.31Å; N528-Q547 PolarHBondContact N-O 2.88Å
548	N	65	Low	61.4	Low	1 Å²	1	51 Å²	51	1%	0.005	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-137.1	126.2	-176.4	-55.2	-73.9	0	0	0	111	N528 N536 G546 P556 Q567 K568	N528-N548 WeakPolarHBondContact CB-OD1 3.29Å; N528-N548 PolarHBondContact ND2-OD1 3.35Å; N528-N548 CarbonylContact O-C 3.52Å; N528-N548 WeakPolarHBondContact O-CA 3.34Å; N536-N548 PolarHBondContact ND2-OD1 2.64Å; G546-N548 PolarHBondContact O-ND2 2.99Å; N548-P556 HydrophobicContact CB-CG 4.04Å; N548-Q567 PolarHBondContact N-O 2.99Å; N548-K568 WeakPolarHBondContact O-CA 3.2Å; N548-K568 WeakPolarHBondContact O-CG 3.31Å
549	Q	63.2	Low	61	Low	66 Å²	66	54.1 Å²	54.1	31%	0.308	26%	0.261	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	116	-175.9	-61.4	177.2	-1.4	0	0	109.8	N528 Q529 G530	N528-Q549 PolarHBondContact O-N 3.36Å; Q529-Q549 CarbonylContact C-O 3.54Å; Q529-Q549 VanDerWaalsContact CA-O 3.3Å; Q529-Q549 WeakPolarHBondContact CA-O 3.24Å; Q529-Q549 HydrophobicContact CG-CB 4.38Å; G530-Q549 PolarHBondContact N-O 3.1Å
550	T	59.2	Low	60.5	Low	20 Å²	20	52.4 Å²	52.4	12%	0.123	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.1	94.6	-163.1	40.3	0	0	0	0	111.6	K552 D570	T550-K552 PolarHBondContact O-N 2.85Å; T550-D570 PolarHBondContact N-OD1 2.83Å; T550-D570 PolarHBondContact N-OD2 3.38Å; T550-D570 PolarHBondContact OG1-OD2 2.84Å
551	K	59.3	Low	60.1	Low	121 Å²	121	57.6 Å²	57.6	53%	0.526	28%	0.279	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-56.2	-26.1	-166.4	-56.5	-161.2	-178.6	-155.6	0	115.4	G530 K531 D570	G530-K551 PolarHBondContact O-N 2.96Å; K531-K551 HydrophobicContact CG-CD 4.41Å; K551-D570 VanDerWaalsContact CA-OD1 3.32Å; K551-D570 WeakPolarHBondContact CA-OD1 3.36Å; K551-D570 PolarHBondContact N-OD1 2.88Å; K551-D570 VanDerWaalsContact N-OD1 3.13Å
552	K	58.2	Low	59.8	Low	120 Å²	120	55.3 Å²	55.3	52%	0.522	27%	0.269	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.1	128.7	162	177.8	-179.2	176.9	-179	0	108.6	K531 K532 T550	K531-K552 PolarHBondContact O-N 3.08Å; K531-K552 VanDerWaalsContact O-N 3.12Å; K532-K552 WeakPolarHBondContact CA-O 3.39Å; T550-K552 PolarHBondContact O-N 2.85Å
553	G	58.4	Low	59.4	Low	7 Å²	7	49.4 Å²	49.4	7%	0.072	25%	0.249	C	C	.	.	E	Extended strand (participates in β ladder)	trans	173.8	174.1	176.6	0	0	0	0	0	113.9	G533 E574	G533-G553 WeakPolarHBondContact O-CA 3.29Å; G553-E574 PolarHBondContact O-N 2.65Å
554	E	59.5	Low	59.3	Low	104 Å²	104	52.1 Å²	52.1	49%	0.486	26%	0.261	S	S	.	.	P	Polyproline II helix	trans	-67	156.2	167.5	-64.1	-176.2	140.4	0	0	111.2	G533 E534 A535	G533-E554 PolarHBondContact O-N 3.24Å; E534-E554 HydrophobicContact CG-CG 4.17Å; A535-E554 PolarHBondContact N-OE2 3.31Å
555	G	57.9	Low	59.1	Low	8 Å²	8	49.7 Å²	49.7	8%	0.082	26%	0.258	C	S	.	.	P	Polyproline II helix	trans	-73.7	146	173.4	0	0	0	0	0	113	E574 G575	G555-E574 PolarHBondContact N-O 2.94Å; G555-G575 VanDerWaalsContact CA-O 3.26Å; G555-G575 WeakPolarHBondContact CA-O 3.4Å; G555-G575 PolarHBondContact N-O 2.92Å; G555-G575 VanDerWaalsContact N-O 3.13Å
556	P	64.5	Low	59.2	Low	3 Å²	3	48.8 Å²	48.8	2%	0.019	25%	0.248	C	C	.	.	P	Polyproline II helix	trans	-58.6	150.6	167.7	26.2	-36.1	0	0	0	112.4	N536 N548 K568 Q577	N536-P556 HydrophobicContact CB-CB 4.18Å; N536-P556 CarbonylContact O-C 3.53Å; N536-P556 WeakPolarHBondContact O-CA 3.4Å; N536-P556 VanDerWaalsContact O-CB 3.26Å; N536-P556 WeakPolarHBondContact O-CB 3.4Å; N548-P556 HydrophobicContact CB-CG 4.04Å; P556-K568 VanDerWaalsContact CD-CE 3.47Å; P556-Q577 PolarHBondContact O-N 3.43Å
557	Q	63.8	Low	59.2	Low	56 Å²	56	53.7 Å²	53.7	26%	0.262	27%	0.271	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	116.9	167.7	-58	179.4	-50.9	0	0	109.1	N536 Q537 N538 Q577	N536-Q557 PolarHBondContact O-N 2.84Å; Q537-Q557 VanDerWaalsContact CA-O 3.3Å; Q537-Q557 WeakPolarHBondContact CA-O 2.78Å; Q537-Q557 HydrophobicContact CG-CB 4.34Å; N538-Q557 PolarHBondContact N-O 3.37Å; N538-Q557 VanDerWaalsContact N-O 3.08Å; Q557-Q577 CarbonylContact C-O 3.49Å; Q557-Q577 VanDerWaalsContact CA-O 3.27Å; Q557-Q577 WeakPolarHBondContact CA-O 3.39Å; Q557-Q577 HydrophobicContact CG-CB 4.29Å
558	N	66.8	Low	59	Low	19 Å²	19	50.5 Å²	50.5	10%	0.102	26%	0.256	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106	133.4	175	-51.2	-61.9	0	0	0	110.2	N538 Q577 N578 Q579	N538-N558 WeakPolarHBondContact CB-OD1 3.36Å; N538-N558 PolarHBondContact ND2-OD1 3.25Å; N538-N558 VanDerWaalsContact O-CA 3.29Å; N538-N558 WeakPolarHBondContact O-CA 3.39Å; N558-Q577 PolarHBondContact N-O 3.43Å; N558-N578 WeakPolarHBondContact CB-OD1 3.35Å; N558-N578 PolarHBondContact ND2-OD1 2.64Å; N558-N578 WeakPolarHBondContact O-CA 3.34Å; N558-Q579 PolarHBondContact O-N 2.96Å
559	Q	63.4	Low	58.7	Low	73 Å²	73	55.4 Å²	55.4	34%	0.341	28%	0.279	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	125.9	-179.4	-61.1	-170.9	-0.7	0	0	111.6	N538 Q539 A540 Q579	N538-Q559 PolarHBondContact O-N 3.24Å; Q539-Q559 CarbonylContact C-O 3.45Å; Q539-Q559 WeakPolarHBondContact CA-O 3.49Å; Q539-Q559 HydrophobicContact CG-CB 4.35Å; A540-Q559 PolarHBondContact N-O 2.87Å; Q559-Q579 WeakPolarHBondContact CA-O 3.4Å; Q559-Q579 HydrophobicContact CG-CB 4.43Å
560	G	60	Low	58.4	Low	21 Å²	21	53.1 Å²	53.1	22%	0.216	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-167.9	170.2	-177.1	0	0	0	0	0	117.2	A540 Q579 G580 K581	A540-G560 WeakPolarHBondContact O-CA 3.35Å; G560-Q579 PolarHBondContact N-O 2.86Å; G560-G580 WeakPolarHBondContact O-CA 3.37Å; G560-K581 PolarHBondContact O-N 2.85Å
561	K	56.8	Low	58.5	Low	121 Å²	121	58.6 Å²	58.6	53%	0.526	29%	0.291	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.9	-43.8	174.5	-61.5	-175.9	174.9	-178	0	111.8	K541 K581 K582	K541-K561 WeakPolarHBondContact O-CB 3.48Å; K561-K581 WeakPolarHBondContact O-CB 3.43Å; K561-K582 PolarHBondContact O-N 2.9Å; K561-K582 VanDerWaalsContact O-N 3.07Å
562	K	54.7	Low	58.4	Low	75 Å²	75	56.6 Å²	56.6	33%	0.326	28%	0.282	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.5	124.8	159.1	-166.7	-154.4	177.4	-157	0	105.2	E564 E584	K562-E564 HydrophobicContact CD-CG 4.49Å; K562-E564 WeakPolarHBondContact CE-OE1 3.44Å; K562-E564 IonicContact NZ-OE1 3.79Å; K562-E564 PolarHBondContact NZ-OE1 3.2Å; K562-E564 IonicContact NZ-OE2 2.88Å; K562-E564 PolarHBondContact NZ-OE2 3.48Å; K562-E584 VanDerWaalsContact CE-OE1 3.28Å; K562-E584 WeakPolarHBondContact CE-OE1 3.2Å
563	G	50	Low	58.4	Low	21 Å²	21	51 Å²	51	22%	0.216	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.8	124.3	178.6	0	0	0	0	0	108.4	K582 E584	G563-K582 PolarHBondContact N-O 3.35Å; G563-E584 PolarHBondContact O-N 3.42Å
564	E	51.9	Low	58.4	Low	63 Å²	63	53.7 Å²	53.7	29%	0.294	27%	0.269	S	S	.	.			trans	-94.6	170.2	-166.5	-45	-170.6	-161.7	0	0	110.9	G545 K562 A566 E584	G545-E564 VanDerWaalsContact CA-O 3.24Å; G545-E564 WeakPolarHBondContact CA-O 3.4Å; G545-E564 PolarHBondContact N-O 3.34Å; K562-E564 HydrophobicContact CD-CG 4.49Å; K562-E564 WeakPolarHBondContact CE-OE1 3.44Å; K562-E564 IonicContact NZ-OE1 3.79Å; K562-E564 PolarHBondContact NZ-OE1 3.2Å; K562-E564 IonicContact NZ-OE2 2.88Å; K562-E564 PolarHBondContact NZ-OE2 3.48Å; E564-A566 PolarHBondContact O-N 3Å; E564-E584 VanDerWaalsContact CA-OE2 3.27Å; E564-E584 WeakPolarHBondContact CA-OE2 2.96Å; E564-E584 WeakPolarHBondContact CB-OE2 3.34Å
565	A	50.6	Low	58.5	Low	52 Å²	52	50.4 Å²	50.4	43%	0.43	26%	0.262	S	S	.	.			trans	-56.1	109.2	-166.8	0	0	0	0	0	114.7	Q567 G585	A565-Q567 PolarHBondContact O-N 3.17Å; A565-G585 WeakPolarHBondContact CA-O 3.2Å; A565-G585 WeakPolarHBondContact CB-O 3.27Å
566	A	58.2	Low	58.8	Low	2 Å²	2	50 Å²	50	2%	0.017	26%	0.258	C	S	.	.			trans	-66.5	128.7	167.2	0	0	0	0	0	110.4	G546 E564 T586 S587	G546-A566 VanDerWaalsContact O-CB 3.31Å; G546-A566 WeakPolarHBondContact O-CB 3.43Å; E564-A566 PolarHBondContact O-N 3Å; A566-T586 HydrophobicContact CB-CG2 4.43Å; A566-T586 CarbonylContact O-C 3.57Å; A566-T586 VanDerWaalsContact O-CA 3.26Å; A566-T586 WeakPolarHBondContact O-CA 3.41Å; A566-T586 WeakPolarHBondContact O-CG2 3.49Å; A566-S587 PolarHBondContact O-N 2.93Å
567	Q	57.9	Low	58.9	Low	105 Å²	105	52.9 Å²	52.9	49%	0.491	27%	0.271	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	144.3	174.5	-63.5	-176.9	4.2	0	0	111.9	N548 A565	N548-Q567 PolarHBondContact N-O 2.99Å; A565-Q567 PolarHBondContact O-N 3.17Å
568	K	60.1	Low	59.1	Low	2 Å²	2	50.6 Å²	50.6	1%	0.009	26%	0.261	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.6	146.9	170.5	-54.3	-170.4	-168.5	164.1	0	112.4	N548 P556 I573 T586 S587 N588 Q589	N548-K568 WeakPolarHBondContact O-CA 3.2Å; N548-K568 WeakPolarHBondContact O-CG 3.31Å; P556-K568 VanDerWaalsContact CD-CE 3.47Å; K568-I573 HydrophobicContact CB-CD1 3.9Å; K568-I573 HydrophobicContact CD-CD1 3.73Å; K568-I573 HydrophobicContact CD-CG1 4.24Å; K568-I573 HydrophobicContact CD-CG2 4.26Å; K568-I573 VanDerWaalsContact NZ-CG2 3.31Å; K568-T586 HydrophobicContact CD-CG2 4.14Å; K568-T586 HydrophobicContact CG-CG2 3.89Å; K568-S587 PolarHBondContact N-O 2.96Å; K568-N588 WeakPolarHBondContact CD-OD1 3.41Å; K568-Q589 PolarHBondContact O-N 2.93Å
569	Q	58.5	Low	59	Low	105 Å²	105	53.4 Å²	53.4	49%	0.491	27%	0.274	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.9	95.3	-178.8	-69.7	-175.2	-24	0	0	111.1	Q589	Q569-Q589 CarbonylContact C-O 3.47Å; Q569-Q589 WeakPolarHBondContact CA-O 3.25Å; Q569-Q589 HydrophobicContact CG-CB 4.31Å
570	D	56.8	Low	59.1	Low	18 Å²	18	51.1 Å²	51.1	10%	0.096	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.2	173.5	-163.9	-81.6	-53.8	0	0	0	117.4	T550 K551 I573 Q589 G590 K591	T550-D570 PolarHBondContact N-OD1 2.83Å; T550-D570 PolarHBondContact N-OD2 3.38Å; T550-D570 PolarHBondContact OG1-OD2 2.84Å; K551-D570 VanDerWaalsContact CA-OD1 3.32Å; K551-D570 WeakPolarHBondContact CA-OD1 3.36Å; K551-D570 PolarHBondContact N-OD1 2.88Å; K551-D570 VanDerWaalsContact N-OD1 3.13Å; D570-I573 HydrophobicContact CB-CD1 3.8Å; D570-I573 HydrophobicContact CB-CG1 3.79Å; D570-Q589 PolarHBondContact N-O 3.02Å; D570-G590 WeakPolarHBondContact O-CA 2.99Å; D570-K591 PolarHBondContact O-N 2.89Å
571	K	60.8	Low	59.2	Low	134 Å²	134	55.8 Å²	55.8	58%	0.583	28%	0.284	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.7	-48.4	178.4	-70.1	-173.1	178	-176.6	0	113.1	K591 K592	K571-K591 WeakPolarHBondContact O-CB 3.47Å; K571-K592 PolarHBondContact O-N 2.63Å
572	K	58.2	Low	59.6	Low	80 Å²	80	55 Å²	55	35%	0.348	28%	0.281	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.1	126	172.6	-166.4	-160.3	-179.4	-158.8	0	108.7	E574 K592	K572-E574 VanDerWaalsContact CD-OE1 3.29Å; K572-E574 WeakPolarHBondContact CD-OE1 2.72Å; K572-E574 WeakPolarHBondContact CE-OE1 3.23Å; K572-E574 IonicContact NZ-OE1 2.68Å; K572-E574 PolarHBondContact NZ-OE1 2.83Å; K572-K592 WeakPolarHBondContact CA-O 3.36Å; K572-K592 HydrophobicContact CG-CB 4.1Å; K572-K592 HydrophobicContact CG-CD 4.04Å
573	I	58.1	Low	60	Low	2 Å²	2	51.8 Å²	51.8	1%	0.01	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118	136.5	172.9	-68.5	154.3	0	0	0	107.7	K568 D570 N588 K592	K568-I573 HydrophobicContact CB-CD1 3.9Å; K568-I573 HydrophobicContact CD-CD1 3.73Å; K568-I573 HydrophobicContact CD-CG1 4.24Å; K568-I573 HydrophobicContact CD-CG2 4.26Å; K568-I573 VanDerWaalsContact NZ-CG2 3.31Å; D570-I573 HydrophobicContact CB-CD1 3.8Å; D570-I573 HydrophobicContact CB-CG1 3.79Å; I573-N588 HydrophobicContact CD1-CB 4.35Å; I573-K592 PolarHBondContact N-O 2.96Å
574	E	58.5	Low	60.7	Low	64 Å²	64	52.3 Å²	52.3	30%	0.299	26%	0.264	S	S	.	.			trans	-99.4	155.6	161	-76.6	129.4	-121.5	0	0	110.3	G553 G555 K572 E594	G553-E574 PolarHBondContact O-N 2.65Å; G555-E574 PolarHBondContact N-O 2.94Å; K572-E574 VanDerWaalsContact CD-OE1 3.29Å; K572-E574 WeakPolarHBondContact CD-OE1 2.72Å; K572-E574 WeakPolarHBondContact CE-OE1 3.23Å; K572-E574 IonicContact NZ-OE1 2.68Å; K572-E574 PolarHBondContact NZ-OE1 2.83Å; E574-E594 VanDerWaalsContact CA-OE2 3.22Å; E574-E594 WeakPolarHBondContact CA-OE2 3.44Å
575	G	60.3	Low	61.1	Low	34 Å²	34	49.7 Å²	49.7	35%	0.351	25%	0.254	S	S	.	.			trans	-41.9	144.9	-161.3	0	0	0	0	0	118.8	G555 E594	G555-G575 VanDerWaalsContact CA-O 3.26Å; G555-G575 WeakPolarHBondContact CA-O 3.4Å; G555-G575 PolarHBondContact N-O 2.92Å; G555-G575 VanDerWaalsContact N-O 3.13Å; G575-E594 PolarHBondContact N-OE2 2.83Å; G575-E594 VanDerWaalsContact N-OE2 3.09Å
576	A	65.7	Low	61.7	Low	0 Å²	0	47.2 Å²	47.2	0%	0	23%	0.234	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	159.4	171.8	0	0	0	0	0	111.8	A596 Q597	A576-A596 HydrophobicContact CB-CB 4.09Å; A576-A596 CarbonylContact O-C 3.55Å; A576-A596 WeakPolarHBondContact O-CA 3.3Å; A576-Q597 PolarHBondContact O-N 3.04Å
577	Q	65.8	Low	61.9	Low	63 Å²	63	48.1 Å²	48.1	29%	0.294	24%	0.24	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	125.2	174	-61	-173.7	-37.4	0	0	111.8	P556 Q557 N558 Q597	P556-Q577 PolarHBondContact O-N 3.43Å; Q557-Q577 CarbonylContact C-O 3.49Å; Q557-Q577 VanDerWaalsContact CA-O 3.27Å; Q557-Q577 WeakPolarHBondContact CA-O 3.39Å; Q557-Q577 HydrophobicContact CG-CB 4.29Å; N558-Q577 PolarHBondContact N-O 3.43Å; Q577-Q597 CarbonylContact C-O 3.56Å; Q577-Q597 WeakPolarHBondContact CA-O 2.76Å; Q577-Q597 HydrophobicContact CG-CB 4.31Å
578	N	67.8	Low	62.1	Low	9 Å²	9	43.3 Å²	43.3	5%	0.048	22%	0.218	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.9	116	176.1	-52.8	-61.9	0	0	0	110.4	N558 P583 T586 A596 Q597 N598 Q599	N558-N578 WeakPolarHBondContact CB-OD1 3.35Å; N558-N578 PolarHBondContact ND2-OD1 2.64Å; N558-N578 WeakPolarHBondContact O-CA 3.34Å; N578-P583 HydrophobicContact CB-CB 3.78Å; N578-P583 WeakPolarHBondContact O-CB 3.33Å; N578-T586 PolarHBondContact ND2-OG1 2.88Å; N578-A596 WeakPolarHBondContact ND2-CB 3.5Å; N578-Q597 PolarHBondContact N-O 3.05Å; N578-N598 WeakPolarHBondContact CB-OD1 3.33Å; N578-N598 PolarHBondContact ND2-OD1 3.45Å; N578-N598 CarbonylContact O-C 3.27Å; N578-N598 WeakPolarHBondContact O-CA 3.49Å; N578-Q599 PolarHBondContact O-N 3.44Å
579	Q	65.8	Low	62.2	Low	78 Å²	78	46.8 Å²	46.8	36%	0.364	23%	0.234	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-113.7	131.3	-178	-62.1	-175.9	-5.2	0	0	111.5	N558 Q559 G560 Q599	N558-Q579 PolarHBondContact O-N 2.96Å; Q559-Q579 WeakPolarHBondContact CA-O 3.4Å; Q559-Q579 HydrophobicContact CG-CB 4.43Å; G560-Q579 PolarHBondContact N-O 2.86Å; Q579-Q599 WeakPolarHBondContact CA-O 3.46Å; Q579-Q599 HydrophobicContact CG-CB 4.4Å
580	G	64.8	Low	62.3	Low	25 Å²	25	43.1 Å²	43.1	26%	0.258	22%	0.224	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-180	-170.2	179.9	0	0	0	0	0	118.7	G560 Q599 G600	G560-G580 WeakPolarHBondContact O-CA 3.37Å; G580-Q599 PolarHBondContact N-O 3Å; G580-G600 WeakPolarHBondContact O-CA 3.36Å
581	K	62.9	Low	62.6	Low	119 Å²	119	48.1 Å²	48.1	52%	0.517	25%	0.245	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-78.5	-44.7	165.5	-65.5	-172.8	175.6	-171.3	0	110.4	G560 K561 K601 K602	G560-K581 PolarHBondContact O-N 2.85Å; K561-K581 WeakPolarHBondContact O-CB 3.43Å; K581-K601 WeakPolarHBondContact O-CA 3.4Å; K581-K601 WeakPolarHBondContact O-CB 3.36Å; K581-K601 PolarHBondContact O-N 2.84Å; K581-K602 PolarHBondContact O-N 3.33Å; K581-K602 VanDerWaalsContact O-N 3.09Å
582	K	64.8	Low	62.8	Low	104 Å²	104	44 Å²	44	45%	0.452	23%	0.227	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-126.9	90.8	166.5	-63.2	-167.7	176.3	-170.3	0	109.9	K561 G563 K602	K561-K582 PolarHBondContact O-N 2.9Å; K561-K582 VanDerWaalsContact O-N 3.07Å; G563-K582 PolarHBondContact N-O 3.35Å; K582-K602 WeakPolarHBondContact CA-O 3.44Å; K582-K602 HydrophobicContact CG-CB 4.27Å
583	P	62.3	Low	62.9	Low	7 Å²	7	40.4 Å²	40.4	5%	0.045	21%	0.213	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-80.6	125.7	160.9	30.3	-34.4	0	0	0	110.8	N578 N598 K602 G603 E604	N578-P583 HydrophobicContact CB-CB 3.78Å; N578-P583 WeakPolarHBondContact O-CB 3.33Å; P583-N598 HydrophobicContact CB-CB 4.37Å; P583-N598 HydrophobicContact CG-CB 4.2Å; P583-K602 VanDerWaalsContact CD-O 3.29Å; P583-K602 WeakPolarHBondContact CD-O 3.34Å; P583-G603 WeakPolarHBondContact O-CA 3.12Å; P583-E604 PolarHBondContact O-N 3.25Å
584	E	63.9	Low	63.3	Low	32 Å²	32	42.1 Å²	42.1	15%	0.15	22%	0.221	C	C	.	.	P	Polyproline II helix	trans	-97.6	154.9	172.4	-67.1	160.3	-147.3	0	0	110.1	K562 G563 E564	K562-E584 VanDerWaalsContact CE-OE1 3.28Å; K562-E584 WeakPolarHBondContact CE-OE1 3.2Å; G563-E584 PolarHBondContact O-N 3.42Å; E564-E584 VanDerWaalsContact CA-OE2 3.27Å; E564-E584 WeakPolarHBondContact CA-OE2 2.96Å; E564-E584 WeakPolarHBondContact CB-OE2 3.34Å
585	G	61.2	Low	63.5	Low	8 Å²	8	39.4 Å²	39.4	8%	0.082	21%	0.211	C	C	.	.	P	Polyproline II helix	trans	-71.5	145.5	-170.4	0	0	0	0	0	114	A565 E604	A565-G585 WeakPolarHBondContact CA-O 3.2Å; A565-G585 WeakPolarHBondContact CB-O 3.27Å; G585-E604 WeakPolarHBondContact CA-O 3.4Å; G585-E604 PolarHBondContact N-O 2.82Å
586	T	63.7	Low	63.9	Low	0 Å²	0	37.9 Å²	37.9	0%	0	20%	0.195	C	C	.	.	P	Polyproline II helix	trans	-73.9	130.5	170.1	-56	0	0	0	0	110	A566 K568 N578 N588 A606	A566-T586 HydrophobicContact CB-CG2 4.43Å; A566-T586 CarbonylContact O-C 3.57Å; A566-T586 VanDerWaalsContact O-CA 3.26Å; A566-T586 WeakPolarHBondContact O-CA 3.41Å; A566-T586 WeakPolarHBondContact O-CG2 3.49Å; K568-T586 HydrophobicContact CD-CG2 4.14Å; K568-T586 HydrophobicContact CG-CG2 3.89Å; N578-T586 PolarHBondContact ND2-OG1 2.88Å; T586-N588 WeakPolarHBondContact CG2-OD1 3.32Å; T586-A606 WeakPolarHBondContact O-CA 3.48Å; T586-A606 WeakPolarHBondContact O-CB 3.46Å
587	S	62.8	Low	64	Low	22 Å²	22	41.5 Å²	41.5	15%	0.154	21%	0.211	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-91	120.3	171.5	-171.4	0	0	0	0	110.1	A566 K568 Q607	A566-S587 PolarHBondContact O-N 2.93Å; K568-S587 PolarHBondContact N-O 2.96Å; S587-Q607 CarbonylContact C-O 3.46Å; S587-Q607 WeakPolarHBondContact CA-O 3Å
588	N	62	Low	64.2	Low	3 Å²	3	38.5 Å²	38.5	2%	0.016	20%	0.197	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-113	116.6	-177.5	-61.4	-48.7	0	0	0	110.4	K568 I573 T586 E594 Q607 N608 Q609	K568-N588 WeakPolarHBondContact CD-OD1 3.41Å; I573-N588 HydrophobicContact CD1-CB 4.35Å; T586-N588 WeakPolarHBondContact CG2-OD1 3.32Å; N588-E594 PolarHBondContact ND2-O 3.02Å; N588-Q607 PolarHBondContact N-O 2.63Å; N588-N608 WeakPolarHBondContact CB-OD1 3.36Å; N588-N608 PolarHBondContact ND2-OD1 3Å; N588-N608 WeakPolarHBondContact O-CA 3.48Å; N588-Q609 PolarHBondContact O-N 2.87Å
589	Q	61.6	Low	64.1	Low	75 Å²	75	41.9 Å²	41.9	35%	0.35	21%	0.213	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-105.2	125.4	169.3	-64.7	177.6	-32.9	0	0	109.3	K568 Q569 D570 Q609	K568-Q589 PolarHBondContact O-N 2.93Å; Q569-Q589 CarbonylContact C-O 3.47Å; Q569-Q589 WeakPolarHBondContact CA-O 3.25Å; Q569-Q589 HydrophobicContact CG-CB 4.31Å; D570-Q589 PolarHBondContact N-O 3.02Å; Q589-Q609 WeakPolarHBondContact CA-O 3.28Å; Q589-Q609 HydrophobicContact CG-CB 4.4Å; Q589-Q609 VanDerWaalsContact NE2-OE1 3.14Å
590	G	61.5	Low	64.1	Low	28 Å²	28	39.2 Å²	39.2	29%	0.289	21%	0.206	S	C	.	.	E	Extended strand (participates in β ladder)	trans	179	-171	-176.2	0	0	0	0	0	119.4	D570 Q609 G610	D570-G590 WeakPolarHBondContact O-CA 2.99Å; G590-Q609 PolarHBondContact N-O 3.49Å; G590-G610 WeakPolarHBondContact O-CA 3.32Å
591	K	63	Low	64.2	Low	123 Å²	123	44 Å²	44	54%	0.535	22%	0.22	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-84.4	-49.8	173.4	-70.6	-172.7	-179.9	-175.3	0	111.8	D570 K571 K611 K612	D570-K591 PolarHBondContact O-N 2.89Å; K571-K591 WeakPolarHBondContact O-CB 3.47Å; K591-K611 WeakPolarHBondContact O-CB 3.28Å; K591-K611 PolarHBondContact O-N 3.07Å; K591-K612 PolarHBondContact O-N 3.01Å
592	K	63.2	Low	64.5	Low	47 Å²	47	40.7 Å²	40.7	20%	0.204	21%	0.206	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.4	129.2	163.7	-160.6	-144.1	-176	-155.5	0	109	K571 K572 I573 E594 K612 E614	K571-K592 PolarHBondContact O-N 2.63Å; K572-K592 WeakPolarHBondContact CA-O 3.36Å; K572-K592 HydrophobicContact CG-CB 4.1Å; K572-K592 HydrophobicContact CG-CD 4.04Å; I573-K592 PolarHBondContact N-O 2.96Å; K592-E594 IonicContact NZ-OE1 2.77Å; K592-E594 PolarHBondContact NZ-OE1 3.35Å; K592-K612 WeakPolarHBondContact CA-O 3.45Å; K592-K612 HydrophobicContact CG-CB 4.05Å; K592-K612 HydrophobicContact CG-CD 4.2Å; K592-E614 WeakPolarHBondContact CE-OE1 3.42Å; K592-E614 IonicContact NZ-OE1 2.64Å; K592-E614 PolarHBondContact NZ-OE1 3.47Å; K592-E614 IonicContact NZ-OE2 2.65Å
593	G	62.3	Low	64.4	Low	6 Å²	6	35.8 Å²	35.8	6%	0.062	18%	0.184	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	136.8	171.1	0	0	0	0	0	111.5	K612 G613 E614	G593-K612 PolarHBondContact N-O 2.9Å; G593-K612 VanDerWaalsContact N-O 3.08Å; G593-G613 WeakPolarHBondContact O-CA 3.33Å; G593-E614 PolarHBondContact O-N 2.81Å
594	E	65.1	Low	64.7	Low	37 Å²	37	37.8 Å²	37.8	17%	0.173	19%	0.193	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-104.9	139.3	171.1	-74.3	163.1	-142.9	0	0	109.6	E574 G575 N588 K592 E614	E574-E594 VanDerWaalsContact CA-OE2 3.22Å; E574-E594 WeakPolarHBondContact CA-OE2 3.44Å; G575-E594 PolarHBondContact N-OE2 2.83Å; G575-E594 VanDerWaalsContact N-OE2 3.09Å; N588-E594 PolarHBondContact ND2-O 3.02Å; K592-E594 IonicContact NZ-OE1 2.77Å; K592-E594 PolarHBondContact NZ-OE1 3.35Å; E594-E614 HydrophobicContact CG-CB 4.41Å
595	G	63.9	Low	64.8	Low	8 Å²	8	37.1 Å²	37.1	8%	0.082	19%	0.194	C	C	.	.			trans	-65.1	165.5	-178.4	0	0	0	0	0	113.3	E614	G595-E614 WeakPolarHBondContact CA-O 3.25Å; G595-E614 PolarHBondContact N-O 3.47Å
596	A	68.6	Low	65.1	Low	1 Å²	1	36.7 Å²	36.7	1%	0.008	19%	0.19	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-80.3	144	173.5	0	0	0	0	0	111.6	A576 N578 N598 A616 Q617	A576-A596 HydrophobicContact CB-CB 4.09Å; A576-A596 CarbonylContact O-C 3.55Å; A576-A596 WeakPolarHBondContact O-CA 3.3Å; N578-A596 WeakPolarHBondContact ND2-CB 3.5Å; A596-N598 WeakPolarHBondContact CB-OD1 3.49Å; A596-A616 CarbonylContact O-C 3.54Å; A596-A616 VanDerWaalsContact O-CA 3.28Å; A596-A616 WeakPolarHBondContact O-CA 3.41Å; A596-A616 VanDerWaalsContact O-CB 3.25Å; A596-A616 WeakPolarHBondContact O-CB 3.31Å; A596-Q617 PolarHBondContact O-N 3Å
597	Q	67.6	Low	65.2	Low	76 Å²	76	41 Å²	41	36%	0.355	21%	0.21	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-85.3	113.7	159.4	-61.2	-174.1	-43.4	0	0	108.6	A576 Q577 N578 Q617	A576-Q597 PolarHBondContact O-N 3.04Å; Q577-Q597 CarbonylContact C-O 3.56Å; Q577-Q597 WeakPolarHBondContact CA-O 2.76Å; Q577-Q597 HydrophobicContact CG-CB 4.31Å; N578-Q597 PolarHBondContact N-O 3.05Å; Q597-Q617 CarbonylContact C-O 3.59Å; Q597-Q617 VanDerWaalsContact CA-O 3.32Å; Q597-Q617 WeakPolarHBondContact CA-O 3.34Å; Q597-Q617 HydrophobicContact CG-CB 4.31Å
598	N	68.6	Low	65.4	Low	0 Å²	0	40 Å²	40	0%	0	20%	0.204	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-111.2	120.6	-179	-58.1	-41.2	0	0	0	110.2	N578 P583 A596 E604 Q617 N618 Q619	N578-N598 WeakPolarHBondContact CB-OD1 3.33Å; N578-N598 PolarHBondContact ND2-OD1 3.45Å; N578-N598 CarbonylContact O-C 3.27Å; N578-N598 WeakPolarHBondContact O-CA 3.49Å; P583-N598 HydrophobicContact CB-CB 4.37Å; P583-N598 HydrophobicContact CG-CB 4.2Å; A596-N598 WeakPolarHBondContact CB-OD1 3.49Å; N598-E604 PolarHBondContact ND2-O 3.28Å; N598-Q617 PolarHBondContact N-O 2.78Å; N598-N618 WeakPolarHBondContact CB-OD1 3.29Å; N598-N618 PolarHBondContact ND2-OD1 2.9Å; N598-N618 WeakPolarHBondContact O-CA 2.9Å; N598-Q619 PolarHBondContact O-N 2.87Å
599	Q	67.3	Low	65.5	Low	81 Å²	81	43.6 Å²	43.6	38%	0.379	22%	0.22	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	117.9	180	-68.1	-179.1	-21.7	0	0	110.8	N578 Q579 G580 Q619	N578-Q599 PolarHBondContact O-N 3.44Å; Q579-Q599 WeakPolarHBondContact CA-O 3.46Å; Q579-Q599 HydrophobicContact CG-CB 4.4Å; G580-Q599 PolarHBondContact N-O 3Å; Q599-Q619 WeakPolarHBondContact CA-O 3.38Å; Q599-Q619 HydrophobicContact CG-CB 4.34Å
600	G	65.6	Low	65.6	Low	21 Å²	21	41.3 Å²	41.3	22%	0.216	22%	0.217	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-178.2	-161.8	-178.8	0	0	0	0	0	118.1	G580 Q619 G620	G580-G600 WeakPolarHBondContact O-CA 3.36Å; G600-Q619 PolarHBondContact N-O 3.42Å; G600-G620 WeakPolarHBondContact O-CA 3.16Å
601	K	66.8	Low	65.9	Low	125 Å²	125	45.7 Å²	45.7	54%	0.543	23%	0.228	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-88.1	-41.1	176.8	-65	-168.7	178	-172.9	0	112	K581 K621 K622	K581-K601 WeakPolarHBondContact O-CA 3.4Å; K581-K601 WeakPolarHBondContact O-CB 3.36Å; K581-K601 PolarHBondContact O-N 2.84Å; K601-K621 WeakPolarHBondContact O-CA 3.34Å; K601-K621 WeakPolarHBondContact O-CB 3.31Å; K601-K621 PolarHBondContact O-N 2.93Å; K601-K622 PolarHBondContact O-N 2.83Å
602	K	68	Low	66.1	Low	51 Å²	51	42.6 Å²	42.6	22%	0.222	21%	0.214	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-124.4	115.9	163.7	-168.3	-154.7	-173.6	-140.5	0	107.3	K581 K582 P583 E604 K622 E624	K581-K602 PolarHBondContact O-N 3.33Å; K581-K602 VanDerWaalsContact O-N 3.09Å; K582-K602 WeakPolarHBondContact CA-O 3.44Å; K582-K602 HydrophobicContact CG-CB 4.27Å; P583-K602 VanDerWaalsContact CD-O 3.29Å; P583-K602 WeakPolarHBondContact CD-O 3.34Å; K602-E604 HydrophobicContact CD-CG 4.37Å; K602-E604 WeakPolarHBondContact CD-OE1 3.34Å; K602-E604 WeakPolarHBondContact CE-OE1 3.27Å; K602-E604 IonicContact NZ-OE1 2.73Å; K602-E604 PolarHBondContact NZ-OE1 3.06Å; K602-E604 IonicContact NZ-OE2 3.29Å; K602-K622 CarbonylContact C-O 3.55Å; K602-K622 WeakPolarHBondContact CA-O 2.99Å; K602-K622 HydrophobicContact CG-CB 4.11Å; K602-K622 HydrophobicContact CG-CD 4.25Å; K602-K622 HydrophobicContact CG-CG 4.33Å; K602-E624 VanDerWaalsContact CE-CD 3.45Å; K602-E624 WeakPolarHBondContact CE-OE1 3.27Å; K602-E624 IonicContact NZ-OE1 2.65Å; K602-E624 PolarHBondContact NZ-OE1 2.82Å; K602-E624 IonicContact NZ-OE2 2.59Å; K602-E624 PolarHBondContact NZ-OE2 3.23Å
603	G	64.3	Low	66.2	Low	0 Å²	0	40.6 Å²	40.6	0%	0	21%	0.207	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	144.1	171.9	0	0	0	0	0	110.9	P583 K622 G623 E624	P583-G603 WeakPolarHBondContact O-CA 3.12Å; G603-K622 PolarHBondContact N-O 3.27Å; G603-G623 CarbonylContact O-C 3.58Å; G603-G623 WeakPolarHBondContact O-CA 3.44Å; G603-E624 PolarHBondContact O-N 3.43Å
604	E	68.3	Low	66.5	Low	50 Å²	50	42.2 Å²	42.2	23%	0.234	21%	0.213	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	136.4	179.8	-57.2	175.2	-153.2	0	0	109.8	P583 G585 N598 K602	P583-E604 PolarHBondContact O-N 3.25Å; G585-E604 WeakPolarHBondContact CA-O 3.4Å; G585-E604 PolarHBondContact N-O 2.82Å; N598-E604 PolarHBondContact ND2-O 3.28Å; K602-E604 HydrophobicContact CD-CG 4.37Å; K602-E604 WeakPolarHBondContact CD-OE1 3.34Å; K602-E604 WeakPolarHBondContact CE-OE1 3.27Å; K602-E604 IonicContact NZ-OE1 2.73Å; K602-E604 PolarHBondContact NZ-OE1 3.06Å; K602-E604 IonicContact NZ-OE2 3.29Å
605	G	65.2	Low	66.6	Low	17 Å²	17	41.1 Å²	41.1	18%	0.175	21%	0.212	C	C	.	.	P	Polyproline II helix	trans	-70.4	156	-169.4	0	0	0	0	0	114.4	E624	G605-E624 WeakPolarHBondContact CA-O 3.39Å; G605-E624 PolarHBondContact N-O 2.77Å
606	A	67.5	Low	66.9	Low	0 Å²	0	40.8 Å²	40.8	0%	0	21%	0.208	C	C	.	.	P	Polyproline II helix	trans	-65.3	154.1	171.1	0	0	0	0	0	112	T586 A616 A626 Q627	T586-A606 WeakPolarHBondContact O-CA 3.48Å; T586-A606 WeakPolarHBondContact O-CB 3.46Å; A606-A616 HydrophobicContact CB-CB 3.99Å; A606-A626 CarbonylContact O-C 3.6Å; A606-A626 WeakPolarHBondContact O-CA 3.49Å; A606-A626 WeakPolarHBondContact O-CB 3.28Å; A606-Q627 PolarHBondContact O-N 2.94Å
607	Q	67.2	Low	67	Low	90 Å²	90	44.3 Å²	44.3	42%	0.421	22%	0.224	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-103.3	125.5	158.2	-71.9	-174.8	-38.5	0	0	108.5	S587 N588 Q627	S587-Q607 CarbonylContact C-O 3.46Å; S587-Q607 WeakPolarHBondContact CA-O 3Å; N588-Q607 PolarHBondContact N-O 2.63Å; Q607-Q627 WeakPolarHBondContact CA-O 3.34Å; Q607-Q627 HydrophobicContact CG-CB 4.36Å
608	N	65.1	Low	67.1	Low	2 Å²	2	40.8 Å²	40.8	1%	0.011	21%	0.208	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-116	119.1	175.5	-66.5	-58.4	0	0	0	109.8	N588 E614 Q627 N628 Q629	N588-N608 WeakPolarHBondContact CB-OD1 3.36Å; N588-N608 PolarHBondContact ND2-OD1 3Å; N588-N608 WeakPolarHBondContact O-CA 3.48Å; N608-E614 PolarHBondContact ND2-O 3.31Å; N608-Q627 PolarHBondContact N-O 2.95Å; N608-N628 WeakPolarHBondContact CB-OD1 3.41Å; N608-N628 PolarHBondContact ND2-OD1 2.87Å; N608-N628 WeakPolarHBondContact O-CA 3.39Å; N608-Q629 PolarHBondContact O-N 2.88Å
609	Q	64.4	Low	67	Low	78 Å²	78	44.9 Å²	44.9	36%	0.364	23%	0.227	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	117.2	175.4	-69.1	177.5	-20.3	0	0	109.7	N588 Q589 G590 Q629	N588-Q609 PolarHBondContact O-N 2.87Å; Q589-Q609 WeakPolarHBondContact CA-O 3.28Å; Q589-Q609 HydrophobicContact CG-CB 4.4Å; Q589-Q609 VanDerWaalsContact NE2-OE1 3.14Å; G590-Q609 PolarHBondContact N-O 3.49Å; Q609-Q629 WeakPolarHBondContact CA-O 3.46Å; Q609-Q629 HydrophobicContact CG-CB 4.46Å
610	G	64.4	Low	67	Low	27 Å²	27	42.2 Å²	42.2	28%	0.278	22%	0.221	S	C	.	.	E	Extended strand (participates in β ladder)	trans	178.6	-162.5	-176.2	0	0	0	0	0	119.1	G590 Q629 G630 K631	G590-G610 WeakPolarHBondContact O-CA 3.32Å; G610-Q629 PolarHBondContact N-O 2.86Å; G610-G630 WeakPolarHBondContact O-CA 3.41Å; G610-K631 PolarHBondContact O-N 3.09Å
611	K	67.3	Low	67.2	Low	120 Å²	120	47 Å²	47	52%	0.522	24%	0.236	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-84.4	-45.2	173.7	-67.4	-170.2	179.2	-172.5	0	111.6	K591 K631 K632	K591-K611 WeakPolarHBondContact O-CB 3.28Å; K591-K611 PolarHBondContact O-N 3.07Å; K611-K631 CarbonylContact O-C 3.56Å; K611-K631 WeakPolarHBondContact O-CA 3.47Å; K611-K631 WeakPolarHBondContact O-CB 3.47Å; K611-K631 PolarHBondContact O-N 3Å; K611-K632 PolarHBondContact O-N 3.01Å
612	K	67.8	Low	67.4	Low	58 Å²	58	43.6 Å²	43.6	25%	0.252	22%	0.221	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.9	131.9	163.8	-158.8	-156.6	-175.5	-160.3	0	109.3	K591 K592 G593 E614 K632 E634	K591-K612 PolarHBondContact O-N 3.01Å; K592-K612 WeakPolarHBondContact CA-O 3.45Å; K592-K612 HydrophobicContact CG-CB 4.05Å; K592-K612 HydrophobicContact CG-CD 4.2Å; G593-K612 PolarHBondContact N-O 2.9Å; G593-K612 VanDerWaalsContact N-O 3.08Å; K612-E614 HydrophobicContact CD-CG 4.38Å; K612-E614 WeakPolarHBondContact CD-OE1 3.38Å; K612-E614 WeakPolarHBondContact CE-OE1 3.49Å; K612-E614 IonicContact NZ-OE1 2.6Å; K612-E614 PolarHBondContact NZ-OE1 2.8Å; K612-K632 WeakPolarHBondContact CA-O 3.43Å; K612-K632 HydrophobicContact CG-CB 4.21Å; K612-E634 WeakPolarHBondContact CE-OE1 3.41Å; K612-E634 IonicContact NZ-OE1 3.66Å; K612-E634 PolarHBondContact NZ-OE1 2.85Å; K612-E634 IonicContact NZ-OE2 2.61Å; K612-E634 PolarHBondContact NZ-OE2 2.88Å
613	G	65.3	Low	67.3	Low	5 Å²	5	41.3 Å²	41.3	5%	0.052	21%	0.212	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	140.8	170.3	0	0	0	0	0	111	G593 K632 G633 E634	G593-G613 WeakPolarHBondContact O-CA 3.33Å; G613-K632 PolarHBondContact N-O 3.38Å; G613-G633 CarbonylContact O-C 3.54Å; G613-G633 WeakPolarHBondContact O-CA 3.32Å; G613-E634 PolarHBondContact O-N 2.73Å
614	E	69	Low	67.6	Low	40 Å²	40	43 Å²	43	19%	0.187	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.5	133.1	178	-54.5	174.5	-158.3	0	0	108.5	K592 G593 E594 G595 N608 K612 E634	K592-E614 WeakPolarHBondContact CE-OE1 3.42Å; K592-E614 IonicContact NZ-OE1 2.64Å; K592-E614 PolarHBondContact NZ-OE1 3.47Å; K592-E614 IonicContact NZ-OE2 2.65Å; G593-E614 PolarHBondContact O-N 2.81Å; E594-E614 HydrophobicContact CG-CB 4.41Å; G595-E614 WeakPolarHBondContact CA-O 3.25Å; G595-E614 PolarHBondContact N-O 3.47Å; N608-E614 PolarHBondContact ND2-O 3.31Å; K612-E614 HydrophobicContact CD-CG 4.38Å; K612-E614 WeakPolarHBondContact CD-OE1 3.38Å; K612-E614 WeakPolarHBondContact CE-OE1 3.49Å; K612-E614 IonicContact NZ-OE1 2.6Å; K612-E614 PolarHBondContact NZ-OE1 2.8Å; E614-E634 HydrophobicContact CB-CB 4.45Å; E614-E634 HydrophobicContact CG-CB 4.31Å; E614-E634 WeakPolarHBondContact CG-OE2 3.49Å
615	G	66.1	Low	67.5	Low	14 Å²	14	41.4 Å²	41.4	14%	0.144	22%	0.217	C	C	.	.			trans	-67.5	164.3	-168.5	0	0	0	0	0	115.3	E634	G615-E634 PolarHBondContact N-O 3.47Å
616	A	71.2	Confident	67.7	Low	0 Å²	0	40.6 Å²	40.6	0%	0	21%	0.209	C	C	.	.			trans	-71.2	154.6	174.3	0	0	0	0	0	112.3	A596 A606 A626 A636 Q637	A596-A616 CarbonylContact O-C 3.54Å; A596-A616 VanDerWaalsContact O-CA 3.28Å; A596-A616 WeakPolarHBondContact O-CA 3.41Å; A596-A616 VanDerWaalsContact O-CB 3.25Å; A596-A616 WeakPolarHBondContact O-CB 3.31Å; A606-A616 HydrophobicContact CB-CB 3.99Å; A616-A626 HydrophobicContact CB-CB 3.96Å; A616-A636 CarbonylContact O-C 3.49Å; A616-A636 VanDerWaalsContact O-CA 3.23Å; A616-A636 WeakPolarHBondContact O-CA 3.34Å; A616-A636 VanDerWaalsContact O-CB 3.27Å; A616-A636 WeakPolarHBondContact O-CB 3.25Å; A616-Q637 PolarHBondContact O-N 3.07Å
617	Q	70.4	Confident	67.8	Low	75 Å²	75	44.1 Å²	44.1	35%	0.35	23%	0.225	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	113	166	-66.8	-177.3	-43.9	0	0	109.1	A596 Q597 N598 Q637	A596-Q617 PolarHBondContact O-N 3Å; Q597-Q617 CarbonylContact C-O 3.59Å; Q597-Q617 VanDerWaalsContact CA-O 3.32Å; Q597-Q617 WeakPolarHBondContact CA-O 3.34Å; Q597-Q617 HydrophobicContact CG-CB 4.31Å; N598-Q617 PolarHBondContact N-O 2.78Å; Q617-Q637 CarbonylContact C-O 3.51Å; Q617-Q637 WeakPolarHBondContact CA-O 3.15Å; Q617-Q637 HydrophobicContact CG-CB 4.35Å
618	N	68.8	Low	67.8	Low	2 Å²	2	39.9 Å²	39.9	1%	0.011	21%	0.205	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	122.9	178.4	-64.4	-58.2	0	0	0	110.8	N598 E624 Q637 N638 Q639	N598-N618 WeakPolarHBondContact CB-OD1 3.29Å; N598-N618 PolarHBondContact ND2-OD1 2.9Å; N598-N618 WeakPolarHBondContact O-CA 2.9Å; N618-E624 PolarHBondContact ND2-O 3.02Å; N618-Q637 PolarHBondContact N-O 2.87Å; N618-N638 WeakPolarHBondContact CB-OD1 3.36Å; N618-N638 PolarHBondContact ND2-OD1 3.29Å; N618-Q639 PolarHBondContact O-N 3.33Å
619	Q	67.9	Low	68	Low	86 Å²	86	43.8 Å²	43.8	40%	0.402	22%	0.223	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-117	120.5	174.1	-69.4	177.5	-23.5	0	0	110.3	N598 Q599 G600 Q639	N598-Q619 PolarHBondContact O-N 2.87Å; Q599-Q619 WeakPolarHBondContact CA-O 3.38Å; Q599-Q619 HydrophobicContact CG-CB 4.34Å; G600-Q619 PolarHBondContact N-O 3.42Å; Q619-Q639 WeakPolarHBondContact CA-O 3.33Å; Q619-Q639 HydrophobicContact CG-CB 4.37Å
620	G	66.8	Low	68.1	Low	25 Å²	25	41.1 Å²	41.1	26%	0.258	22%	0.217	S	C	.	.	E	Extended strand (participates in β ladder)	trans	178	-163.4	-179.1	0	0	0	0	0	118.5	G600 Q639 G640	G600-G620 WeakPolarHBondContact O-CA 3.16Å; G620-Q639 PolarHBondContact N-O 3.11Å; G620-G640 WeakPolarHBondContact O-CA 3.39Å
621	K	69.3	Low	68.4	Low	121 Å²	121	45.5 Å²	45.5	53%	0.526	23%	0.228	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-83.1	-42.8	172.8	-67.9	-170.1	178.3	-171.6	0	111.4	K601 K641 K642	K601-K621 WeakPolarHBondContact O-CA 3.34Å; K601-K621 WeakPolarHBondContact O-CB 3.31Å; K601-K621 PolarHBondContact O-N 2.93Å; K621-K641 CarbonylContact O-C 3.55Å; K621-K641 WeakPolarHBondContact O-CA 3.39Å; K621-K641 WeakPolarHBondContact O-CB 3.15Å; K621-K641 PolarHBondContact O-N 2.89Å; K621-K642 PolarHBondContact O-N 2.96Å
622	K	71.1	Confident	68.7	Low	54 Å²	54	42.5 Å²	42.5	24%	0.235	22%	0.215	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	138.8	161.2	-175.9	177.2	-172.7	-169.6	0	109.5	K601 K602 G603 E624 K642 E644	K601-K622 PolarHBondContact O-N 2.83Å; K602-K622 CarbonylContact C-O 3.55Å; K602-K622 WeakPolarHBondContact CA-O 2.99Å; K602-K622 HydrophobicContact CG-CB 4.11Å; K602-K622 HydrophobicContact CG-CD 4.25Å; K602-K622 HydrophobicContact CG-CG 4.33Å; G603-K622 PolarHBondContact N-O 3.27Å; K622-E624 HydrophobicContact CD-CG 4.41Å; K622-E624 WeakPolarHBondContact CD-OE1 3.23Å; K622-E624 WeakPolarHBondContact CE-OE1 3.34Å; K622-E624 IonicContact NZ-OE1 2.77Å; K622-E624 PolarHBondContact NZ-OE1 2.83Å; K622-K642 CarbonylContact C-O 3.49Å; K622-K642 VanDerWaalsContact CA-O 3.26Å; K622-K642 WeakPolarHBondContact CA-O 3.24Å; K622-K642 HydrophobicContact CG-CB 4.35Å; K622-E644 WeakPolarHBondContact CE-OE1 3.2Å; K622-E644 VanDerWaalsContact CE-OE2 3.31Å; K622-E644 WeakPolarHBondContact CE-OE2 3.49Å; K622-E644 IonicContact NZ-OE1 2.62Å; K622-E644 PolarHBondContact NZ-OE1 2.93Å; K622-E644 IonicContact NZ-OE2 2.76Å; K622-E644 PolarHBondContact NZ-OE2 3.14Å
623	G	66.1	Low	68.6	Low	3 Å²	3	39.9 Å²	39.9	3%	0.031	20%	0.204	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	140.5	166.5	0	0	0	0	0	110.6	G603 K642 G643 E644	G603-G623 CarbonylContact O-C 3.58Å; G603-G623 WeakPolarHBondContact O-CA 3.44Å; G623-K642 PolarHBondContact N-O 2.97Å; G623-G643 CarbonylContact O-C 3.56Å; G623-G643 WeakPolarHBondContact O-CA 3.35Å; G623-E644 PolarHBondContact O-N 2.81Å
624	E	69.9	Low	68.8	Low	37 Å²	37	41.2 Å²	41.2	17%	0.173	21%	0.209	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-118.5	132.4	175.9	-62.8	172.2	-170.9	0	0	108.6	K602 G603 G605 N618 K622 E644	K602-E624 VanDerWaalsContact CE-CD 3.45Å; K602-E624 WeakPolarHBondContact CE-OE1 3.27Å; K602-E624 IonicContact NZ-OE1 2.65Å; K602-E624 PolarHBondContact NZ-OE1 2.82Å; K602-E624 IonicContact NZ-OE2 2.59Å; K602-E624 PolarHBondContact NZ-OE2 3.23Å; G603-E624 PolarHBondContact O-N 3.43Å; G605-E624 WeakPolarHBondContact CA-O 3.39Å; G605-E624 PolarHBondContact N-O 2.77Å; N618-E624 PolarHBondContact ND2-O 3.02Å; K622-E624 HydrophobicContact CD-CG 4.41Å; K622-E624 WeakPolarHBondContact CD-OE1 3.23Å; K622-E624 WeakPolarHBondContact CE-OE1 3.34Å; K622-E624 IonicContact NZ-OE1 2.77Å; K622-E624 PolarHBondContact NZ-OE1 2.83Å; E624-E644 HydrophobicContact CB-CB 4.4Å; E624-E644 HydrophobicContact CG-CB 4.18Å
625	G	66.1	Low	68.7	Low	16 Å²	16	40.3 Å²	40.3	17%	0.165	21%	0.21	C	C	.	.			trans	-69.5	161.8	-168.7	0	0	0	0	0	115.4	N638 E644 G645	G625-N638 WeakPolarHBondContact CA-ND2 3.32Å; G625-E644 PolarHBondContact N-O 2.83Å; G625-E644 VanDerWaalsContact N-O 3.14Å; G625-G645 WeakPolarHBondContact CA-O 2.99Å; G625-G645 PolarHBondContact N-O 2.95Å
626	A	69.9	Low	69	Low	0 Å²	0	39.7 Å²	39.7	0%	0	20%	0.204	C	C	.	.			trans	-76.8	159.4	174.7	0	0	0	0	0	112.1	A606 A616 A636 A646 Q647	A606-A626 CarbonylContact O-C 3.6Å; A606-A626 WeakPolarHBondContact O-CA 3.49Å; A606-A626 WeakPolarHBondContact O-CB 3.28Å; A616-A626 HydrophobicContact CB-CB 3.96Å; A626-A636 HydrophobicContact CB-CB 3.85Å; A626-A646 CarbonylContact O-C 3.57Å; A626-A646 VanDerWaalsContact O-CA 3.24Å; A626-A646 WeakPolarHBondContact O-CA 3.5Å; A626-A646 VanDerWaalsContact O-CB 3.3Å; A626-A646 WeakPolarHBondContact O-CB 2.72Å; A626-Q647 PolarHBondContact O-N 3.26Å
627	Q	69.9	Low	69	Low	73 Å²	73	43 Å²	43	34%	0.341	22%	0.219	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-111.8	124.1	164.4	-63.3	-179.4	-47.3	0	0	109.8	A606 Q607 N608 Q647	A606-Q627 PolarHBondContact O-N 2.94Å; Q607-Q627 WeakPolarHBondContact CA-O 3.34Å; Q607-Q627 HydrophobicContact CG-CB 4.36Å; N608-Q627 PolarHBondContact N-O 2.95Å; Q627-Q647 CarbonylContact C-O 3.28Å; Q627-Q647 VanDerWaalsContact CA-O 3.32Å; Q627-Q647 WeakPolarHBondContact CA-O 3.37Å; Q627-Q647 HydrophobicContact CG-CB 4.32Å
628	N	67.5	Low	69	Low	1 Å²	1	39.5 Å²	39.5	1%	0.005	20%	0.203	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-113.6	119.8	174.6	-60.7	-73.8	0	0	0	110.4	N608 E634 Q647 N648 Q649	N608-N628 WeakPolarHBondContact CB-OD1 3.41Å; N608-N628 PolarHBondContact ND2-OD1 2.87Å; N608-N628 WeakPolarHBondContact O-CA 3.39Å; N628-E634 PolarHBondContact ND2-O 2.97Å; N628-Q647 PolarHBondContact N-O 2.84Å; N628-N648 WeakPolarHBondContact CB-OD1 3.45Å; N628-N648 PolarHBondContact ND2-OD1 2.88Å; N628-Q649 PolarHBondContact O-N 2.94Å
629	Q	67.8	Low	69	Low	84 Å²	84	43.3 Å²	43.3	39%	0.393	22%	0.221	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-117.3	118.8	175.7	-68.8	179.9	-25.6	0	0	110.1	N608 Q609 G610 Q649	N608-Q629 PolarHBondContact O-N 2.88Å; Q609-Q629 WeakPolarHBondContact CA-O 3.46Å; Q609-Q629 HydrophobicContact CG-CB 4.46Å; G610-Q629 PolarHBondContact N-O 2.86Å; Q629-Q649 WeakPolarHBondContact CA-O 3.35Å; Q629-Q649 HydrophobicContact CG-CB 4.3Å
630	G	66.6	Low	69	Low	22 Å²	22	40.2 Å²	40.2	23%	0.227	21%	0.212	C	C	.	.	E	Extended strand (participates in β ladder)	trans	178.9	-163.4	-178.5	0	0	0	0	0	118.9	G610 Q649 G650 K651	G610-G630 WeakPolarHBondContact O-CA 3.41Å; G630-Q649 PolarHBondContact N-O 2.77Å; G630-G650 WeakPolarHBondContact O-CA 3.44Å; G630-K651 PolarHBondContact O-N 2.73Å
631	K	71.6	Confident	69.1	Low	120 Å²	120	44.8 Å²	44.8	52%	0.522	23%	0.225	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-83.6	-40.5	175.3	-68	-169.3	179	-171.9	0	112.1	G610 K611 K651 K652	G610-K631 PolarHBondContact O-N 3.09Å; K611-K631 CarbonylContact O-C 3.56Å; K611-K631 WeakPolarHBondContact O-CA 3.47Å; K611-K631 WeakPolarHBondContact O-CB 3.47Å; K611-K631 PolarHBondContact O-N 3Å; K631-K651 WeakPolarHBondContact O-CB 3.32Å; K631-K651 PolarHBondContact O-N 2.87Å; K631-K652 PolarHBondContact O-N 2.88Å
632	K	72.6	Confident	69.2	Low	57 Å²	57	41.8 Å²	41.8	25%	0.248	21%	0.212	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-123	131.9	160.4	-165.9	-168.4	-173.5	-162	0	109.2	K611 K612 G613 E634 K652 E654	K611-K632 PolarHBondContact O-N 3.01Å; K612-K632 WeakPolarHBondContact CA-O 3.43Å; K612-K632 HydrophobicContact CG-CB 4.21Å; G613-K632 PolarHBondContact N-O 3.38Å; K632-E634 HydrophobicContact CD-CG 4.44Å; K632-E634 WeakPolarHBondContact CD-OE1 3.05Å; K632-E634 VanDerWaalsContact CE-OE1 3.23Å; K632-E634 WeakPolarHBondContact CE-OE1 3.36Å; K632-E634 IonicContact NZ-OE1 2.63Å; K632-E634 PolarHBondContact NZ-OE1 3.06Å; K632-K652 CarbonylContact C-O 3.32Å; K632-K652 VanDerWaalsContact CA-O 3.3Å; K632-K652 WeakPolarHBondContact CA-O 2.99Å; K632-K652 HydrophobicContact CB-CB 4.42Å; K632-K652 HydrophobicContact CG-CB 4.05Å; K632-E654 WeakPolarHBondContact CE-OE1 3.39Å; K632-E654 IonicContact NZ-OE1 3.42Å; K632-E654 PolarHBondContact NZ-OE1 2.92Å; K632-E654 IonicContact NZ-OE2 3.1Å; K632-E654 PolarHBondContact NZ-OE2 3.35Å
633	G	66.6	Low	69	Low	2 Å²	2	39.3 Å²	39.3	2%	0.021	20%	0.202	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	150.3	166.4	0	0	0	0	0	111.2	G613 K652 G653 E654	G613-G633 CarbonylContact O-C 3.54Å; G613-G633 WeakPolarHBondContact O-CA 3.32Å; G633-K652 PolarHBondContact N-O 2.59Å; G633-G653 CarbonylContact O-C 3.47Å; G633-G653 VanDerWaalsContact O-CA 3.28Å; G633-G653 WeakPolarHBondContact O-CA 3.33Å; G633-E654 PolarHBondContact O-N 3.15Å
634	E	69.9	Low	69.2	Low	34 Å²	34	40.9 Å²	40.9	16%	0.159	21%	0.208	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	142.4	172.8	-59.3	175.2	-173.6	0	0	108.3	K612 G613 E614 G615 N628 K632 N648 E654	K612-E634 WeakPolarHBondContact CE-OE1 3.41Å; K612-E634 IonicContact NZ-OE1 3.66Å; K612-E634 PolarHBondContact NZ-OE1 2.85Å; K612-E634 IonicContact NZ-OE2 2.61Å; K612-E634 PolarHBondContact NZ-OE2 2.88Å; G613-E634 PolarHBondContact O-N 2.73Å; E614-E634 HydrophobicContact CB-CB 4.45Å; E614-E634 HydrophobicContact CG-CB 4.31Å; E614-E634 WeakPolarHBondContact CG-OE2 3.49Å; G615-E634 PolarHBondContact N-O 3.47Å; N628-E634 PolarHBondContact ND2-O 2.97Å; K632-E634 HydrophobicContact CD-CG 4.44Å; K632-E634 WeakPolarHBondContact CD-OE1 3.05Å; K632-E634 VanDerWaalsContact CE-OE1 3.23Å; K632-E634 WeakPolarHBondContact CE-OE1 3.36Å; K632-E634 IonicContact NZ-OE1 2.63Å; K632-E634 PolarHBondContact NZ-OE1 3.06Å; E634-N648 VanDerWaalsContact C-ND2 3.32Å; E634-N648 PolarHBondContact O-ND2 2.92Å; E634-E654 HydrophobicContact CG-CB 4.4Å; E634-E654 WeakPolarHBondContact CG-OE2 3.46Å
635	G	66.7	Low	69	Low	20 Å²	20	40.4 Å²	40.4	21%	0.206	21%	0.213	C	C	.	.			trans	-67.5	159.3	-166.2	0	0	0	0	0	115.9	N648 E654 G655	G635-N648 WeakPolarHBondContact CA-ND2 3.26Å; G635-N648 PolarHBondContact N-ND2 3.44Å; G635-E654 PolarHBondContact N-O 2.91Å; G635-G655 VanDerWaalsContact CA-O 3.31Å; G635-G655 WeakPolarHBondContact CA-O 2.92Å; G635-G655 PolarHBondContact N-O 3.16Å
636	A	72.1	Confident	69.3	Low	1 Å²	1	39.7 Å²	39.7	1%	0.008	21%	0.206	C	C	.	.			trans	-77.4	160.3	166.2	0	0	0	0	0	111.3	A616 A626 A646 A656 Q657	A616-A636 CarbonylContact O-C 3.49Å; A616-A636 VanDerWaalsContact O-CA 3.23Å; A616-A636 WeakPolarHBondContact O-CA 3.34Å; A616-A636 VanDerWaalsContact O-CB 3.27Å; A616-A636 WeakPolarHBondContact O-CB 3.25Å; A626-A636 HydrophobicContact CB-CB 3.85Å; A636-A646 HydrophobicContact CB-CB 3.52Å; A636-A656 WeakPolarHBondContact O-CA 3.3Å; A636-A656 WeakPolarHBondContact O-CB 3.46Å; A636-Q657 PolarHBondContact O-N 3.19Å
637	Q	72	Confident	69.3	Low	70 Å²	70	42.9 Å²	42.9	33%	0.327	22%	0.221	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	123.3	166.4	-63.4	178.2	-47.8	0	0	109.8	A616 Q617 N618 Q657	A616-Q637 PolarHBondContact O-N 3.07Å; Q617-Q637 CarbonylContact C-O 3.51Å; Q617-Q637 WeakPolarHBondContact CA-O 3.15Å; Q617-Q637 HydrophobicContact CG-CB 4.35Å; N618-Q637 PolarHBondContact N-O 2.87Å; Q637-Q657 CarbonylContact C-O 3.53Å; Q637-Q657 VanDerWaalsContact CA-O 3.31Å; Q637-Q657 WeakPolarHBondContact CA-O 3.34Å; Q637-Q657 HydrophobicContact CG-CB 4.34Å
638	N	69.4	Low	69.3	Low	1 Å²	1	39.6 Å²	39.6	1%	0.005	21%	0.205	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-111.2	127.6	172.2	-65.4	-79.6	0	0	0	110.1	N618 G625 E644 Q657 N658 Q659	N618-N638 WeakPolarHBondContact CB-OD1 3.36Å; N618-N638 PolarHBondContact ND2-OD1 3.29Å; G625-N638 WeakPolarHBondContact CA-ND2 3.32Å; N638-E644 PolarHBondContact ND2-O 2.76Å; N638-Q657 PolarHBondContact N-O 2.92Å; N638-N658 WeakPolarHBondContact CB-OD1 3.43Å; N638-N658 PolarHBondContact ND2-OD1 2.9Å; N638-N658 CarbonylContact O-C 3.49Å; N638-Q659 PolarHBondContact O-N 3.21Å
639	Q	69.3	Low	69.4	Low	83 Å²	83	43 Å²	43	39%	0.388	22%	0.221	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.5	114.8	174.6	-71.1	178.4	-24.5	0	0	109.9	N618 Q619 G620 Q659	N618-Q639 PolarHBondContact O-N 3.33Å; Q619-Q639 WeakPolarHBondContact CA-O 3.33Å; Q619-Q639 HydrophobicContact CG-CB 4.37Å; G620-Q639 PolarHBondContact N-O 3.11Å; Q639-Q659 WeakPolarHBondContact CA-O 3.15Å; Q639-Q659 HydrophobicContact CG-CB 4.26Å; Q639-Q659 VanDerWaalsContact NE2-OE1 3.11Å
640	G	67.7	Low	69.5	Low	21 Å²	21	40 Å²	40	22%	0.216	21%	0.214	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-178.3	-166.8	179.8	0	0	0	0	0	118.4	G620 Q659 G660 K661	G620-G640 WeakPolarHBondContact O-CA 3.39Å; G640-Q659 PolarHBondContact N-O 3.18Å; G640-G660 CarbonylContact O-C 3.57Å; G640-G660 WeakPolarHBondContact O-CA 3.3Å; G640-K661 PolarHBondContact O-N 2.86Å
641	K	69.9	Low	69.8	Low	120 Å²	120	44.9 Å²	44.9	52%	0.522	23%	0.229	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-81.6	-42.7	175.6	-66.3	-169.2	179.3	-171.4	0	112	K621 K661 K662	K621-K641 CarbonylContact O-C 3.55Å; K621-K641 WeakPolarHBondContact O-CA 3.39Å; K621-K641 WeakPolarHBondContact O-CB 3.15Å; K621-K641 PolarHBondContact O-N 2.89Å; K641-K661 WeakPolarHBondContact O-CB 3.3Å; K641-K661 PolarHBondContact O-N 3.44Å; K641-K662 PolarHBondContact O-N 2.89Å
642	K	71.6	Confident	70	Confident	58 Å²	58	44.9 Å²	44.9	25%	0.252	23%	0.229	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	129.1	160.9	-167.3	-175.8	-175.8	-160	0	109.8	K621 K622 G623 E644 K662 E664	K621-K642 PolarHBondContact O-N 2.96Å; K622-K642 CarbonylContact C-O 3.49Å; K622-K642 VanDerWaalsContact CA-O 3.26Å; K622-K642 WeakPolarHBondContact CA-O 3.24Å; K622-K642 HydrophobicContact CG-CB 4.35Å; G623-K642 PolarHBondContact N-O 2.97Å; K642-E644 WeakPolarHBondContact CD-OE1 3.39Å; K642-E644 WeakPolarHBondContact CE-OE1 3.35Å; K642-E644 IonicContact NZ-OE1 2.72Å; K642-E644 PolarHBondContact NZ-OE1 3Å; K642-K662 CarbonylContact C-O 3.57Å; K642-K662 VanDerWaalsContact CA-O 3.22Å; K642-K662 WeakPolarHBondContact CA-O 3.36Å; K642-K662 HydrophobicContact CG-CB 4.29Å; K642-E664 WeakPolarHBondContact CE-OE1 3.49Å; K642-E664 VanDerWaalsContact NZ-CD 3.32Å; K642-E664 IonicContact NZ-OE1 2.69Å; K642-E664 PolarHBondContact NZ-OE1 3.35Å; K642-E664 IonicContact NZ-OE2 3.25Å; K642-E664 PolarHBondContact NZ-OE2 2.77Å
643	G	66	Low	69.7	Low	3 Å²	3	42.3 Å²	42.3	3%	0.031	22%	0.218	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-105.9	157.9	162.8	0	0	0	0	0	111.7	G623 K662 G663 E664	G623-G643 CarbonylContact O-C 3.56Å; G623-G643 WeakPolarHBondContact O-CA 3.35Å; G643-K662 PolarHBondContact N-O 3.32Å; G643-G663 CarbonylContact O-C 2.97Å; G643-G663 VanDerWaalsContact O-CA 3.29Å; G643-G663 WeakPolarHBondContact O-CA 3.35Å; G643-E664 PolarHBondContact O-N 2.94Å
644	E	69.5	Low	69.9	Low	36 Å²	36	44.6 Å²	44.6	17%	0.168	23%	0.228	C	C	.	.			trans	-132.4	151	169.2	-101	144.2	-117.8	0	0	110	K622 G623 E624 G625 N638 K642 N658 E664	K622-E644 WeakPolarHBondContact CE-OE1 3.2Å; K622-E644 VanDerWaalsContact CE-OE2 3.31Å; K622-E644 WeakPolarHBondContact CE-OE2 3.49Å; K622-E644 IonicContact NZ-OE1 2.62Å; K622-E644 PolarHBondContact NZ-OE1 2.93Å; K622-E644 IonicContact NZ-OE2 2.76Å; K622-E644 PolarHBondContact NZ-OE2 3.14Å; G623-E644 PolarHBondContact O-N 2.81Å; E624-E644 HydrophobicContact CB-CB 4.4Å; E624-E644 HydrophobicContact CG-CB 4.18Å; G625-E644 PolarHBondContact N-O 2.83Å; G625-E644 VanDerWaalsContact N-O 3.14Å; N638-E644 PolarHBondContact ND2-O 2.76Å; K642-E644 WeakPolarHBondContact CD-OE1 3.39Å; K642-E644 WeakPolarHBondContact CE-OE1 3.35Å; K642-E644 IonicContact NZ-OE1 2.72Å; K642-E644 PolarHBondContact NZ-OE1 3Å; E644-N658 PolarHBondContact O-ND2 3.45Å; E644-E664 CarbonylContact C-O 3.58Å; E644-E664 HydrophobicContact CG-CB 4.13Å; E644-E664 VanDerWaalsContact CG-OE2 3.25Å; E644-E664 WeakPolarHBondContact CG-OE2 3.33Å
645	G	66	Low	69.8	Low	27 Å²	27	43.9 Å²	43.9	28%	0.278	23%	0.23	S	C	.	.			trans	-59.8	150.1	-167.7	0	0	0	0	0	114.3	G625 E664 G665	G625-G645 WeakPolarHBondContact CA-O 2.99Å; G625-G645 PolarHBondContact N-O 2.95Å; G645-E664 WeakPolarHBondContact CA-O 3.37Å; G645-E664 PolarHBondContact N-O 2.77Å; G645-E664 VanDerWaalsContact N-O 3.14Å; G645-G665 WeakPolarHBondContact CA-O 3.29Å
646	A	72.1	Confident	70.1	Confident	1 Å²	1	43.1 Å²	43.1	1%	0.008	22%	0.222	C	C	.	.			trans	-102.2	146.5	165.3	0	0	0	0	0	109.8	A626 A636 A656 P666 Q667	A626-A646 CarbonylContact O-C 3.57Å; A626-A646 VanDerWaalsContact O-CA 3.24Å; A626-A646 WeakPolarHBondContact O-CA 3.5Å; A626-A646 VanDerWaalsContact O-CB 3.3Å; A626-A646 WeakPolarHBondContact O-CB 2.72Å; A636-A646 HydrophobicContact CB-CB 3.52Å; A646-A656 HydrophobicContact CB-CB 3.8Å; A646-P666 VanDerWaalsContact O-CA 3.3Å; A646-P666 WeakPolarHBondContact O-CA 3.41Å; A646-P666 WeakPolarHBondContact O-CB 3.33Å; A646-Q667 PolarHBondContact O-N 2.89Å
647	Q	71.3	Confident	70.1	Confident	66 Å²	66	46.1 Å²	46.1	31%	0.308	24%	0.236	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.6	125.7	-177.7	-61.5	-178.6	-59.4	0	0	111.4	A626 Q627 N628 Q667	A626-Q647 PolarHBondContact O-N 3.26Å; Q627-Q647 CarbonylContact C-O 3.28Å; Q627-Q647 VanDerWaalsContact CA-O 3.32Å; Q627-Q647 WeakPolarHBondContact CA-O 3.37Å; Q627-Q647 HydrophobicContact CG-CB 4.32Å; N628-Q647 PolarHBondContact N-O 2.84Å; Q647-Q667 WeakPolarHBondContact CA-O 3.35Å; Q647-Q667 HydrophobicContact CG-CB 4.33Å
648	N	68.3	Low	70	Confident	4 Å²	4	42.9 Å²	42.9	2%	0.021	22%	0.221	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-115.1	125.2	176.2	-77.1	3.8	0	0	0	110.1	N628 E634 G635 E654 Q667 Q669	N628-N648 WeakPolarHBondContact CB-OD1 3.45Å; N628-N648 PolarHBondContact ND2-OD1 2.88Å; E634-N648 VanDerWaalsContact C-ND2 3.32Å; E634-N648 PolarHBondContact O-ND2 2.92Å; G635-N648 WeakPolarHBondContact CA-ND2 3.26Å; G635-N648 PolarHBondContact N-ND2 3.44Å; N648-E654 PolarHBondContact ND2-O 2.94Å; N648-Q667 PolarHBondContact N-O 3.29Å; N648-Q669 PolarHBondContact O-N 2.95Å
649	Q	70.1	Confident	70.1	Confident	72 Å²	72	46 Å²	46	34%	0.336	24%	0.235	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	125.3	-179.5	-69.6	179.9	-28	0	0	110.6	N628 Q629 G630 Q669	N628-Q649 PolarHBondContact O-N 2.94Å; Q629-Q649 WeakPolarHBondContact CA-O 3.35Å; Q629-Q649 HydrophobicContact CG-CB 4.3Å; G630-Q649 PolarHBondContact N-O 2.77Å; Q649-Q669 WeakPolarHBondContact CA-O 3.49Å; Q649-Q669 HydrophobicContact CG-CB 4.16Å
650	G	69.9	Low	70.1	Confident	23 Å²	23	43.1 Å²	43.1	24%	0.237	23%	0.228	C	C	.	.	E	Extended strand (participates in β ladder)	trans	174.2	-162.2	-179.9	0	0	0	0	0	120	G630 Q669 A670 K671	G630-G650 WeakPolarHBondContact O-CA 3.44Å; G650-Q669 PolarHBondContact N-O 2.86Å; G650-A670 WeakPolarHBondContact O-CA 3.39Å; G650-K671 PolarHBondContact O-N 2.64Å; G650-K671 VanDerWaalsContact O-N 3.15Å
651	K	73.9	Confident	70.2	Confident	124 Å²	124	47.7 Å²	47.7	54%	0.539	24%	0.241	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-84.6	-40.8	172.1	-66.7	-163.3	179	-165.2	0	111.9	G630 K631 K671 K672	G630-K651 PolarHBondContact O-N 2.73Å; K631-K651 WeakPolarHBondContact O-CB 3.32Å; K631-K651 PolarHBondContact O-N 2.87Å; K651-K671 CarbonylContact O-C 3.54Å; K651-K671 WeakPolarHBondContact O-CA 3.39Å; K651-K671 WeakPolarHBondContact O-CB 2.92Å; K651-K671 PolarHBondContact O-N 3.29Å; K651-K672 PolarHBondContact O-N 3.14Å
652	K	74.7	Confident	70.2	Confident	120 Å²	120	45.2 Å²	45.2	52%	0.522	23%	0.231	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-124.6	144.9	166.3	-67.1	-170.6	177.3	-171.6	0	108.9	K631 K632 G633 K672	K631-K652 PolarHBondContact O-N 2.88Å; K632-K652 CarbonylContact C-O 3.32Å; K632-K652 VanDerWaalsContact CA-O 3.3Å; K632-K652 WeakPolarHBondContact CA-O 2.99Å; K632-K652 HydrophobicContact CB-CB 4.42Å; K632-K652 HydrophobicContact CG-CB 4.05Å; G633-K652 PolarHBondContact N-O 2.59Å; K652-K672 CarbonylContact C-O 3.46Å; K652-K672 VanDerWaalsContact CA-O 3.27Å; K652-K672 WeakPolarHBondContact CA-O 2.99Å; K652-K672 HydrophobicContact CG-CB 4.41Å
653	G	67.2	Low	70	Confident	3 Å²	3	42.6 Å²	42.6	3%	0.031	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-151.3	125	176.1	0	0	0	0	0	111.4	G633 N668 K672 G673 E674	G633-G653 CarbonylContact O-C 3.47Å; G633-G653 VanDerWaalsContact O-CA 3.28Å; G633-G653 WeakPolarHBondContact O-CA 3.33Å; G653-N668 PolarHBondContact O-ND2 2.65Å; G653-K672 PolarHBondContact N-O 2.77Å; G653-G673 CarbonylContact O-C 3.54Å; G653-G673 VanDerWaalsContact O-CA 3.3Å; G653-G673 WeakPolarHBondContact O-CA 3.5Å; G653-E674 PolarHBondContact O-N 2.79Å
654	E	71.4	Confident	70.1	Confident	49 Å²	49	44.9 Å²	44.9	23%	0.229	23%	0.23	C	C	.	.			trans	-84.1	148.5	164.2	-85.5	122	-110.5	0	0	110.5	K632 G633 E634 G635 N648 E674	K632-E654 WeakPolarHBondContact CE-OE1 3.39Å; K632-E654 IonicContact NZ-OE1 3.42Å; K632-E654 PolarHBondContact NZ-OE1 2.92Å; K632-E654 IonicContact NZ-OE2 3.1Å; K632-E654 PolarHBondContact NZ-OE2 3.35Å; G633-E654 PolarHBondContact O-N 3.15Å; E634-E654 HydrophobicContact CG-CB 4.4Å; E634-E654 WeakPolarHBondContact CG-OE2 3.46Å; G635-E654 PolarHBondContact N-O 2.91Å; N648-E654 PolarHBondContact ND2-O 2.94Å; E654-E674 HydrophobicContact CG-CB 4.1Å; E654-E674 HydrophobicContact CG-CG 4.32Å; E654-E674 VanDerWaalsContact CG-OE2 3.25Å; E654-E674 WeakPolarHBondContact CG-OE2 3.06Å
655	G	66.5	Low	70	Confident	19 Å²	19	43.6 Å²	43.6	20%	0.196	23%	0.226	C	C	.	.			trans	-72.4	168.2	179.7	0	0	0	0	0	113.5	G635 E674 G675	G635-G655 VanDerWaalsContact CA-O 3.31Å; G635-G655 WeakPolarHBondContact CA-O 2.92Å; G635-G655 PolarHBondContact N-O 3.16Å; G655-E674 PolarHBondContact N-O 3.38Å; G655-G675 WeakPolarHBondContact CA-O 3.37Å
656	A	73.4	Confident	70.3	Confident	4 Å²	4	42.3 Å²	42.3	3%	0.033	21%	0.213	C	C	.	.			trans	-107.2	167.5	178.2	0	0	0	0	0	111.6	A636 A646 P666 Q677	A636-A656 WeakPolarHBondContact O-CA 3.3Å; A636-A656 WeakPolarHBondContact O-CB 3.46Å; A646-A656 HydrophobicContact CB-CB 3.8Å; A656-P666 HydrophobicContact CB-CB 3.55Å; A656-P666 HydrophobicContact CB-CG 3.88Å; A656-P666 WeakPolarHBondContact O-CG 3.5Å; A656-Q677 PolarHBondContact O-N 3.04Å
657	Q	72.5	Confident	70.3	Confident	64 Å²	64	44.1 Å²	44.1	30%	0.299	22%	0.222	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	124.6	-175.4	-59.3	-179.9	-49.7	0	0	112.1	A636 Q637 N638 Q677	A636-Q657 PolarHBondContact O-N 3.19Å; Q637-Q657 CarbonylContact C-O 3.53Å; Q637-Q657 VanDerWaalsContact CA-O 3.31Å; Q637-Q657 WeakPolarHBondContact CA-O 3.34Å; Q637-Q657 HydrophobicContact CG-CB 4.34Å; N638-Q657 PolarHBondContact N-O 2.92Å; Q657-Q677 WeakPolarHBondContact CA-O 3.16Å; Q657-Q677 HydrophobicContact CG-CB 4.28Å
658	N	70.4	Confident	70.3	Confident	2 Å²	2	41 Å²	41	1%	0.011	21%	0.207	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	93.5	-177.3	-83.9	13.2	0	0	0	113.5	N638 E644 E664 Q677 N678 Q679 G680	N638-N658 WeakPolarHBondContact CB-OD1 3.43Å; N638-N658 PolarHBondContact ND2-OD1 2.9Å; N638-N658 CarbonylContact O-C 3.49Å; E644-N658 PolarHBondContact O-ND2 3.45Å; N658-E664 PolarHBondContact ND2-O 2.91Å; N658-Q677 PolarHBondContact N-O 2.74Å; N658-N678 PolarHBondContact O-OD1 3.07Å; N658-N678 VanDerWaalsContact O-OD1 3.1Å; N658-Q679 CarbonylContact O-C 3.57Å; N658-Q679 VanDerWaalsContact O-C 3.27Å; N658-Q679 WeakPolarHBondContact O-CA 3.18Å; N658-Q679 PolarHBondContact O-N 2.98Å; N658-G680 PolarHBondContact O-N 3.04Å
659	Q	70.4	Confident	70.6	Confident	67 Å²	67	44 Å²	44	31%	0.313	22%	0.221	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-91.5	135.6	-178.5	-74.8	172.1	-16	0	0	113.4	N638 Q639 G640 Q679	N638-Q659 PolarHBondContact O-N 3.21Å; Q639-Q659 WeakPolarHBondContact CA-O 3.15Å; Q639-Q659 HydrophobicContact CG-CB 4.26Å; Q639-Q659 VanDerWaalsContact NE2-OE1 3.11Å; G640-Q659 PolarHBondContact N-O 3.18Å; Q659-Q679 CarbonylContact C-O 3Å; Q659-Q679 VanDerWaalsContact CA-O 3.32Å; Q659-Q679 WeakPolarHBondContact CA-O 3.48Å; Q659-Q679 HydrophobicContact CB-CB 4.41Å; Q659-Q679 HydrophobicContact CG-CB 3.62Å
660	G	68.6	Low	70.7	Confident	22 Å²	22	40.7 Å²	40.7	23%	0.227	21%	0.206	C	C	.	.	E	Extended strand (participates in β ladder)	trans	169.6	-142.8	176.8	0	0	0	0	0	121.7	G640 Q679 G680 K681	G640-G660 CarbonylContact O-C 3.57Å; G640-G660 WeakPolarHBondContact O-CA 3.3Å; G660-Q679 PolarHBondContact N-O 2.92Å; G660-G680 CarbonylContact O-C 3.52Å; G660-G680 WeakPolarHBondContact O-CA 3.15Å; G660-K681 PolarHBondContact O-N 2.87Å; G660-K681 VanDerWaalsContact O-N 3.15Å
661	K	70.5	Confident	70.8	Confident	117 Å²	117	45.5 Å²	45.5	51%	0.509	22%	0.22	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-112	-46.5	174.1	-67.5	-169.5	-178.6	-172.3	0	113.2	G640 K641 K681 K682	G640-K661 PolarHBondContact O-N 2.86Å; K641-K661 WeakPolarHBondContact O-CB 3.3Å; K641-K661 PolarHBondContact O-N 3.44Å; K661-K681 CarbonylContact O-C 3.19Å; K661-K681 WeakPolarHBondContact O-CA 3.13Å; K661-K681 VanDerWaalsContact O-CB 3.28Å; K661-K681 WeakPolarHBondContact O-CB 2.96Å; K661-K681 PolarHBondContact O-N 3.15Å; K661-K681 VanDerWaalsContact O-N 3.1Å; K661-K682 PolarHBondContact O-N 3.1Å
662	K	70.7	Confident	70.8	Confident	69 Å²	69	42.2 Å²	42.2	30%	0.3	21%	0.206	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-113.3	145.5	155.5	-162.9	-173.5	-179.2	-140	0	108.7	K641 K642 G643 E664 K682 E684	K641-K662 PolarHBondContact O-N 2.89Å; K642-K662 CarbonylContact C-O 3.57Å; K642-K662 VanDerWaalsContact CA-O 3.22Å; K642-K662 WeakPolarHBondContact CA-O 3.36Å; K642-K662 HydrophobicContact CG-CB 4.29Å; G643-K662 PolarHBondContact N-O 3.32Å; K662-E664 IonicContact NZ-OE1 2.82Å; K662-E664 PolarHBondContact NZ-OE1 3.32Å; K662-K682 CarbonylContact C-O 3.54Å; K662-K682 WeakPolarHBondContact CA-O 3.26Å; K662-E684 WeakPolarHBondContact CE-OE2 3.23Å; K662-E684 IonicContact NZ-OE2 2.61Å; K662-E684 PolarHBondContact NZ-OE2 2.93Å
663	G	66.2	Low	70.3	Confident	2 Å²	2	36.5 Å²	36.5	2%	0.021	18%	0.181	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-152.1	121.7	171.7	0	0	0	0	0	112.7	G643 N678 K682 G683 E684	G643-G663 CarbonylContact O-C 2.97Å; G643-G663 VanDerWaalsContact O-CA 3.29Å; G643-G663 WeakPolarHBondContact O-CA 3.35Å; G663-N678 PolarHBondContact O-ND2 2.89Å; G663-K682 PolarHBondContact N-O 3.22Å; G663-K682 VanDerWaalsContact N-O 3.07Å; G663-G683 CarbonylContact O-C 3.55Å; G663-G683 WeakPolarHBondContact O-CA 2.98Å; G663-E684 PolarHBondContact O-N 3.3Å
664	E	69.4	Low	70.5	Confident	51 Å²	51	38.9 Å²	38.9	24%	0.238	19%	0.191	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-78.3	143	163.3	-74.8	130.3	-129	0	0	109.3	K642 G643 E644 G645 N658 K662 E684	K642-E664 WeakPolarHBondContact CE-OE1 3.49Å; K642-E664 VanDerWaalsContact NZ-CD 3.32Å; K642-E664 IonicContact NZ-OE1 2.69Å; K642-E664 PolarHBondContact NZ-OE1 3.35Å; K642-E664 IonicContact NZ-OE2 3.25Å; K642-E664 PolarHBondContact NZ-OE2 2.77Å; G643-E664 PolarHBondContact O-N 2.94Å; E644-E664 CarbonylContact C-O 3.58Å; E644-E664 HydrophobicContact CG-CB 4.13Å; E644-E664 VanDerWaalsContact CG-OE2 3.25Å; E644-E664 WeakPolarHBondContact CG-OE2 3.33Å; G645-E664 WeakPolarHBondContact CA-O 3.37Å; G645-E664 PolarHBondContact N-O 2.77Å; G645-E664 VanDerWaalsContact N-O 3.14Å; N658-E664 PolarHBondContact ND2-O 2.91Å; K662-E664 IonicContact NZ-OE1 2.82Å; K662-E664 PolarHBondContact NZ-OE1 3.32Å; E664-E684 CarbonylContact C-O 3.09Å; E664-E684 HydrophobicContact CG-CB 3.67Å
665	G	67	Low	70.2	Confident	9 Å²	9	37.6 Å²	37.6	9%	0.093	19%	0.191	C	C	.	.	P	Polyproline II helix	trans	-93.2	164	-160.5	0	0	0	0	0	113	G645 N678 E684 G685	G645-G665 WeakPolarHBondContact CA-O 3.29Å; G665-N678 WeakPolarHBondContact CA-ND2 3.4Å; G665-N678 PolarHBondContact N-ND2 3.04Å; G665-E684 WeakPolarHBondContact CA-O 3.48Å; G665-E684 PolarHBondContact N-O 2.95Å; G665-G685 CarbonylContact C-O 3.56Å
666	P	71.6	Confident	70.5	Confident	1 Å²	1	36.7 Å²	36.7	1%	0.006	18%	0.182	C	C	.	.	P	Polyproline II helix	trans	-85.2	154.7	-175.8	16.2	-2.3	0	0	0	113	A646 A656 A676 Q677 Q687	A646-P666 VanDerWaalsContact O-CA 3.3Å; A646-P666 WeakPolarHBondContact O-CA 3.41Å; A646-P666 WeakPolarHBondContact O-CB 3.33Å; A656-P666 HydrophobicContact CB-CB 3.55Å; A656-P666 HydrophobicContact CB-CG 3.88Å; A656-P666 WeakPolarHBondContact O-CG 3.5Å; P666-A676 HydrophobicContact CB-CB 4.22Å; P666-A676 HydrophobicContact CG-CB 4Å; P666-A676 WeakPolarHBondContact O-CB 2.81Å; P666-Q677 WeakPolarHBondContact CD-O 3.29Å; P666-Q677 WeakPolarHBondContact CG-O 3.34Å; P666-Q687 PolarHBondContact O-N 2.96Å
667	Q	72.3	Confident	70.5	Confident	39 Å²	39	38.6 Å²	38.6	18%	0.182	19%	0.19	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	121.7	-178.2	-175.5	-175.8	28.7	0	0	110.1	A646 Q647 N648 Q669 Q687	A646-Q667 PolarHBondContact O-N 2.89Å; Q647-Q667 WeakPolarHBondContact CA-O 3.35Å; Q647-Q667 HydrophobicContact CG-CB 4.33Å; N648-Q667 PolarHBondContact N-O 3.29Å; Q667-Q669 HydrophobicContact CG-CG 4.3Å; Q667-Q687 WeakPolarHBondContact CA-O 3.32Å; Q667-Q687 HydrophobicContact CB-CB 4.41Å; Q667-Q687 HydrophobicContact CG-CB 4.09Å; Q667-Q687 VanDerWaalsContact NE2-OE1 3.09Å
668	N	72.1	Confident	70.4	Confident	1 Å²	1	35.6 Å²	35.6	1%	0.005	18%	0.176	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	125.4	175.5	-166	3.4	0	0	0	109.6	G653 G673 E674 Q687 N688 Q689	G653-N668 PolarHBondContact O-ND2 2.65Å; N668-G673 WeakPolarHBondContact ND2-CA 3.25Å; N668-E674 PolarHBondContact ND2-N 3.1Å; N668-E674 PolarHBondContact ND2-O 2.74Å; N668-Q687 PolarHBondContact N-O 2.72Å; N668-N688 CarbonylContact O-C 3.42Å; N668-N688 WeakPolarHBondContact O-CA 3.21Å; N668-N688 PolarHBondContact O-OD1 3.15Å; N668-Q689 PolarHBondContact O-N 2.93Å
669	Q	74.2	Confident	70.6	Confident	65 Å²	65	37.2 Å²	37.2	30%	0.304	18%	0.184	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-125.6	80.2	179.4	-69.6	-172.7	-40.5	0	0	108.9	N648 Q649 G650 Q667 Q689	N648-Q669 PolarHBondContact O-N 2.95Å; Q649-Q669 WeakPolarHBondContact CA-O 3.49Å; Q649-Q669 HydrophobicContact CG-CB 4.16Å; G650-Q669 PolarHBondContact N-O 2.86Å; Q667-Q669 HydrophobicContact CG-CG 4.3Å; Q669-Q689 CarbonylContact C-O 3.53Å; Q669-Q689 WeakPolarHBondContact CA-O 3.34Å; Q669-Q689 HydrophobicContact CG-CB 4.33Å
670	A	72.2	Confident	70.6	Confident	3 Å²	3	34 Å²	34	3%	0.025	17%	0.169	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-134.7	146.9	-169.6	0	0	0	0	0	113.6	G650 K672 Q689 G690	G650-A670 WeakPolarHBondContact O-CA 3.39Å; A670-K672 VanDerWaalsContact C-N 3.3Å; A670-K672 WeakPolarHBondContact CB-O 3.22Å; A670-K672 PolarHBondContact O-N 2.93Å; A670-Q689 PolarHBondContact N-O 3.17Å; A670-G690 WeakPolarHBondContact O-CA 3.37Å
671	K	71.9	Confident	70.7	Confident	124 Å²	124	37.8 Å²	37.8	54%	0.539	18%	0.179	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-64.5	-33.1	177.5	-62.6	-176.1	179.2	-178.8	0	112.3	G650 K651 K691 K692	G650-K671 PolarHBondContact O-N 2.64Å; G650-K671 VanDerWaalsContact O-N 3.15Å; K651-K671 CarbonylContact O-C 3.54Å; K651-K671 WeakPolarHBondContact O-CA 3.39Å; K651-K671 WeakPolarHBondContact O-CB 2.92Å; K651-K671 PolarHBondContact O-N 3.29Å; K671-K691 WeakPolarHBondContact O-CB 3.42Å; K671-K691 PolarHBondContact O-N 3.31Å; K671-K692 PolarHBondContact O-N 3.14Å
672	K	72.9	Confident	70.7	Confident	55 Å²	55	35.7 Å²	35.7	24%	0.239	17%	0.17	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	114.9	152.6	-163.1	-136.9	176.3	-154.4	0	108.6	K651 K652 G653 A670 E674 K692 E694	K651-K672 PolarHBondContact O-N 3.14Å; K652-K672 CarbonylContact C-O 3.46Å; K652-K672 VanDerWaalsContact CA-O 3.27Å; K652-K672 WeakPolarHBondContact CA-O 2.99Å; K652-K672 HydrophobicContact CG-CB 4.41Å; G653-K672 PolarHBondContact N-O 2.77Å; A670-K672 VanDerWaalsContact C-N 3.3Å; A670-K672 WeakPolarHBondContact CB-O 3.22Å; A670-K672 PolarHBondContact O-N 2.93Å; K672-E674 IonicContact NZ-OE1 2.68Å; K672-E674 PolarHBondContact NZ-OE1 2.73Å; K672-K692 CarbonylContact C-O 3.4Å; K672-K692 VanDerWaalsContact CA-O 3.25Å; K672-K692 WeakPolarHBondContact CA-O 3.14Å; K672-K692 HydrophobicContact CG-CB 4.23Å; K672-K692 HydrophobicContact CG-CD 4.42Å; K672-E694 WeakPolarHBondContact CE-OE1 3.24Å; K672-E694 IonicContact NZ-OE1 3.25Å; K672-E694 PolarHBondContact NZ-OE1 2.76Å
673	G	65.5	Low	70.5	Confident	0 Å²	0	32.4 Å²	32.4	0%	0	16%	0.156	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-119	125.7	-178.6	0	0	0	0	0	113.4	G653 N668 N688 K692 G693 E694	G653-G673 CarbonylContact O-C 3.54Å; G653-G673 VanDerWaalsContact O-CA 3.3Å; G653-G673 WeakPolarHBondContact O-CA 3.5Å; N668-G673 WeakPolarHBondContact ND2-CA 3.25Å; G673-N688 PolarHBondContact O-ND2 3.16Å; G673-K692 PolarHBondContact N-O 2.62Å; G673-G693 CarbonylContact O-C 3.57Å; G673-G693 WeakPolarHBondContact O-CA 3.31Å; G673-E694 PolarHBondContact O-N 2.75Å
674	E	70.1	Confident	70.6	Confident	53 Å²	53	34.3 Å²	34.3	25%	0.248	16%	0.164	C	C	.	.	P	Polyproline II helix	trans	-95.8	161.8	178.1	-50.9	177.8	-170.2	0	0	110.5	G653 E654 G655 N668 K672 E694	G653-E674 PolarHBondContact O-N 2.79Å; E654-E674 HydrophobicContact CG-CB 4.1Å; E654-E674 HydrophobicContact CG-CG 4.32Å; E654-E674 VanDerWaalsContact CG-OE2 3.25Å; E654-E674 WeakPolarHBondContact CG-OE2 3.06Å; G655-E674 PolarHBondContact N-O 3.38Å; N668-E674 PolarHBondContact ND2-N 3.1Å; N668-E674 PolarHBondContact ND2-O 2.74Å; K672-E674 IonicContact NZ-OE1 2.68Å; K672-E674 PolarHBondContact NZ-OE1 2.73Å; E674-E694 WeakPolarHBondContact CB-OE2 3.38Å; E674-E694 WeakPolarHBondContact CG-OE2 3.5Å
675	G	65.6	Low	70.5	Confident	22 Å²	22	33 Å²	33	23%	0.227	16%	0.164	C	C	.	.	P	Polyproline II helix	trans	-62.1	129.6	-159	0	0	0	0	0	116.6	G655 G695	G655-G675 WeakPolarHBondContact CA-O 3.37Å; G675-G695 WeakPolarHBondContact CA-O 3.32Å
676	A	72.5	Confident	70.8	Confident	0 Å²	0	32.6 Å²	32.6	0%	0	16%	0.16	C	C	.	.	P	Polyproline II helix	trans	-85.3	133.3	172.8	0	0	0	0	0	111.3	P666 A696 Q697	P666-A676 HydrophobicContact CB-CB 4.22Å; P666-A676 HydrophobicContact CG-CB 4Å; P666-A676 WeakPolarHBondContact O-CB 2.81Å; A676-A696 HydrophobicContact CB-CB 4.24Å; A676-A696 CarbonylContact O-C 3.49Å; A676-A696 WeakPolarHBondContact O-CA 3.26Å; A676-A696 WeakPolarHBondContact O-CB 3.37Å; A676-Q697 PolarHBondContact O-N 3.12Å
677	Q	73.2	Confident	70.8	Confident	45 Å²	45	34.5 Å²	34.5	21%	0.21	17%	0.169	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	136.6	-174.6	-60.4	-176.3	-31.7	0	0	112.9	A656 Q657 N658 P666 Q697	A656-Q677 PolarHBondContact O-N 3.04Å; Q657-Q677 WeakPolarHBondContact CA-O 3.16Å; Q657-Q677 HydrophobicContact CG-CB 4.28Å; N658-Q677 PolarHBondContact N-O 2.74Å; P666-Q677 WeakPolarHBondContact CD-O 3.29Å; P666-Q677 WeakPolarHBondContact CG-O 3.34Å; Q677-Q697 WeakPolarHBondContact CA-O 3.38Å; Q677-Q697 HydrophobicContact CG-CB 4.3Å
678	N	72.3	Confident	70.6	Confident	1 Å²	1	32.6 Å²	32.6	1%	0.005	16%	0.16	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	146.5	165.5	-161	-32	0	0	0	110.2	T119 P120 N658 G663 G665 G680 E684 Q697 N698	T119-N678 WeakPolarHBondContact O-CB 3.22Å; T119-N678 PolarHBondContact O-ND2 3.45Å; P120-N678 CarbonylContact C-O 3.57Å; P120-N678 VanDerWaalsContact C-O 3.32Å; P120-N678 CarbonylContact O-C 3.53Å; N658-N678 PolarHBondContact O-OD1 3.07Å; N658-N678 VanDerWaalsContact O-OD1 3.1Å; G663-N678 PolarHBondContact O-ND2 2.89Å; G665-N678 WeakPolarHBondContact CA-ND2 3.4Å; G665-N678 PolarHBondContact N-ND2 3.04Å; N678-G680 PolarHBondContact OD1-N 2.88Å; N678-E684 PolarHBondContact ND2-O 3.12Å; N678-E684 VanDerWaalsContact ND2-O 3.14Å; N678-Q697 PolarHBondContact N-O 3.44Å; N678-Q697 VanDerWaalsContact N-O 3.16Å; N678-N698 WeakPolarHBondContact CB-OD1 3.49Å
679	Q	73.1	Confident	70.6	Confident	36 Å²	36	34.9 Å²	34.9	17%	0.168	17%	0.17	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-150.5	40.9	-173.1	-80.3	-164.4	-21.2	0	0	113.8	I121 A122 N658 Q659 G660 Q699	I121-Q679 CarbonylContact C-O 3.59Å; I121-Q679 VanDerWaalsContact C-O 3.28Å; I121-Q679 VanDerWaalsContact N-C 3.31Å; I121-Q679 VanDerWaalsContact N-CA 3.34Å; I121-Q679 VanDerWaalsContact O-CA 3.27Å; I121-Q679 WeakPolarHBondContact O-CA 3.27Å; I121-Q679 WeakPolarHBondContact O-CG 3.28Å; A122-Q679 CarbonylContact C-O 3.57Å; A122-Q679 VanDerWaalsContact N-C 3.28Å; A122-Q679 PolarHBondContact N-O 2.93Å; A122-Q679 WeakPolarHBondContact O-CB 3.4Å; N658-Q679 CarbonylContact O-C 3.57Å; N658-Q679 VanDerWaalsContact O-C 3.27Å; N658-Q679 WeakPolarHBondContact O-CA 3.18Å; N658-Q679 PolarHBondContact O-N 2.98Å; Q659-Q679 CarbonylContact C-O 3Å; Q659-Q679 VanDerWaalsContact CA-O 3.32Å; Q659-Q679 WeakPolarHBondContact CA-O 3.48Å; Q659-Q679 HydrophobicContact CB-CB 4.41Å; Q659-Q679 HydrophobicContact CG-CB 3.62Å; G660-Q679 PolarHBondContact N-O 2.92Å; Q679-Q699 VanDerWaalsContact NE2-OE1 3.13Å
680	G	70.3	Confident	70.4	Confident	0 Å²	0	32.9 Å²	32.9	0%	0	17%	0.168	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	141.1	167.7	0	0	0	0	0	117.7	P120 I121 N658 G660 N678 K682	P120-G680 WeakPolarHBondContact CB-O 3.38Å; I121-G680 VanDerWaalsContact CA-C 3.44Å; I121-G680 VanDerWaalsContact CA-N 3.31Å; I121-G680 VanDerWaalsContact CA-O 3.28Å; I121-G680 WeakPolarHBondContact CA-O 3.37Å; I121-G680 WeakPolarHBondContact CG1-O 3.29Å; I121-G680 PolarHBondContact N-O 3Å; N658-G680 PolarHBondContact O-N 3.04Å; G660-G680 CarbonylContact O-C 3.52Å; G660-G680 WeakPolarHBondContact O-CA 3.15Å; N678-G680 PolarHBondContact OD1-N 2.88Å; G680-K682 VanDerWaalsContact C-N 3.25Å; G680-K682 CarbonylContact C-O 3.56Å; G680-K682 CarbonylContact O-C 3.49Å; G680-K682 WeakPolarHBondContact O-CA 3.44Å; G680-K682 PolarHBondContact O-N 2.82Å
681	K	71.1	Confident	70.4	Confident	100 Å²	100	38.9 Å²	38.9	44%	0.435	19%	0.193	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-35.8	-33.2	-166.6	-78.2	-170.4	-179.1	-176.3	0	118.9	I121 G660 K661	I121-K681 WeakPolarHBondContact CD1-O 3.4Å; I121-K681 VanDerWaalsContact CG1-CA 3.41Å; I121-K681 WeakPolarHBondContact CG1-O 3.38Å; G660-K681 PolarHBondContact O-N 2.87Å; G660-K681 VanDerWaalsContact O-N 3.15Å; K661-K681 CarbonylContact O-C 3.19Å; K661-K681 WeakPolarHBondContact O-CA 3.13Å; K661-K681 VanDerWaalsContact O-CB 3.28Å; K661-K681 WeakPolarHBondContact O-CB 2.96Å; K661-K681 PolarHBondContact O-N 3.15Å; K661-K681 VanDerWaalsContact O-N 3.1Å
682	K	70.8	Confident	70.3	Confident	74 Å²	74	36.8 Å²	36.8	32%	0.322	18%	0.184	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-128	148.6	151.8	-164.7	-148.2	-178.3	-169.4	0	105.7	K661 K662 G663 G680 E684 K702	K661-K682 PolarHBondContact O-N 3.1Å; K662-K682 CarbonylContact C-O 3.54Å; K662-K682 WeakPolarHBondContact CA-O 3.26Å; G663-K682 PolarHBondContact N-O 3.22Å; G663-K682 VanDerWaalsContact N-O 3.07Å; G680-K682 VanDerWaalsContact C-N 3.25Å; G680-K682 CarbonylContact C-O 3.56Å; G680-K682 CarbonylContact O-C 3.49Å; G680-K682 WeakPolarHBondContact O-CA 3.44Å; G680-K682 PolarHBondContact O-N 2.82Å; K682-E684 VanDerWaalsContact CE-OE1 3.23Å; K682-E684 WeakPolarHBondContact CE-OE1 3.43Å; K682-E684 IonicContact NZ-OE1 2.61Å; K682-E684 PolarHBondContact NZ-OE1 3.44Å; K682-K702 HydrophobicContact CG-CB 4.39Å; K682-K702 HydrophobicContact CG-CG 4.36Å
683	G	65.7	Low	69.9	Low	0 Å²	0	34.2 Å²	34.2	0%	0	17%	0.173	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	-157.5	176.2	0	0	0	0	0	112.3	T119 G663	T119-G683 VanDerWaalsContact CB-CA 3.45Å; T119-G683 WeakPolarHBondContact CB-O 3.05Å; T119-G683 WeakPolarHBondContact CG2-O 3.33Å; G663-G683 CarbonylContact O-C 3.55Å; G663-G683 WeakPolarHBondContact O-CA 2.98Å
684	E	69	Low	70	Confident	42 Å²	42	36.2 Å²	36.2	20%	0.196	18%	0.182	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-165.4	178.8	154.9	-95.5	110	-139.4	0	0	107.5	H118 T119 K662 G663 E664 G665 N678 K682	H118-E684 CarbonylContact O-C 3.55Å; T119-E684 HydrophobicContact CG2-CB 4.46Å; T119-E684 HydrophobicContact CG2-CG 4.08Å; T119-E684 PolarHBondContact O-N 3.34Å; T119-E684 VanDerWaalsContact O-O 3.1Å; K662-E684 WeakPolarHBondContact CE-OE2 3.23Å; K662-E684 IonicContact NZ-OE2 2.61Å; K662-E684 PolarHBondContact NZ-OE2 2.93Å; G663-E684 PolarHBondContact O-N 3.3Å; E664-E684 CarbonylContact C-O 3.09Å; E664-E684 HydrophobicContact CG-CB 3.67Å; G665-E684 WeakPolarHBondContact CA-O 3.48Å; G665-E684 PolarHBondContact N-O 2.95Å; N678-E684 PolarHBondContact ND2-O 3.12Å; N678-E684 VanDerWaalsContact ND2-O 3.14Å; K682-E684 VanDerWaalsContact CE-OE1 3.23Å; K682-E684 WeakPolarHBondContact CE-OE1 3.43Å; K682-E684 IonicContact NZ-OE1 2.61Å; K682-E684 PolarHBondContact NZ-OE1 3.44Å
685	G	68	Low	69.8	Low	24 Å²	24	34.3 Å²	34.3	25%	0.247	18%	0.176	C	C	.	.			trans	71.7	9.6	159.9	0	0	0	0	0	126.9	H118 G665 Q687	H118-G685 VanDerWaalsContact CA-N 3.31Å; H118-G685 CarbonylContact O-C 3.56Å; H118-G685 WeakPolarHBondContact O-CA 3Å; H118-G685 PolarHBondContact O-N 2.85Å; G665-G685 CarbonylContact C-O 3.56Å; G685-Q687 PolarHBondContact O-N 3.36Å
686	A	71.6	Confident	70.1	Confident	0 Å²	0	33.2 Å²	33.2	0%	0	17%	0.166	C	C	.	.			trans	-78.8	116.7	-175	0	0	0	0	0	115	H118 N698 Q707	H118-A686 PolarHBondContact O-N 3.39Å; A686-N698 WeakPolarHBondContact CB-OD1 3.24Å; A686-Q707 PolarHBondContact O-N 2.71Å; A686-Q707 VanDerWaalsContact O-N 3.12Å
687	Q	71.7	Confident	70.2	Confident	40 Å²	40	35.6 Å²	35.6	19%	0.187	18%	0.176	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-140.7	144.6	-171.6	-64.3	-172	-37	0	0	115.5	P666 Q667 N668 G685 Q707	P666-Q687 PolarHBondContact O-N 2.96Å; Q667-Q687 WeakPolarHBondContact CA-O 3.32Å; Q667-Q687 HydrophobicContact CB-CB 4.41Å; Q667-Q687 HydrophobicContact CG-CB 4.09Å; Q667-Q687 VanDerWaalsContact NE2-OE1 3.09Å; N668-Q687 PolarHBondContact N-O 2.72Å; G685-Q687 PolarHBondContact O-N 3.36Å; Q687-Q707 WeakPolarHBondContact CA-O 3.19Å; Q687-Q707 HydrophobicContact CG-CB 4.29Å
688	N	69.5	Low	70.1	Confident	0 Å²	0	33.4 Å²	33.4	0%	0	17%	0.166	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-134.5	134	166.1	-167.7	7.6	0	0	0	111.9	N668 G673 E694 Q707 S708 Q709	N668-N688 CarbonylContact O-C 3.42Å; N668-N688 WeakPolarHBondContact O-CA 3.21Å; N668-N688 PolarHBondContact O-OD1 3.15Å; G673-N688 PolarHBondContact O-ND2 3.16Å; N688-E694 PolarHBondContact ND2-O 3.02Å; N688-Q707 PolarHBondContact N-O 3.02Å; N688-S708 CarbonylContact O-C 3.29Å; N688-S708 VanDerWaalsContact O-CA 3.25Å; N688-S708 WeakPolarHBondContact O-CA 3.48Å; N688-Q709 PolarHBondContact O-N 3.48Å
689	Q	71.5	Confident	70.1	Confident	48 Å²	48	36.2 Å²	36.2	22%	0.224	18%	0.18	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-137.2	130.9	-177	-60.7	179.8	-36.4	0	0	110.6	N668 Q669 A670 Q709	N668-Q689 PolarHBondContact O-N 2.93Å; Q669-Q689 CarbonylContact C-O 3.53Å; Q669-Q689 WeakPolarHBondContact CA-O 3.34Å; Q669-Q689 HydrophobicContact CG-CB 4.33Å; A670-Q689 PolarHBondContact N-O 3.17Å; Q689-Q709 CarbonylContact C-O 3.29Å; Q689-Q709 WeakPolarHBondContact CA-O 3.25Å; Q689-Q709 HydrophobicContact CG-CB 4.22Å
690	G	70.4	Confident	70	Confident	24 Å²	24	35.3 Å²	35.3	25%	0.247	18%	0.179	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-175.5	-170.3	-171.8	0	0	0	0	0	118.9	A670 Q709 K711	A670-G690 WeakPolarHBondContact O-CA 3.37Å; G690-Q709 PolarHBondContact N-O 2.99Å; G690-K711 PolarHBondContact O-N 2.9Å
691	K	72.4	Confident	70	Confident	129 Å²	129	41 Å²	41	56%	0.561	20%	0.204	S	C	*	.	E	Extended strand (participates in β ladder)	trans	-92.1	-49	166.5	-72.8	-165.4	177.4	-168	0	110.7	K671 K711 K712	K671-K691 WeakPolarHBondContact O-CB 3.42Å; K671-K691 PolarHBondContact O-N 3.31Å; K691-K711 CarbonylContact O-C 3.59Å; K691-K711 WeakPolarHBondContact O-CA 3.15Å; K691-K711 WeakPolarHBondContact O-CB 3.38Å; K691-K711 PolarHBondContact O-N 2.86Å; K691-K712 PolarHBondContact O-N 3.44Å
692	K	68.7	Low	70	Confident	80 Å²	80	39.4 Å²	39.4	35%	0.348	20%	0.197	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-115.2	145.2	161.4	-161.8	-162.2	174.5	-158.8	0	109.5	K671 K672 G673 K712	K671-K692 PolarHBondContact O-N 3.14Å; K672-K692 CarbonylContact C-O 3.4Å; K672-K692 VanDerWaalsContact CA-O 3.25Å; K672-K692 WeakPolarHBondContact CA-O 3.14Å; K672-K692 HydrophobicContact CG-CB 4.23Å; K672-K692 HydrophobicContact CG-CD 4.42Å; G673-K692 PolarHBondContact N-O 2.62Å; K692-K712 WeakPolarHBondContact CA-O 3.41Å; K692-K712 VanDerWaalsContact CG-O 3.26Å; K692-K712 WeakPolarHBondContact CG-O 3.38Å
693	G	64.4	Low	69.9	Low	0 Å²	0	35.9 Å²	35.9	0%	0	18%	0.182	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-164.9	159.6	165.4	0	0	0	0	0	115.8	G673 K712 G713 E714	G673-G693 CarbonylContact O-C 3.57Å; G673-G693 WeakPolarHBondContact O-CA 3.31Å; G693-K712 PolarHBondContact N-O 2.94Å; G693-G713 CarbonylContact O-C 3.5Å; G693-G713 WeakPolarHBondContact O-CA 3.28Å; G693-E714 PolarHBondContact O-N 2.92Å
694	E	67.4	Low	69.9	Low	43 Å²	43	36.7 Å²	36.7	20%	0.201	19%	0.186	C	C	.	.	P	Polyproline II helix	trans	-95.7	155.4	175.1	-67.4	138.5	-140.9	0	0	110.2	K672 G673 E674 N688 E714	K672-E694 WeakPolarHBondContact CE-OE1 3.24Å; K672-E694 IonicContact NZ-OE1 3.25Å; K672-E694 PolarHBondContact NZ-OE1 2.76Å; G673-E694 PolarHBondContact O-N 2.75Å; E674-E694 WeakPolarHBondContact CB-OE2 3.38Å; E674-E694 WeakPolarHBondContact CG-OE2 3.5Å; N688-E694 PolarHBondContact ND2-O 3.02Å; E694-E714 HydrophobicContact CG-CG 4.45Å
695	G	65.7	Low	69.8	Low	12 Å²	12	34.8 Å²	34.8	12%	0.124	18%	0.177	C	C	.	.	P	Polyproline II helix	trans	-64.5	142.1	-171.1	0	0	0	0	0	114.3	G675 G715	G675-G695 WeakPolarHBondContact CA-O 3.32Å; G695-G715 WeakPolarHBondContact CA-O 3.07Å
696	A	73.1	Confident	69.8	Low	0 Å²	0	33.6 Å²	33.6	0%	0	17%	0.165	C	C	.	.	P	Polyproline II helix	trans	-71	155.4	162.7	0	0	0	0	0	110.7	A676 V706 T716 Q717	A676-A696 HydrophobicContact CB-CB 4.24Å; A676-A696 CarbonylContact O-C 3.49Å; A676-A696 WeakPolarHBondContact O-CA 3.26Å; A676-A696 WeakPolarHBondContact O-CB 3.37Å; A696-V706 HydrophobicContact CB-CG1 3.52Å; A696-V706 WeakPolarHBondContact O-CG1 3.25Å; A696-T716 WeakPolarHBondContact O-CA 3.26Å; A696-Q717 PolarHBondContact O-N 2.68Å
697	Q	73.4	Confident	69.7	Low	49 Å²	49	35.7 Å²	35.7	23%	0.229	18%	0.175	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-137.7	145.4	-173.2	-56.1	-178.1	-66.5	0	0	114.5	A676 Q677 N678 Q717	A676-Q697 PolarHBondContact O-N 3.12Å; Q677-Q697 WeakPolarHBondContact CA-O 3.38Å; Q677-Q697 HydrophobicContact CG-CB 4.3Å; N678-Q697 PolarHBondContact N-O 3.44Å; N678-Q697 VanDerWaalsContact N-O 3.16Å; Q697-Q717 CarbonylContact C-O 3.55Å; Q697-Q717 VanDerWaalsContact CA-O 3.29Å; Q697-Q717 WeakPolarHBondContact CA-O 3.48Å; Q697-Q717 HydrophobicContact CG-CB 4.15Å
698	N	72.2	Confident	69.5	Low	0 Å²	0	33.8 Å²	33.8	0%	0	17%	0.166	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-150.7	128	-169	-93.6	2.3	0	0	0	109.7	T119 P120 N678 A686 E704 V706 Q717 N718 Q719	T119-N698 VanDerWaalsContact C-OD1 3.3Å; T119-N698 PolarHBondContact N-ND2 2.96Å; T119-N698 PolarHBondContact O-OD1 2.86Å; P120-N698 VanDerWaalsContact CD-CB 3.41Å; P120-N698 WeakPolarHBondContact CD-ND2 3.48Å; P120-N698 CarbonylContact O-C 3.31Å; N678-N698 WeakPolarHBondContact CB-OD1 3.49Å; A686-N698 WeakPolarHBondContact CB-OD1 3.24Å; N698-E704 PolarHBondContact ND2-O 2.68Å; N698-E704 VanDerWaalsContact ND2-O 3.15Å; N698-V706 HydrophobicContact CB-CG2 3.48Å; N698-V706 VanDerWaalsContact CB-CG2 3.48Å; N698-V706 VanDerWaalsContact ND2-CG2 3.26Å; N698-V706 WeakPolarHBondContact ND2-CG2 3.35Å; N698-Q717 PolarHBondContact N-O 3.45Å; N698-N718 WeakPolarHBondContact CB-OD1 3.44Å; N698-N718 CarbonylContact O-C 3.51Å; N698-N718 VanDerWaalsContact O-CA 3.27Å; N698-N718 WeakPolarHBondContact O-CA 3.31Å; N698-Q719 PolarHBondContact O-N 2.9Å
699	Q	72.5	Confident	69.6	Low	60 Å²	60	37.6 Å²	37.6	28%	0.28	18%	0.184	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-143.3	73.8	-160.4	-63.5	179.5	-22.8	0	0	118	P120 I121 Q679 Q719	P120-Q699 PolarHBondContact O-N 2.93Å; I121-Q699 VanDerWaalsContact CB-O 3.25Å; I121-Q699 WeakPolarHBondContact CB-O 2.98Å; I121-Q699 WeakPolarHBondContact CG2-O 3.27Å; Q679-Q699 VanDerWaalsContact NE2-OE1 3.13Å; Q699-Q719 CarbonylContact C-O 3.54Å; Q699-Q719 HydrophobicContact CG-CG 4.42Å
700	G	70.6	Confident	69.3	Low	16 Å²	16	35.5 Å²	35.5	17%	0.165	18%	0.175	C	C	.	.	E	Extended strand (participates in β ladder)	trans	153.2	-140.3	155.7	0	0	0	0	0	118.6	I121 K702 A703 Q719 G720 K721	I121-G700 WeakPolarHBondContact CD1-O 3.47Å; I121-G700 VanDerWaalsContact CG2-CA 3.42Å; G700-K702 PolarHBondContact O-N 3.14Å; G700-A703 VanDerWaalsContact O-CB 3.27Å; G700-A703 WeakPolarHBondContact O-CB 3.48Å; G700-Q719 WeakPolarHBondContact CA-O 3.12Å; G700-Q719 PolarHBondContact N-O 3.42Å; G700-G720 VanDerWaalsContact C-CA 3.4Å; G700-G720 WeakPolarHBondContact O-CA 3.44Å; G700-K721 PolarHBondContact O-N 2.81Å
701	K	70.9	Confident	69.1	Low	120 Å²	120	40.4 Å²	40.4	52%	0.522	19%	0.189	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-23.6	-75.9	-170.8	-66.4	-158.9	178.7	-163.9	0	119.6	I121 K721 K722	I121-K701 HydrophobicContact CD1-CB 4.02Å; I121-K701 HydrophobicContact CG1-CB 4.44Å; K701-K721 WeakPolarHBondContact O-CA 3.47Å; K701-K721 VanDerWaalsContact O-CB 3.25Å; K701-K721 WeakPolarHBondContact O-CB 3.43Å; K701-K721 PolarHBondContact O-N 2.82Å; K701-K721 VanDerWaalsContact O-N 3.13Å; K701-K722 PolarHBondContact O-N 3.01Å; K701-K722 VanDerWaalsContact O-N 3.16Å
702	K	69.7	Low	68.8	Low	66 Å²	66	40 Å²	40	29%	0.287	19%	0.187	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	110.4	170.8	170	154.3	170.2	118.9	0	111.2	T119 P120 I121 K682 G700 E704 K722 D724	T119-K702 PolarHBondContact OG1-O 3.05Å; P120-K702 WeakPolarHBondContact CG-O 3.39Å; I121-K702 WeakPolarHBondContact CD1-O 3.44Å; K682-K702 HydrophobicContact CG-CB 4.39Å; K682-K702 HydrophobicContact CG-CG 4.36Å; G700-K702 PolarHBondContact O-N 3.14Å; K702-E704 WeakPolarHBondContact CE-OE1 2.87Å; K702-E704 WeakPolarHBondContact CE-OE2 3.04Å; K702-E704 IonicContact NZ-OE1 2.64Å; K702-E704 PolarHBondContact NZ-OE1 2.82Å; K702-E704 IonicContact NZ-OE2 3.62Å; K702-K722 CarbonylContact C-O 3.57Å; K702-K722 WeakPolarHBondContact CA-O 3.11Å; K702-D724 IonicContact NZ-OD2 2.99Å; K702-D724 PolarHBondContact NZ-OD2 3.41Å
703	A	68.6	Low	68.4	Low	0 Å²	0	36.3 Å²	36.3	0%	0	17%	0.172	C	C	.	.			trans	-135.3	84.8	-152.9	0	0	0	0	0	115.3	T119 P120 G700 N718 Q719 K722 G723	T119-A703 WeakPolarHBondContact OG1-CA 3.34Å; P120-A703 VanDerWaalsContact CG-CA 3.45Å; P120-A703 HydrophobicContact CG-CB 3.58Å; G700-A703 VanDerWaalsContact O-CB 3.27Å; G700-A703 WeakPolarHBondContact O-CB 3.48Å; A703-N718 VanDerWaalsContact C-OD1 3.31Å; A703-N718 WeakPolarHBondContact CB-OD1 3.25Å; A703-N718 PolarHBondContact O-ND2 3.08Å; A703-N718 PolarHBondContact O-OD1 2.93Å; A703-Q719 WeakPolarHBondContact CB-O 3.35Å; A703-K722 PolarHBondContact N-O 3.32Å; A703-G723 VanDerWaalsContact C-CA 3.42Å; A703-G723 CarbonylContact O-C 3.55Å; A703-G723 VanDerWaalsContact O-C 3.31Å; A703-G723 WeakPolarHBondContact O-CA 3.47Å
704	E	67.7	Low	68.5	Low	18 Å²	18	39.8 Å²	39.8	8%	0.084	19%	0.189	C	C	.	.			trans	-108	172.3	-170.2	-60.5	153.2	120.2	0	0	111.7	H118 T119 N698 K702 V706 N718 D724	H118-E704 CarbonylContact C-O 3.54Å; H118-E704 VanDerWaalsContact C-O 3.29Å; H118-E704 HydrophobicContact CB-CB 3.31Å; H118-E704 HydrophobicContact CB-CG 4.46Å; H118-E704 WeakPolarHBondContact ND1-CB 3.37Å; T119-E704 HydrophobicContact CG2-CB 4.06Å; T119-E704 HydrophobicContact CG2-CG 4.4Å; T119-E704 WeakPolarHBondContact CG2-OE2 2.99Å; T119-E704 PolarHBondContact N-O 2.84Å; T119-E704 PolarHBondContact OG1-N 3.25Å; N698-E704 PolarHBondContact ND2-O 2.68Å; N698-E704 VanDerWaalsContact ND2-O 3.15Å; K702-E704 WeakPolarHBondContact CE-OE1 2.87Å; K702-E704 WeakPolarHBondContact CE-OE2 3.04Å; K702-E704 IonicContact NZ-OE1 2.64Å; K702-E704 PolarHBondContact NZ-OE1 2.82Å; K702-E704 IonicContact NZ-OE2 3.62Å; E704-V706 PolarHBondContact O-N 2.94Å; E704-N718 PolarHBondContact O-ND2 3Å; E704-D724 CarbonylContact C-O 3.57Å; E704-D724 WeakPolarHBondContact CA-O 3.26Å; E704-D724 HydrophobicContact CB-CB 4.45Å; E704-D724 WeakPolarHBondContact CB-O 3.1Å; E704-D724 HydrophobicContact CG-CB 3.91Å; E704-D724 WeakPolarHBondContact CG-OD2 2.98Å
705	G	65.1	Low	68.3	Low	1 Å²	1	38.6 Å²	38.6	1%	0.01	19%	0.188	C	C	.	.			trans	46.1	43.1	149.5	0	0	0	0	0	121.1	G117 H118 D724 G725	G117-G705 CarbonylContact C-O 3.54Å; G117-G705 VanDerWaalsContact C-O 3.29Å; G117-G705 CarbonylContact O-C 3.44Å; G117-G705 WeakPolarHBondContact O-CA 3.35Å; H118-G705 PolarHBondContact N-O 2.9Å; H118-G705 VanDerWaalsContact ND1-CA 3.34Å; H118-G705 WeakPolarHBondContact ND1-CA 3.42Å; H118-G705 PolarHBondContact ND1-N 2.69Å; G705-D724 PolarHBondContact N-O 2.89Å; G705-G725 VanDerWaalsContact CA-O 3.26Å; G705-G725 WeakPolarHBondContact CA-O 3.41Å; G705-G725 PolarHBondContact N-O 2.9Å
706	V	68.8	Low	68.5	Low	0 Å²	0	38 Å²	38	0%	0	18%	0.182	C	C	.	.			trans	-67.6	139.2	162.8	-170.2	0	0	0	0	109.1	A696 N698 E704 T716 N718 N726 P727	A696-V706 HydrophobicContact CB-CG1 3.52Å; A696-V706 WeakPolarHBondContact O-CG1 3.25Å; N698-V706 HydrophobicContact CB-CG2 3.48Å; N698-V706 VanDerWaalsContact CB-CG2 3.48Å; N698-V706 VanDerWaalsContact ND2-CG2 3.26Å; N698-V706 WeakPolarHBondContact ND2-CG2 3.35Å; E704-V706 PolarHBondContact O-N 2.94Å; V706-T716 HydrophobicContact CG1-CG2 3.62Å; V706-N718 HydrophobicContact CG2-CB 3.9Å; V706-N726 WeakPolarHBondContact CB-OD1 3.11Å; V706-N726 CarbonylContact O-C 3.5Å; V706-N726 WeakPolarHBondContact O-CA 3.23Å; V706-N726 PolarHBondContact O-OD1 3.04Å; V706-P727 WeakPolarHBondContact O-CD 3.26Å
707	Q	69.5	Low	68.4	Low	43 Å²	43	41.3 Å²	41.3	20%	0.201	20%	0.197	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-130.7	138.7	175.2	-68.3	171.7	-2.8	0	0	112.6	V116 G117 A686 Q687 N688 P727	V116-Q707 PolarHBondContact O-NE2 3.27Å; G117-Q707 PolarHBondContact O-NE2 3.33Å; A686-Q707 PolarHBondContact O-N 2.71Å; A686-Q707 VanDerWaalsContact O-N 3.12Å; Q687-Q707 WeakPolarHBondContact CA-O 3.19Å; Q687-Q707 HydrophobicContact CG-CB 4.29Å; N688-Q707 PolarHBondContact N-O 3.02Å; Q707-P727 WeakPolarHBondContact CA-O 3.37Å; Q707-P727 HydrophobicContact CG-CG 4.3Å
708	S	67.6	Low	68.1	Low	0 Å²	0	39 Å²	39	0%	0	19%	0.186	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	135.2	167.2	-178.3	0	0	0	0	111.2	N688 P727 N728 Q729	N688-S708 CarbonylContact O-C 3.29Å; N688-S708 VanDerWaalsContact O-CA 3.25Å; N688-S708 WeakPolarHBondContact O-CA 3.48Å; S708-P727 PolarHBondContact N-O 3.15Å; S708-N728 WeakPolarHBondContact O-CA 3.07Å; S708-N728 PolarHBondContact O-OD1 2.7Å; S708-Q729 PolarHBondContact O-N 2.84Å
709	Q	71	Confident	68	Low	81 Å²	81	41.6 Å²	41.6	38%	0.379	20%	0.199	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.4	90.3	174.6	-61	-177.2	-50.8	0	0	109.9	N688 Q689 G690 Q729	N688-Q709 PolarHBondContact O-N 3.48Å; Q689-Q709 CarbonylContact C-O 3.29Å; Q689-Q709 WeakPolarHBondContact CA-O 3.25Å; Q689-Q709 HydrophobicContact CG-CB 4.22Å; G690-Q709 PolarHBondContact N-O 2.99Å; Q709-Q729 CarbonylContact C-O 3.47Å; Q709-Q729 VanDerWaalsContact CA-O 3.32Å; Q709-Q729 WeakPolarHBondContact CA-O 3.33Å; Q709-Q729 HydrophobicContact CG-CB 4.26Å
710	S	64.8	Low	67.9	Low	4 Å²	4	39.6 Å²	39.6	3%	0.028	19%	0.194	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-134.5	137.5	-172.4	-81.5	0	0	0	0	113.1	K712 Q729 G730	S710-K712 VanDerWaalsContact C-N 3.32Å; S710-K712 PolarHBondContact O-N 2.85Å; S710-Q729 PolarHBondContact N-O 2.61Å; S710-G730 WeakPolarHBondContact O-CA 3.36Å
711	K	66.8	Low	67.7	Low	127 Å²	127	43.6 Å²	43.6	55%	0.552	21%	0.207	S	C	*	.	E	Extended strand (participates in β ladder)	trans	-65.4	-33	177.7	-62.5	-166.3	178.9	-170.1	0	113	G690 K691 K731 K732	G690-K711 PolarHBondContact O-N 2.9Å; K691-K711 CarbonylContact O-C 3.59Å; K691-K711 WeakPolarHBondContact O-CA 3.15Å; K691-K711 WeakPolarHBondContact O-CB 3.38Å; K691-K711 PolarHBondContact O-N 2.86Å; K711-K731 WeakPolarHBondContact O-CB 3.39Å; K711-K731 PolarHBondContact O-N 2.69Å; K711-K732 PolarHBondContact O-N 2.72Å
712	K	65.7	Low	67.4	Low	119 Å²	119	43.7 Å²	43.7	52%	0.517	21%	0.207	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-136.9	113.2	164.3	-178.1	177.3	179.3	178.9	0	109.3	K691 K692 G693 S710 K732	K691-K712 PolarHBondContact O-N 3.44Å; K692-K712 WeakPolarHBondContact CA-O 3.41Å; K692-K712 VanDerWaalsContact CG-O 3.26Å; K692-K712 WeakPolarHBondContact CG-O 3.38Å; G693-K712 PolarHBondContact N-O 2.94Å; S710-K712 VanDerWaalsContact C-N 3.32Å; S710-K712 PolarHBondContact O-N 2.85Å; K712-K732 VanDerWaalsContact CA-O 3.23Å; K712-K732 WeakPolarHBondContact CA-O 3.28Å
713	G	61.7	Low	67.1	Low	4 Å²	4	40.5 Å²	40.5	4%	0.041	19%	0.193	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-155	163.4	-178.3	0	0	0	0	0	117.1	G693 K732 G733 E734	G693-G713 CarbonylContact O-C 3.5Å; G693-G713 WeakPolarHBondContact O-CA 3.28Å; G713-K732 PolarHBondContact N-O 3.4Å; G713-K732 VanDerWaalsContact N-O 3.15Å; G713-G733 WeakPolarHBondContact O-CA 3.23Å; G713-E734 PolarHBondContact O-N 2.88Å
714	E	64.6	Low	66.9	Low	73 Å²	73	41.9 Å²	41.9	34%	0.341	20%	0.201	S	C	.	.	P	Polyproline II helix	trans	-89.9	165.3	-176.5	-59.5	169.8	-153.1	0	0	112	G693 E694	G693-E714 PolarHBondContact O-N 2.92Å; E694-E714 HydrophobicContact CG-CG 4.45Å
715	G	63.6	Low	66.5	Low	18 Å²	18	41.8 Å²	41.8	19%	0.186	20%	0.204	C	C	.	.	P	Polyproline II helix	trans	-69.2	131.7	-169.2	0	0	0	0	0	115.9	G695 E734 G735	G695-G715 WeakPolarHBondContact CA-O 3.07Å; G715-E734 WeakPolarHBondContact CA-O 3.31Å; G715-G735 WeakPolarHBondContact CA-O 3.34Å
716	T	70.8	Confident	66.4	Low	0 Å²	0	41.7 Å²	41.7	0%	0	20%	0.204	C	C	.	.	P	Polyproline II helix	trans	-73.6	132.8	172.3	40.3	0	0	0	0	111.9	A696 V706 N726 A736 S737	A696-T716 WeakPolarHBondContact O-CA 3.26Å; V706-T716 HydrophobicContact CG1-CG2 3.62Å; T716-N726 WeakPolarHBondContact CB-OD1 3.38Å; T716-N726 PolarHBondContact O-ND2 3.44Å; T716-N726 PolarHBondContact OG1-OD1 3.1Å; T716-A736 CarbonylContact O-C 3.36Å; T716-A736 WeakPolarHBondContact O-CA 3.42Å; T716-S737 PolarHBondContact O-N 3.26Å
717	Q	69.8	Low	66.2	Low	69 Å²	69	43.1 Å²	43.1	32%	0.322	21%	0.213	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	131.1	-173	-57.5	-169.5	-17.2	0	0	113.4	A696 Q697 N698	A696-Q717 PolarHBondContact O-N 2.68Å; Q697-Q717 CarbonylContact C-O 3.55Å; Q697-Q717 VanDerWaalsContact CA-O 3.29Å; Q697-Q717 WeakPolarHBondContact CA-O 3.48Å; Q697-Q717 HydrophobicContact CG-CB 4.15Å; N698-Q717 PolarHBondContact N-O 3.45Å
718	N	68.7	Low	65.8	Low	0 Å²	0	41.1 Å²	41.1	0%	0	20%	0.204	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	135.9	179.2	-158.9	5.4	0	0	0	109	N698 A703 E704 V706 S737 N738 Q739	N698-N718 WeakPolarHBondContact CB-OD1 3.44Å; N698-N718 CarbonylContact O-C 3.51Å; N698-N718 VanDerWaalsContact O-CA 3.27Å; N698-N718 WeakPolarHBondContact O-CA 3.31Å; A703-N718 VanDerWaalsContact C-OD1 3.31Å; A703-N718 WeakPolarHBondContact CB-OD1 3.25Å; A703-N718 PolarHBondContact O-ND2 3.08Å; A703-N718 PolarHBondContact O-OD1 2.93Å; E704-N718 PolarHBondContact O-ND2 3Å; V706-N718 HydrophobicContact CG2-CB 3.9Å; N718-S737 PolarHBondContact N-O 3.11Å; N718-N738 CarbonylContact O-C 3.58Å; N718-N738 VanDerWaalsContact O-CA 3.23Å; N718-N738 WeakPolarHBondContact O-CA 2.97Å; N718-N738 PolarHBondContact O-OD1 3.04Å; N718-Q739 PolarHBondContact O-N 2.96Å
719	Q	70	Confident	65.7	Low	55 Å²	55	44.3 Å²	44.3	26%	0.257	22%	0.218	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-142.3	151.2	-175.4	-45.9	178.9	-12.1	0	0	109.9	N698 Q699 G700 A703 Q739	N698-Q719 PolarHBondContact O-N 2.9Å; Q699-Q719 CarbonylContact C-O 3.54Å; Q699-Q719 HydrophobicContact CG-CG 4.42Å; G700-Q719 WeakPolarHBondContact CA-O 3.12Å; G700-Q719 PolarHBondContact N-O 3.42Å; A703-Q719 WeakPolarHBondContact CB-O 3.35Å; Q719-Q739 CarbonylContact C-O 3.55Å; Q719-Q739 WeakPolarHBondContact CA-O 3.36Å; Q719-Q739 HydrophobicContact CB-CB 4.11Å; Q719-Q739 HydrophobicContact CG-CB 4.1Å
720	G	69.6	Low	65.4	Low	17 Å²	17	41 Å²	41	18%	0.175	21%	0.206	C	C	.	.	E	Extended strand (participates in β ladder)	trans	159.8	-155.8	-177.3	0	0	0	0	0	122.7	G700 Q739 N740 R741	G700-G720 VanDerWaalsContact C-CA 3.4Å; G700-G720 WeakPolarHBondContact O-CA 3.44Å; G720-Q739 PolarHBondContact N-O 2.72Å; G720-N740 WeakPolarHBondContact CA-OD1 2.89Å; G720-N740 PolarHBondContact N-OD1 3.49Å; G720-R741 PolarHBondContact O-N 2.87Å
721	K	65.8	Low	65.3	Low	100 Å²	100	47.3 Å²	47.3	44%	0.435	23%	0.233	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-108.4	-35.2	174.3	-58.9	-167.4	174.4	-166.4	0	113.8	G700 K701 N740 R741 K742	G700-K721 PolarHBondContact O-N 2.81Å; K701-K721 WeakPolarHBondContact O-CA 3.47Å; K701-K721 VanDerWaalsContact O-CB 3.25Å; K701-K721 WeakPolarHBondContact O-CB 3.43Å; K701-K721 PolarHBondContact O-N 2.82Å; K701-K721 VanDerWaalsContact O-N 3.13Å; K721-N740 PolarHBondContact N-OD1 2.76Å; K721-R741 WeakPolarHBondContact O-CB 3.41Å; K721-K742 PolarHBondContact O-N 2.82Å
722	K	66.3	Low	65.1	Low	122 Å²	122	45.2 Å²	45.2	53%	0.53	22%	0.224	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-136.9	147.6	168.4	-77.7	-165.5	172.4	-161.9	0	106.9	K701 K702 A703 K742	K701-K722 PolarHBondContact O-N 3.01Å; K701-K722 VanDerWaalsContact O-N 3.16Å; K702-K722 CarbonylContact C-O 3.57Å; K702-K722 WeakPolarHBondContact CA-O 3.11Å; A703-K722 PolarHBondContact N-O 3.32Å; K722-K742 CarbonylContact C-O 3.56Å; K722-K742 WeakPolarHBondContact CA-O 3.44Å
723	G	63.5	Low	64.8	Low	0 Å²	0	39.7 Å²	39.7	0%	0	20%	0.2	C	C	.	.			trans	178.6	118.1	-177	0	0	0	0	0	118.7	A703 N740 K742 T743	A703-G723 VanDerWaalsContact C-CA 3.42Å; A703-G723 CarbonylContact O-C 3.55Å; A703-G723 VanDerWaalsContact O-C 3.31Å; A703-G723 WeakPolarHBondContact O-CA 3.47Å; G723-N740 WeakPolarHBondContact CA-ND2 3.37Å; G723-N740 PolarHBondContact O-ND2 3.37Å; G723-K742 PolarHBondContact N-O 2.86Å; G723-T743 WeakPolarHBondContact O-CA 3.4Å; G723-T743 WeakPolarHBondContact O-CB 2.9Å; G723-T743 WeakPolarHBondContact O-CG2 2.88Å; G723-T743 PolarHBondContact O-OG1 3.42Å
724	D	63.4	Low	64.7	Low	29 Å²	29	43.3 Å²	43.3	16%	0.155	22%	0.216	C	C	.	.			trans	-122.9	121.9	-152.2	-31.6	-39.4	0	0	0	109	H118 K702 E704 G705 D744	H118-D724 PolarHBondContact ND1-O 2.95Å; K702-D724 IonicContact NZ-OD2 2.99Å; K702-D724 PolarHBondContact NZ-OD2 3.41Å; E704-D724 CarbonylContact C-O 3.57Å; E704-D724 WeakPolarHBondContact CA-O 3.26Å; E704-D724 HydrophobicContact CB-CB 4.45Å; E704-D724 WeakPolarHBondContact CB-O 3.1Å; E704-D724 HydrophobicContact CG-CB 3.91Å; E704-D724 WeakPolarHBondContact CG-OD2 2.98Å; G705-D724 PolarHBondContact N-O 2.89Å; D724-D744 CarbonylContact C-O 3.52Å; D724-D744 VanDerWaalsContact CA-O 3.32Å; D724-D744 WeakPolarHBondContact CA-O 3.35Å; D724-D744 HydrophobicContact CB-CB 4.24Å
725	G	60.4	Low	64.5	Low	15 Å²	15	40.8 Å²	40.8	16%	0.155	21%	0.21	C	C	.	.			trans	81.3	131.2	-173.4	0	0	0	0	0	115.8	G705 D744 T745	G705-G725 VanDerWaalsContact CA-O 3.26Å; G705-G725 WeakPolarHBondContact CA-O 3.41Å; G705-G725 PolarHBondContact N-O 2.9Å; G725-D744 PolarHBondContact N-O 3.02Å; G725-T745 WeakPolarHBondContact CA-O 3.38Å; G725-T745 PolarHBondContact N-O 2.75Å; G725-T745 VanDerWaalsContact N-O 3.12Å
726	N	63.1	Low	64.6	Low	0 Å²	0	40 Å²	40	0%	0	20%	0.202	C	C	.	.			trans	-153.3	66.2	163	-173.7	0.3	0	0	0	113	V706 T716 A736 S737 V746	V706-N726 WeakPolarHBondContact CB-OD1 3.11Å; V706-N726 CarbonylContact O-C 3.5Å; V706-N726 WeakPolarHBondContact O-CA 3.23Å; V706-N726 PolarHBondContact O-OD1 3.04Å; T716-N726 WeakPolarHBondContact CB-OD1 3.38Å; T716-N726 PolarHBondContact O-ND2 3.44Å; T716-N726 PolarHBondContact OG1-OD1 3.1Å; N726-A736 WeakPolarHBondContact O-CB 3.32Å; N726-S737 PolarHBondContact ND2-O 3.42Å; N726-V746 HydrophobicContact CB-CG1 3.97Å; N726-V746 HydrophobicContact CB-CG2 4.39Å; N726-V746 WeakPolarHBondContact O-CG1 3.46Å
727	P	63.6	Low	64.3	Low	30 Å²	30	41.2 Å²	41.2	20%	0.195	21%	0.21	C	C	.	.			trans	-76.6	125.6	-173.2	-16.6	32.7	0	0	0	115.3	V706 Q707 S708 A747	V706-P727 WeakPolarHBondContact O-CD 3.26Å; Q707-P727 WeakPolarHBondContact CA-O 3.37Å; Q707-P727 HydrophobicContact CG-CG 4.3Å; S708-P727 PolarHBondContact N-O 3.15Å; P727-A747 VanDerWaalsContact CA-O 3.26Å; P727-A747 WeakPolarHBondContact CA-O 3.43Å; P727-A747 WeakPolarHBondContact CB-O 3.37Å
728	N	61.9	Low	63.9	Low	1 Å²	1	37.9 Å²	37.9	1%	0.005	20%	0.195	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	124	161.9	-165.3	5.1	0	0	0	110.4	S708 E734 N748 Q749	S708-N728 WeakPolarHBondContact O-CA 3.07Å; S708-N728 PolarHBondContact O-OD1 2.7Å; N728-E734 PolarHBondContact ND2-O 3.02Å; N728-N748 WeakPolarHBondContact CB-OD1 3.35Å; N728-N748 PolarHBondContact N-OD1 3.43Å; N728-N748 WeakPolarHBondContact O-CA 3.34Å; N728-Q749 PolarHBondContact O-N 2.79Å; N728-Q749 VanDerWaalsContact O-N 3.08Å
729	Q	65.5	Low	63.9	Low	66 Å²	66	41.7 Å²	41.7	31%	0.308	21%	0.213	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	120.9	-179.4	-59.5	-176.4	-29.8	0	0	111.2	S708 Q709 S710 Q749	S708-Q729 PolarHBondContact O-N 2.84Å; Q709-Q729 CarbonylContact C-O 3.47Å; Q709-Q729 VanDerWaalsContact CA-O 3.32Å; Q709-Q729 WeakPolarHBondContact CA-O 3.33Å; Q709-Q729 HydrophobicContact CG-CB 4.26Å; S710-Q729 PolarHBondContact N-O 2.61Å; Q729-Q749 CarbonylContact C-O 3.6Å; Q729-Q749 VanDerWaalsContact CA-O 3.25Å; Q729-Q749 WeakPolarHBondContact CA-O 3.36Å; Q729-Q749 HydrophobicContact CG-CB 4.29Å
730	G	63.2	Low	63.7	Low	12 Å²	12	39.4 Å²	39.4	12%	0.124	20%	0.202	C	C	.	.			trans	-174.2	152.7	-171.2	0	0	0	0	0	117.7	S710 Q749 G750 T751 Q753	S710-G730 WeakPolarHBondContact O-CA 3.36Å; G730-Q749 PolarHBondContact N-O 2.95Å; G730-G750 CarbonylContact O-C 3.55Å; G730-G750 VanDerWaalsContact O-CA 3.26Å; G730-G750 WeakPolarHBondContact O-CA 3.35Å; G730-T751 PolarHBondContact O-N 2.92Å; G730-Q753 PolarHBondContact O-NE2 3.18Å; G730-Q753 VanDerWaalsContact O-NE2 3.1Å
731	K	63.6	Low	63.3	Low	137 Å²	137	45 Å²	45	60%	0.596	22%	0.218	S	C	*	.	S	Bend	trans	-68.6	-39.1	178	-73.6	-155.9	173.8	-165.3	0	112.5	K711 T751 K752	K711-K731 WeakPolarHBondContact O-CB 3.39Å; K711-K731 PolarHBondContact O-N 2.69Å; K731-T751 CarbonylContact O-C 3.58Å; K731-T751 WeakPolarHBondContact O-CB 3.15Å; K731-K752 PolarHBondContact O-N 3.21Å
732	K	61.7	Low	63.2	Low	83 Å²	83	45.6 Å²	45.6	36%	0.361	22%	0.221	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-127.2	130.6	156.7	-167.1	-177.2	-176.7	-154.6	0	108.6	K711 K712 G713 K752 E754	K711-K732 PolarHBondContact O-N 2.72Å; K712-K732 VanDerWaalsContact CA-O 3.23Å; K712-K732 WeakPolarHBondContact CA-O 3.28Å; G713-K732 PolarHBondContact N-O 3.4Å; G713-K732 VanDerWaalsContact N-O 3.15Å; K732-K752 CarbonylContact C-O 3.47Å; K732-K752 VanDerWaalsContact CA-O 3.24Å; K732-K752 WeakPolarHBondContact CA-O 3.32Å; K732-K752 HydrophobicContact CG-CB 4.3Å; K732-E754 WeakPolarHBondContact CE-OE1 3.08Å; K732-E754 IonicContact NZ-OE1 3.31Å; K732-E754 PolarHBondContact NZ-OE1 2.77Å
733	G	59.4	Low	62.9	Low	2 Å²	2	39.8 Å²	39.8	2%	0.021	20%	0.195	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-139.3	142.7	176.2	0	0	0	0	0	112.6	G713 K752 E754	G713-G733 WeakPolarHBondContact O-CA 3.23Å; G733-K752 PolarHBondContact N-O 3.38Å; G733-E754 PolarHBondContact O-N 2.96Å
734	E	60.2	Low	62.8	Low	80 Å²	80	42.7 Å²	42.7	37%	0.374	21%	0.211	S	C	.	.	P	Polyproline II helix	trans	-87.9	150.2	163.3	-64.3	159	-146.6	0	0	109.2	G713 G715 N728	G713-E734 PolarHBondContact O-N 2.88Å; G715-E734 WeakPolarHBondContact CA-O 3.31Å; N728-E734 PolarHBondContact ND2-O 3.02Å
735	G	61.1	Low	62.4	Low	21 Å²	21	45.1 Å²	45.1	22%	0.216	23%	0.227	C	C	.	.	P	Polyproline II helix	trans	-75.2	151.4	-157.9	0	0	0	0	0	116.4	G715 E754 G755	G715-G735 WeakPolarHBondContact CA-O 3.34Å; G735-E754 WeakPolarHBondContact CA-O 3.32Å; G735-E754 PolarHBondContact N-O 3.48Å; G735-G755 WeakPolarHBondContact CA-O 3.37Å
736	A	64.2	Low	62.2	Low	1 Å²	1	44.4 Å²	44.4	1%	0.008	22%	0.219	C	C	.	.	P	Polyproline II helix	trans	-69.9	141.5	175.4	0	0	0	0	0	111	T716 N726 V746 V756 S757	T716-A736 CarbonylContact O-C 3.36Å; T716-A736 WeakPolarHBondContact O-CA 3.42Å; N726-A736 WeakPolarHBondContact O-CB 3.32Å; A736-V746 HydrophobicContact CB-CG1 4.22Å; A736-V756 HydrophobicContact CB-CG1 4.41Å; A736-V756 HydrophobicContact CB-CG2 4.36Å; A736-V756 CarbonylContact O-C 3.52Å; A736-V756 VanDerWaalsContact O-CA 3.23Å; A736-V756 WeakPolarHBondContact O-CA 2.77Å; A736-V756 WeakPolarHBondContact O-CG1 3.17Å; A736-S757 PolarHBondContact O-N 2.98Å
737	S	64.7	Low	62.1	Low	25 Å²	25	45.7 Å²	45.7	18%	0.175	23%	0.23	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	136.1	178.1	-174.3	0	0	0	0	111.8	T716 N718 N726 S757	T716-S737 PolarHBondContact O-N 3.26Å; N718-S737 PolarHBondContact N-O 3.11Å; N726-S737 PolarHBondContact ND2-O 3.42Å; S737-S757 WeakPolarHBondContact CA-O 3.21Å
738	N	62.6	Low	61.8	Low	0 Å²	0	44.2 Å²	44.2	0%	0	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-137.1	104.9	-178.9	-139	-23.1	0	0	0	113.1	N718 N740 T743 S757 N758 Q759	N718-N738 CarbonylContact O-C 3.58Å; N718-N738 VanDerWaalsContact O-CA 3.23Å; N718-N738 WeakPolarHBondContact O-CA 2.97Å; N718-N738 PolarHBondContact O-OD1 3.04Å; N738-N740 PolarHBondContact OD1-ND2 3.38Å; N738-T743 VanDerWaalsContact ND2-CG2 3.31Å; N738-T743 WeakPolarHBondContact ND2-CG2 2.96Å; N738-S757 PolarHBondContact N-O 2.71Å; N738-N758 HydrophobicContact CB-CB 4.37Å; N738-N758 WeakPolarHBondContact CB-OD1 2.94Å; N738-N758 VanDerWaalsContact O-CA 3.28Å; N738-N758 WeakPolarHBondContact O-CA 3.23Å; N738-Q759 PolarHBondContact O-N 2.95Å
739	Q	68.1	Low	61.8	Low	80 Å²	80	47.8 Å²	47.8	37%	0.374	24%	0.237	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	68.3	-178	-64.8	-174.8	-8.1	0	0	111.7	N718 Q719 G720 Q759	N718-Q739 PolarHBondContact O-N 2.96Å; Q719-Q739 CarbonylContact C-O 3.55Å; Q719-Q739 WeakPolarHBondContact CA-O 3.36Å; Q719-Q739 HydrophobicContact CB-CB 4.11Å; Q719-Q739 HydrophobicContact CG-CB 4.1Å; G720-Q739 PolarHBondContact N-O 2.72Å; Q739-Q759 HydrophobicContact CG-CB 4.49Å
740	N	65.5	Low	61.4	Low	7 Å²	7	45.7 Å²	45.7	4%	0.037	23%	0.233	C	C	.	.			trans	-113	171	-172.4	-94.5	-43.2	0	0	0	112.6	G720 K721 G723 N738 K742 T743 Q759 V760	G720-N740 WeakPolarHBondContact CA-OD1 2.89Å; G720-N740 PolarHBondContact N-OD1 3.49Å; K721-N740 PolarHBondContact N-OD1 2.76Å; G723-N740 WeakPolarHBondContact CA-ND2 3.37Å; G723-N740 PolarHBondContact O-ND2 3.37Å; N738-N740 PolarHBondContact OD1-ND2 3.38Å; N740-K742 WeakPolarHBondContact CB-O 3.49Å; N740-T743 WeakPolarHBondContact CB-OG1 3.5Å; N740-T743 PolarHBondContact ND2-OG1 2.81Å; N740-T743 VanDerWaalsContact ND2-OG1 3.15Å; N740-Q759 PolarHBondContact N-O 3.01Å; N740-V760 HydrophobicContact CB-CG1 4.03Å; N740-V760 WeakPolarHBondContact O-CA 3.2Å; N740-V760 WeakPolarHBondContact O-CG1 3.01Å
741	R	62.5	Low	61.3	Low	133 Å²	133	47.6 Å²	47.6	50%	0.502	24%	0.243	S	C	.	.	S	Bend	trans	-90.5	-30.2	167.2	-53.1	174.5	-179.6	-160	-6.5	112.3	G720 K721 K761 K762	G720-R741 PolarHBondContact O-N 2.87Å; K721-R741 WeakPolarHBondContact O-CB 3.41Å; R741-K761 WeakPolarHBondContact O-CB 3.27Å; R741-K761 PolarHBondContact O-N 2.96Å; R741-K762 PolarHBondContact O-N 3.12Å
742	K	63.3	Low	61.2	Low	114 Å²	114	47 Å²	47	50%	0.496	24%	0.24	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-137.3	135.6	168.8	-67.9	-167.3	172.1	-159.5	0	108.5	K721 K722 G723 N740 K762	K721-K742 PolarHBondContact O-N 2.82Å; K722-K742 CarbonylContact C-O 3.56Å; K722-K742 WeakPolarHBondContact CA-O 3.44Å; G723-K742 PolarHBondContact N-O 2.86Å; N740-K742 WeakPolarHBondContact CB-O 3.49Å; K742-K762 WeakPolarHBondContact CA-O 3.25Å
743	T	59.9	Low	61	Low	0 Å²	0	43.2 Å²	43.2	0%	0	22%	0.223	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-139.3	131	175	-82.3	0	0	0	0	111.1	G723 N738 N740 V746 K762 S763 E764	G723-T743 WeakPolarHBondContact O-CA 3.4Å; G723-T743 WeakPolarHBondContact O-CB 2.9Å; G723-T743 WeakPolarHBondContact O-CG2 2.88Å; G723-T743 PolarHBondContact O-OG1 3.42Å; N738-T743 VanDerWaalsContact ND2-CG2 3.31Å; N738-T743 WeakPolarHBondContact ND2-CG2 2.96Å; N740-T743 WeakPolarHBondContact CB-OG1 3.5Å; N740-T743 PolarHBondContact ND2-OG1 2.81Å; N740-T743 VanDerWaalsContact ND2-OG1 3.15Å; T743-V746 HydrophobicContact CG2-CG2 3.74Å; T743-K762 PolarHBondContact N-O 2.61Å; T743-S763 WeakPolarHBondContact O-CA 3.17Å; T743-E764 PolarHBondContact O-N 3.34Å
744	D	60.1	Low	60.9	Low	60 Å²	60	45.9 Å²	45.9	32%	0.321	24%	0.236	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	116.4	-175.9	-46.2	-13.6	0	0	0	107.2	D724 G725	D724-D744 CarbonylContact C-O 3.52Å; D724-D744 VanDerWaalsContact CA-O 3.32Å; D724-D744 WeakPolarHBondContact CA-O 3.35Å; D724-D744 HydrophobicContact CB-CB 4.24Å; G725-D744 PolarHBondContact N-O 3.02Å
745	T	55.5	Low	60.8	Low	81 Å²	81	42.5 Å²	42.5	50%	0.497	22%	0.222	S	C	.	.			trans	60.3	123.5	-178.9	-54.1	0	0	0	0	117.8	G725 E764 G765	G725-T745 WeakPolarHBondContact CA-O 3.38Å; G725-T745 PolarHBondContact N-O 2.75Å; G725-T745 VanDerWaalsContact N-O 3.12Å; T745-E764 WeakPolarHBondContact CA-O 3.35Å; T745-E764 PolarHBondContact N-O 3.46Å; T745-G765 CarbonylContact C-O 3.57Å; T745-G765 VanDerWaalsContact CA-O 3.32Å; T745-G765 WeakPolarHBondContact CA-O 3.19Å
746	V	57.1	Low	60.6	Low	0 Å²	0	41.9 Å²	41.9	0%	0	21%	0.214	C	C	.	.			trans	-135.5	102.5	166.2	-174	0	0	0	0	111.5	N726 A736 T743 V756 G765 S766 P767	N726-V746 HydrophobicContact CB-CG1 3.97Å; N726-V746 HydrophobicContact CB-CG2 4.39Å; N726-V746 WeakPolarHBondContact O-CG1 3.46Å; A736-V746 HydrophobicContact CB-CG1 4.22Å; T743-V746 HydrophobicContact CG2-CG2 3.74Å; V746-V756 HydrophobicContact CB-CG1 4.09Å; V746-V756 HydrophobicContact CG1-CB 4.45Å; V746-V756 HydrophobicContact CG1-CG1 3.52Å; V746-V756 HydrophobicContact CG1-CG2 4.04Å; V746-G765 PolarHBondContact N-O 3.16Å; V746-S766 CarbonylContact O-C 3.59Å; V746-S766 WeakPolarHBondContact O-CA 3.02Å; V746-P767 WeakPolarHBondContact O-CD 2.96Å
747	A	59.6	Low	60.3	Low	26 Å²	26	43.5 Å²	43.5	22%	0.215	23%	0.225	C	C	.	.			trans	-105.1	109.4	-173.7	0	0	0	0	0	113.2	P727 P767	P727-A747 VanDerWaalsContact CA-O 3.26Å; P727-A747 WeakPolarHBondContact CA-O 3.43Å; P727-A747 WeakPolarHBondContact CB-O 3.37Å; A747-P767 WeakPolarHBondContact CA-O 3.43Å; A747-P767 HydrophobicContact CB-CG 4.05Å
748	N	58.2	Low	59.9	Low	0 Å²	0	42.3 Å²	42.3	0%	0	22%	0.217	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	140.5	169.6	-86.8	17.9	0	0	0	110.9	N728 Q753 V756 P767 N768 Q769	N728-N748 WeakPolarHBondContact CB-OD1 3.35Å; N728-N748 PolarHBondContact N-OD1 3.43Å; N728-N748 WeakPolarHBondContact O-CA 3.34Å; N748-Q753 PolarHBondContact ND2-OE1 2.84Å; N748-V756 HydrophobicContact CB-CG2 4.17Å; N748-P767 PolarHBondContact N-O 2.97Å; N748-N768 WeakPolarHBondContact CB-OD1 3.39Å; N748-N768 WeakPolarHBondContact O-CA 3.42Å; N748-N768 PolarHBondContact O-OD1 3.27Å; N748-Q769 PolarHBondContact O-N 3.13Å
749	Q	61.3	Low	59.8	Low	75 Å²	75	47 Å²	47	35%	0.35	24%	0.239	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-141.3	128.1	-178.5	-64	-178.2	-18	0	0	112.9	N728 Q729 G730 Q769	N728-Q749 PolarHBondContact O-N 2.79Å; N728-Q749 VanDerWaalsContact O-N 3.08Å; Q729-Q749 CarbonylContact C-O 3.6Å; Q729-Q749 VanDerWaalsContact CA-O 3.25Å; Q729-Q749 WeakPolarHBondContact CA-O 3.36Å; Q729-Q749 HydrophobicContact CG-CB 4.29Å; G730-Q749 PolarHBondContact N-O 2.95Å; Q749-Q769 CarbonylContact C-O 3.53Å; Q749-Q769 WeakPolarHBondContact CA-O 3.46Å; Q749-Q769 HydrophobicContact CG-CB 4.33Å
750	G	58.6	Low	59.2	Low	22 Å²	22	43.6 Å²	43.6	23%	0.227	22%	0.223	C	C	.	.	E	Extended strand (participates in β ladder)	trans	151.3	-168.3	162.2	0	0	0	0	0	115.9	G730 K752 Q769 G770	G730-G750 CarbonylContact O-C 3.55Å; G730-G750 VanDerWaalsContact O-CA 3.26Å; G730-G750 WeakPolarHBondContact O-CA 3.35Å; G750-K752 PolarHBondContact O-N 2.64Å; G750-Q769 PolarHBondContact N-O 3.15Å; G750-G770 WeakPolarHBondContact O-CA 3.41Å
751	T	60.3	Low	58.8	Low	53 Å²	53	49.6 Å²	49.6	33%	0.325	25%	0.249	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-70.8	-39.6	-156.5	-36.3	0	0	0	0	113.6	G730 K731 K771 K772	G730-T751 PolarHBondContact O-N 2.92Å; K731-T751 CarbonylContact O-C 3.58Å; K731-T751 WeakPolarHBondContact O-CB 3.15Å; T751-K771 HydrophobicContact CG2-CB 4.05Å; T751-K771 HydrophobicContact CG2-CD 3.89Å; T751-K771 HydrophobicContact CG2-CG 4.01Å; T751-K771 WeakPolarHBondContact O-CB 3.47Å; T751-K771 PolarHBondContact O-N 3.31Å; T751-K772 PolarHBondContact O-N 3.12Å
752	K	60.3	Low	58.6	Low	124 Å²	124	46.2 Å²	46.2	54%	0.539	24%	0.238	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-135.6	124	167.8	-64.4	-169.8	177.1	-172.7	0	108.2	K731 K732 G733 G750 K772	K731-K752 PolarHBondContact O-N 3.21Å; K732-K752 CarbonylContact C-O 3.47Å; K732-K752 VanDerWaalsContact CA-O 3.24Å; K732-K752 WeakPolarHBondContact CA-O 3.32Å; K732-K752 HydrophobicContact CG-CB 4.3Å; G733-K752 PolarHBondContact N-O 3.38Å; G750-K752 PolarHBondContact O-N 2.64Å; K752-K772 VanDerWaalsContact CA-O 3.31Å; K752-K772 WeakPolarHBondContact CA-O 3.11Å; K752-K772 HydrophobicContact CG-CB 4.26Å
753	Q	58.1	Low	58.3	Low	3 Å²	3	40.9 Å²	40.9	1%	0.014	22%	0.215	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-132.5	129.8	178.7	-72.2	-72.6	-33.3	0	0	109.7	G730 N748 K772 A773 E774	G730-Q753 PolarHBondContact O-NE2 3.18Å; G730-Q753 VanDerWaalsContact O-NE2 3.1Å; N748-Q753 PolarHBondContact ND2-OE1 2.84Å; Q753-K772 PolarHBondContact N-O 2.96Å; Q753-K772 VanDerWaalsContact N-O 3.11Å; Q753-A773 WeakPolarHBondContact O-CA 3.33Å; Q753-E774 PolarHBondContact O-N 2.83Å
754	E	58.7	Low	58	Low	59 Å²	59	44.7 Å²	44.7	28%	0.276	23%	0.233	S	C	.	.	P	Polyproline II helix	trans	-86.1	152.1	165.5	-64.2	157.8	-140.5	0	0	108.5	K732 G733 G735	K732-E754 WeakPolarHBondContact CE-OE1 3.08Å; K732-E754 IonicContact NZ-OE1 3.31Å; K732-E754 PolarHBondContact NZ-OE1 2.77Å; G733-E754 PolarHBondContact O-N 2.96Å; G735-E754 WeakPolarHBondContact CA-O 3.32Å; G735-E754 PolarHBondContact N-O 3.48Å
755	G	56.2	Low	57.6	Low	9 Å²	9	42.7 Å²	42.7	9%	0.093	23%	0.227	C	C	.	.	P	Polyproline II helix	trans	-80.5	157	-151.4	0	0	0	0	0	117.5	G735 S757 E774 A776	G735-G755 WeakPolarHBondContact CA-O 3.37Å; G755-S757 PolarHBondContact O-N 3.02Å; G755-E774 WeakPolarHBondContact CA-O 3.36Å; G755-E774 PolarHBondContact N-O 2.82Å; G755-A776 WeakPolarHBondContact O-CB 3.28Å
756	V	57.4	Low	57.6	Low	7 Å²	7	39.4 Å²	39.4	4%	0.042	21%	0.207	C	C	.	.	P	Polyproline II helix	trans	-70.7	121	175.2	-179.7	0	0	0	0	110.4	A736 V746 N748 N778	A736-V756 HydrophobicContact CB-CG1 4.41Å; A736-V756 HydrophobicContact CB-CG2 4.36Å; A736-V756 CarbonylContact O-C 3.52Å; A736-V756 VanDerWaalsContact O-CA 3.23Å; A736-V756 WeakPolarHBondContact O-CA 2.77Å; A736-V756 WeakPolarHBondContact O-CG1 3.17Å; V746-V756 HydrophobicContact CB-CG1 4.09Å; V746-V756 HydrophobicContact CG1-CB 4.45Å; V746-V756 HydrophobicContact CG1-CG1 3.52Å; V746-V756 HydrophobicContact CG1-CG2 4.04Å; N748-V756 HydrophobicContact CB-CG2 4.17Å; V756-N778 PolarHBondContact O-ND2 2.91Å
757	S	58.3	Low	57.6	Low	36 Å²	36	40.9 Å²	40.9	25%	0.252	22%	0.216	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-103.8	111.1	177.1	-174.1	0	0	0	0	111.6	A736 S737 N738 G755 P777	A736-S757 PolarHBondContact O-N 2.98Å; S737-S757 WeakPolarHBondContact CA-O 3.21Å; N738-S757 PolarHBondContact N-O 2.71Å; G755-S757 PolarHBondContact O-N 3.02Å; S757-P777 PolarHBondContact OG-O 3.09Å
758	N	57.3	Low	57.3	Low	0 Å²	0	40.2 Å²	40.2	0%	0	21%	0.209	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	127.7	176.6	-42.5	-79.4	0	0	0	111.9	N738 V760 S766 N778 Q779	N738-N758 HydrophobicContact CB-CB 4.37Å; N738-N758 WeakPolarHBondContact CB-OD1 2.94Å; N738-N758 VanDerWaalsContact O-CA 3.28Å; N738-N758 WeakPolarHBondContact O-CA 3.23Å; N758-V760 HydrophobicContact CB-CG1 4.36Å; N758-V760 HydrophobicContact CB-CG2 3.62Å; N758-S766 PolarHBondContact ND2-OG 3.42Å; N758-S766 VanDerWaalsContact ND2-OG 3.09Å; N758-N778 WeakPolarHBondContact CB-OD1 3.42Å; N758-N778 PolarHBondContact N-OD1 3.46Å; N758-N778 PolarHBondContact ND2-OD1 2.94Å; N758-N778 CarbonylContact O-C 3.46Å; N758-N778 PolarHBondContact O-OD1 3.34Å; N758-Q779 PolarHBondContact O-N 3.13Å
759	Q	58.8	Low	57.3	Low	99 Å²	99	43.4 Å²	43.4	46%	0.463	22%	0.224	S	C	.	.			trans	-106.8	99.8	167.7	-67.1	-177.4	1.9	0	0	108.5	N738 Q739 N740	N738-Q759 PolarHBondContact O-N 2.95Å; Q739-Q759 HydrophobicContact CG-CB 4.49Å; N740-Q759 PolarHBondContact N-O 3.01Å
760	V	57	Low	57.1	Low	7 Å²	7	41 Å²	41	4%	0.042	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-147.2	140.7	-160.2	-87.5	0	0	0	0	113.7	N740 N758 Q779 G780	N740-V760 HydrophobicContact CB-CG1 4.03Å; N740-V760 WeakPolarHBondContact O-CA 3.2Å; N740-V760 WeakPolarHBondContact O-CG1 3.01Å; N758-V760 HydrophobicContact CB-CG1 4.36Å; N758-V760 HydrophobicContact CB-CG2 3.62Å; V760-Q779 PolarHBondContact N-O 3.42Å; V760-Q779 VanDerWaalsContact N-O 3.12Å; V760-G780 WeakPolarHBondContact O-CA 3.33Å
761	K	56.7	Low	57	Low	133 Å²	133	46.4 Å²	46.4	58%	0.578	24%	0.237	S	C	*	.	E	Extended strand (participates in β ladder)	trans	-78.6	-37.8	177.7	-63	-169.4	176.7	-170.6	0	112.9	R741 K782	R741-K761 WeakPolarHBondContact O-CB 3.27Å; R741-K761 PolarHBondContact O-N 2.96Å; K761-K782 PolarHBondContact O-N 3.13Å
762	K	58.6	Low	56.8	Low	62 Å²	62	46.4 Å²	46.4	27%	0.27	23%	0.233	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-132.1	143.3	160.8	-157.4	-147.1	173	-162	0	109	R741 K742 T743 E764 K782 D784	R741-K762 PolarHBondContact O-N 3.12Å; K742-K762 WeakPolarHBondContact CA-O 3.25Å; T743-K762 PolarHBondContact N-O 2.61Å; K762-E764 IonicContact NZ-OE1 2.66Å; K762-E764 PolarHBondContact NZ-OE1 2.85Å; K762-K782 WeakPolarHBondContact CA-O 3.38Å; K762-K782 HydrophobicContact CG-CB 4.43Å; K762-D784 WeakPolarHBondContact CE-OD2 3.21Å; K762-D784 IonicContact NZ-OD2 2.87Å; K762-D784 PolarHBondContact NZ-OD2 3.17Å
763	S	55.6	Low	56.7	Low	3 Å²	3	40.6 Å²	40.6	2%	0.021	21%	0.208	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-144.8	145	164.7	55.8	0	0	0	0	112.7	T743 K783 D784	T743-S763 WeakPolarHBondContact O-CA 3.17Å; S763-K783 WeakPolarHBondContact OG-CE 3.32Å; S763-K783 WeakPolarHBondContact OG-CG 3.47Å; S763-D784 PolarHBondContact O-N 2.93Å
764	E	54.9	Low	56.6	Low	80 Å²	80	43.8 Å²	43.8	37%	0.374	22%	0.223	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-109.5	119.2	175.6	-70.8	161.1	-150.9	0	0	109	T743 T745 K762 D784	T743-E764 PolarHBondContact O-N 3.34Å; T745-E764 WeakPolarHBondContact CA-O 3.35Å; T745-E764 PolarHBondContact N-O 3.46Å; K762-E764 IonicContact NZ-OE1 2.66Å; K762-E764 PolarHBondContact NZ-OE1 2.85Å; E764-D784 WeakPolarHBondContact CG-OD2 3.2Å
765	G	51.3	Low	56.4	Low	18 Å²	18	42.7 Å²	42.7	19%	0.186	23%	0.227	C	C	.	.			trans	52.2	106.6	166.7	0	0	0	0	0	118.5	T745 V746 P767	T745-G765 CarbonylContact C-O 3.57Å; T745-G765 VanDerWaalsContact CA-O 3.32Å; T745-G765 WeakPolarHBondContact CA-O 3.19Å; V746-G765 PolarHBondContact N-O 3.16Å; G765-P767 WeakPolarHBondContact O-CD 3.4Å
766	S	54.6	Low	56.3	Low	12 Å²	12	43.2 Å²	43.2	8%	0.084	23%	0.23	C	C	.	.			trans	-111.6	66.4	167.6	-62.6	0	0	0	0	113.1	V746 N758 S786	V746-S766 CarbonylContact O-C 3.59Å; V746-S766 WeakPolarHBondContact O-CA 3.02Å; N758-S766 PolarHBondContact ND2-OG 3.42Å; N758-S766 VanDerWaalsContact ND2-OG 3.09Å; S766-S786 PolarHBondContact N-OG 2.9Å
767	P	57.3	Low	56.1	Low	30 Å²	30	46.8 Å²	46.8	20%	0.195	25%	0.254	C	S	.	.			trans	-65.3	137.5	-175.9	26.9	-34.6	0	0	0	113.2	V746 A747 N748 G765 P787	V746-P767 WeakPolarHBondContact O-CD 2.96Å; A747-P767 WeakPolarHBondContact CA-O 3.43Å; A747-P767 HydrophobicContact CB-CG 4.05Å; N748-P767 PolarHBondContact N-O 2.97Å; G765-P767 WeakPolarHBondContact O-CD 3.4Å; P767-P787 WeakPolarHBondContact CA-O 3.32Å; P767-P787 HydrophobicContact CB-CG 4.33Å; P767-P787 WeakPolarHBondContact CB-O 3.43Å
768	N	53.3	Low	55.7	Low	12 Å²	12	46 Å²	46	6%	0.064	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.6	112.7	177.3	-166.3	6.4	0	0	0	109.6	N748 P787 S788 Q789	N748-N768 WeakPolarHBondContact CB-OD1 3.39Å; N748-N768 WeakPolarHBondContact O-CA 3.42Å; N748-N768 PolarHBondContact O-OD1 3.27Å; N768-P787 PolarHBondContact N-O 3.47Å; N768-S788 VanDerWaalsContact O-CA 3.22Å; N768-S788 WeakPolarHBondContact O-CA 3.43Å; N768-S788 WeakPolarHBondContact O-CB 2.95Å; N768-S788 PolarHBondContact O-OG 2.85Å; N768-Q789 PolarHBondContact O-N 3.48Å; N768-Q789 VanDerWaalsContact O-N 3.13Å
769	Q	59	Low	55.5	Low	67 Å²	67	50.6 Å²	50.6	31%	0.313	27%	0.268	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.7	136.3	-171.9	-56.1	177.3	-55.5	0	0	111.4	N748 Q749 G750 Q789	N748-Q769 PolarHBondContact O-N 3.13Å; Q749-Q769 CarbonylContact C-O 3.53Å; Q749-Q769 WeakPolarHBondContact CA-O 3.46Å; Q749-Q769 HydrophobicContact CG-CB 4.33Å; G750-Q769 PolarHBondContact N-O 3.15Å; Q769-Q789 CarbonylContact C-O 3.54Å; Q769-Q789 VanDerWaalsContact CA-O 3.28Å; Q769-Q789 WeakPolarHBondContact CA-O 3.46Å; Q769-Q789 HydrophobicContact CG-CB 4.24Å
770	G	56.5	Low	55.3	Low	26 Å²	26	46.9 Å²	46.9	27%	0.268	26%	0.256	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-178.3	-158.6	-173.7	0	0	0	0	0	118.9	G750 Q789 A790	G750-G770 WeakPolarHBondContact O-CA 3.41Å; G770-Q789 PolarHBondContact N-O 3.5Å; G770-A790 VanDerWaalsContact O-CA 3.27Å; G770-A790 WeakPolarHBondContact O-CA 3.41Å; G770-A790 WeakPolarHBondContact O-CB 3.33Å
771	K	57.3	Low	55.1	Low	135 Å²	135	53 Å²	53	59%	0.587	28%	0.282	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.1	-38.2	166.8	-65.2	-165.4	-177.8	-173	0	112.1	T751 K791 K792	T751-K771 HydrophobicContact CG2-CB 4.05Å; T751-K771 HydrophobicContact CG2-CD 3.89Å; T751-K771 HydrophobicContact CG2-CG 4.01Å; T751-K771 WeakPolarHBondContact O-CB 3.47Å; T751-K771 PolarHBondContact O-N 3.31Å; K771-K791 PolarHBondContact O-N 2.99Å; K771-K792 PolarHBondContact O-N 2.64Å
772	K	56.4	Low	55	Low	53 Å²	53	52.9 Å²	52.9	23%	0.23	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.8	131.3	158.1	-162.1	-168.8	-175.3	-152.1	0	109.2	T751 K752 Q753 E774 K792 D794	T751-K772 PolarHBondContact O-N 3.12Å; K752-K772 VanDerWaalsContact CA-O 3.31Å; K752-K772 WeakPolarHBondContact CA-O 3.11Å; K752-K772 HydrophobicContact CG-CB 4.26Å; Q753-K772 PolarHBondContact N-O 2.96Å; Q753-K772 VanDerWaalsContact N-O 3.11Å; K772-E774 WeakPolarHBondContact CD-OE1 3.31Å; K772-E774 WeakPolarHBondContact CE-OE1 2.96Å; K772-E774 VanDerWaalsContact NZ-CD 3.3Å; K772-E774 IonicContact NZ-OE1 2.68Å; K772-E774 PolarHBondContact NZ-OE1 3.01Å; K772-K792 WeakPolarHBondContact CA-O 3.27Å; K772-K792 HydrophobicContact CG-CB 3.94Å; K772-D794 WeakPolarHBondContact CE-OD2 3.42Å; K772-D794 IonicContact NZ-OD2 2.64Å; K772-D794 PolarHBondContact NZ-OD2 3.41Å
773	A	58	Low	54.5	Low	1 Å²	1	50.9 Å²	50.9	1%	0.008	27%	0.273	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	124.6	168.2	0	0	0	0	0	109.1	Q753 A790 K792 V793 D794	Q753-A773 WeakPolarHBondContact O-CA 3.33Å; A773-A790 HydrophobicContact CB-CB 3.94Å; A773-K792 PolarHBondContact N-O 3.22Å; A773-V793 WeakPolarHBondContact O-CA 3Å; A773-D794 PolarHBondContact O-N 3.28Å
774	E	55.9	Low	54.2	Low	71 Å²	71	53.7 Å²	53.7	33%	0.332	29%	0.288	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.3	137.5	166.9	-75.2	154.7	-128.3	0	0	107.9	Q753 G755 K772 D794	Q753-E774 PolarHBondContact O-N 2.83Å; G755-E774 WeakPolarHBondContact CA-O 3.36Å; G755-E774 PolarHBondContact N-O 2.82Å; K772-E774 WeakPolarHBondContact CD-OE1 3.31Å; K772-E774 WeakPolarHBondContact CE-OE1 2.96Å; K772-E774 VanDerWaalsContact NZ-CD 3.3Å; K772-E774 IonicContact NZ-OE1 2.68Å; K772-E774 PolarHBondContact NZ-OE1 3.01Å; E774-D794 HydrophobicContact CG-CB 4.05Å
775	G	53.3	Low	53.9	Low	36 Å²	36	51 Å²	51	37%	0.371	28%	0.281	S	S	.	.			trans	-74.3	167.2	173.6	0	0	0	0	0	112.1	D794	G775-D794 PolarHBondContact N-O 2.85Å
776	A	54.5	Low	53.9	Low	19 Å²	19	52.5 Å²	52.5	16%	0.157	29%	0.289	C	S	.	.			trans	-133.8	147.7	167	0	0	0	0	0	110.2	G755 N778	G755-A776 WeakPolarHBondContact O-CB 3.28Å; A776-N778 PolarHBondContact O-ND2 3.41Å
777	P	53.3	Low	53.8	Low	83 Å²	83	54.4 Å²	54.4	54%	0.539	30%	0.301	S	S	.	.			trans	-62.1	141.2	-175	24.5	-34.2	0	0	0	112	S757	S757-P777 PolarHBondContact OG-O 3.09Å
778	N	49.9	Very low	53.3	Low	19 Å²	19	53.8 Å²	53.8	10%	0.102	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.2	83.7	-158.1	-117	-72.6	0	0	0	111.3	V756 N758 A776 K783 N798	V756-N778 PolarHBondContact O-ND2 2.91Å; N758-N778 WeakPolarHBondContact CB-OD1 3.42Å; N758-N778 PolarHBondContact N-OD1 3.46Å; N758-N778 PolarHBondContact ND2-OD1 2.94Å; N758-N778 CarbonylContact O-C 3.46Å; N758-N778 PolarHBondContact O-OD1 3.34Å; A776-N778 PolarHBondContact O-ND2 3.41Å; N778-K783 VanDerWaalsContact CB-NZ 3.34Å; N778-K783 PolarHBondContact O-NZ 3.13Å; N778-K783 PolarHBondContact OD1-NZ 3.26Å; N778-N798 WeakPolarHBondContact CB-OD1 3.33Å
779	Q	54.1	Low	53.5	Low	97 Å²	97	57.2 Å²	57.2	45%	0.453	31%	0.313	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.4	139.8	-174.5	-65.1	174.6	-9.9	0	0	112.9	N758 V760 K783 Q799	N758-Q779 PolarHBondContact O-N 3.13Å; V760-Q779 PolarHBondContact N-O 3.42Å; V760-Q779 VanDerWaalsContact N-O 3.12Å; Q779-K783 PolarHBondContact O-NZ 2.71Å; Q779-Q799 WeakPolarHBondContact CA-O 3.22Å; Q779-Q799 HydrophobicContact CG-CB 4.5Å
780	G	54	Low	53.3	Low	20 Å²	20	54.2 Å²	54.2	21%	0.206	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-175.9	-178.8	175.1	0	0	0	0	0	117.8	V760 Q799 G800	V760-G780 WeakPolarHBondContact O-CA 3.33Å; G780-Q799 PolarHBondContact N-O 3.38Å; G780-G800 WeakPolarHBondContact O-CA 3.33Å
781	K	53.3	Low	53.2	Low	136 Å²	136	58.6 Å²	58.6	59%	0.591	31%	0.312	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.4	-34.8	179.3	-71.4	-154.9	174.1	-162.6	0	114.9	K802	K781-K802 PolarHBondContact O-N 3.24Å
782	K	52.9	Low	53	Low	130 Å²	130	57.4 Å²	57.4	57%	0.565	31%	0.306	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-143.2	133.9	171.6	-67.9	-168.3	175.5	-168.8	0	109.2	K761 K762 K802	K761-K782 PolarHBondContact O-N 3.13Å; K762-K782 WeakPolarHBondContact CA-O 3.38Å; K762-K782 HydrophobicContact CG-CB 4.43Å; K782-K802 CarbonylContact C-O 3.52Å; K782-K802 WeakPolarHBondContact CA-O 3.39Å
783	K	48.5	Very low	52.9	Low	21 Å²	21	55.2 Å²	55.2	9%	0.091	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.3	137	175.4	-65.7	-167.6	171.1	176.1	0	111.9	S763 N778 Q779 K802 E804	S763-K783 WeakPolarHBondContact OG-CE 3.32Å; S763-K783 WeakPolarHBondContact OG-CG 3.47Å; N778-K783 VanDerWaalsContact CB-NZ 3.34Å; N778-K783 PolarHBondContact O-NZ 3.13Å; N778-K783 PolarHBondContact OD1-NZ 3.26Å; Q779-K783 PolarHBondContact O-NZ 2.71Å; K783-K802 PolarHBondContact N-O 3.21Å; K783-K802 VanDerWaalsContact N-O 3.07Å; K783-E804 PolarHBondContact O-N 3.35Å; K783-E804 VanDerWaalsContact O-N 3.15Å
784	D	50.5	Low	52.8	Low	62 Å²	62	57.2 Å²	57.2	33%	0.332	31%	0.308	S	S	.	.			trans	-95.5	147.3	169.7	-42.8	-36.1	0	0	0	107.1	K762 S763 E764	K762-D784 WeakPolarHBondContact CE-OD2 3.21Å; K762-D784 IonicContact NZ-OD2 2.87Å; K762-D784 PolarHBondContact NZ-OD2 3.17Å; S763-D784 PolarHBondContact O-N 2.93Å; E764-D784 WeakPolarHBondContact CG-OD2 3.2Å
785	G	47.2	Very low	52.7	Low	22 Å²	22	55.4 Å²	55.4	23%	0.227	31%	0.305	C	S	.	.			trans	-61.6	151.9	-161.4	0	0	0	0	0	116.6	P787 E804 A806	G785-P787 WeakPolarHBondContact O-CD 3.32Å; G785-E804 VanDerWaalsContact CA-O 3.22Å; G785-E804 WeakPolarHBondContact CA-O 3.34Å; G785-A806 VanDerWaalsContact C-CB 3.5Å
786	S	51.5	Low	52.7	Low	50 Å²	50	55 Å²	55	35%	0.35	30%	0.299	S	S	.	.			trans	-115.3	93.2	-178.6	-63.2	0	0	0	0	111.7	S766 S788	S766-S786 PolarHBondContact N-OG 2.9Å; S786-S788 PolarHBondContact O-N 3.29Å
787	P	53.1	Low	52.6	Low	53 Å²	53	56.2 Å²	56.2	34%	0.344	31%	0.309	S	S	.	.			trans	-71.9	127	-173.4	26.5	-32.3	0	0	0	111.3	P767 N768 G785 A806	P767-P787 WeakPolarHBondContact CA-O 3.32Å; P767-P787 HydrophobicContact CB-CG 4.33Å; P767-P787 WeakPolarHBondContact CB-O 3.43Å; N768-P787 PolarHBondContact N-O 3.47Å; G785-P787 WeakPolarHBondContact O-CD 3.32Å; P787-A806 HydrophobicContact CB-CB 4.01Å; P787-A806 HydrophobicContact CG-CB 4.43Å
788	S	48	Very low	52.4	Low	16 Å²	16	55.1 Å²	55.1	11%	0.112	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	127.6	174.7	-173.6	0	0	0	0	110.2	N768 S786 A808 Q809	N768-S788 VanDerWaalsContact O-CA 3.22Å; N768-S788 WeakPolarHBondContact O-CA 3.43Å; N768-S788 WeakPolarHBondContact O-CB 2.95Å; N768-S788 PolarHBondContact O-OG 2.85Å; S786-S788 PolarHBondContact O-N 3.29Å; S788-A808 CarbonylContact O-C 3.58Å; S788-A808 WeakPolarHBondContact O-CA 3.42Å; S788-Q809 PolarHBondContact O-N 3.24Å
789	Q	56	Low	52.4	Low	84 Å²	84	60.2 Å²	60.2	39%	0.393	32%	0.321	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	95.8	-179.9	-78.2	169.4	-20.7	0	0	109.4	N768 Q769 G770 Q809	N768-Q789 PolarHBondContact O-N 3.48Å; N768-Q789 VanDerWaalsContact O-N 3.13Å; Q769-Q789 CarbonylContact C-O 3.54Å; Q769-Q789 VanDerWaalsContact CA-O 3.28Å; Q769-Q789 WeakPolarHBondContact CA-O 3.46Å; Q769-Q789 HydrophobicContact CG-CB 4.24Å; G770-Q789 PolarHBondContact N-O 3.5Å; Q789-Q809 WeakPolarHBondContact CA-O 3.38Å; Q789-Q809 HydrophobicContact CG-CB 3.93Å
790	A	55.4	Low	52.2	Low	5 Å²	5	57 Å²	57	4%	0.041	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.8	146.2	176.9	0	0	0	0	0	113	G770 A773 K792 V793 Q809 G810	G770-A790 VanDerWaalsContact O-CA 3.27Å; G770-A790 WeakPolarHBondContact O-CA 3.41Å; G770-A790 WeakPolarHBondContact O-CB 3.33Å; A773-A790 HydrophobicContact CB-CB 3.94Å; A790-K792 VanDerWaalsContact CB-O 3.31Å; A790-K792 WeakPolarHBondContact CB-O 3.21Å; A790-K792 PolarHBondContact O-N 3.5Å; A790-K792 VanDerWaalsContact O-N 3.13Å; A790-V793 HydrophobicContact CB-CG2 3.89Å; A790-Q809 PolarHBondContact N-O 2.9Å; A790-Q809 VanDerWaalsContact N-O 3.13Å; A790-G810 WeakPolarHBondContact O-CA 3.5Å
791	K	54.9	Low	52	Low	118 Å²	118	64 Å²	64	51%	0.513	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-55.6	-33.9	-179	-73.2	-172.6	172.9	-103.5	0	113.1	K771 Q811 K812	K771-K791 PolarHBondContact O-N 2.99Å; K791-Q811 PolarHBondContact O-N 2.91Å; K791-K812 PolarHBondContact O-N 3.14Å
792	K	51.8	Low	51.9	Low	109 Å²	109	64.6 Å²	64.6	47%	0.474	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120	135.8	158.4	-86.2	-162.8	168.2	-159	0	111	K771 K772 A773 A790 K812	K771-K792 PolarHBondContact O-N 2.64Å; K772-K792 WeakPolarHBondContact CA-O 3.27Å; K772-K792 HydrophobicContact CG-CB 3.94Å; A773-K792 PolarHBondContact N-O 3.22Å; A790-K792 VanDerWaalsContact CB-O 3.31Å; A790-K792 WeakPolarHBondContact CB-O 3.21Å; A790-K792 PolarHBondContact O-N 3.5Å; A790-K792 VanDerWaalsContact O-N 3.13Å; K792-K812 WeakPolarHBondContact CA-O 3.48Å; K792-K812 HydrophobicContact CG-CB 4.08Å
793	V	55.4	Low	51.5	Low	8 Å²	8	61 Å²	61	5%	0.048	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	121.8	170.5	-179.2	0	0	0	0	108.8	A773 A790 A808 K812 A813 S814	A773-V793 WeakPolarHBondContact O-CA 3Å; A790-V793 HydrophobicContact CB-CG2 3.89Å; V793-A808 HydrophobicContact CB-CB 4.37Å; V793-A808 HydrophobicContact CG1-CB 4.03Å; V793-A808 HydrophobicContact CG2-CB 4.5Å; V793-K812 PolarHBondContact N-O 3.3Å; V793-A813 HydrophobicContact CB-CB 4.29Å; V793-A813 CarbonylContact O-C 3.59Å; V793-A813 WeakPolarHBondContact O-CA 3.22Å; V793-S814 PolarHBondContact O-N 3.21Å
794	D	56.1	Low	51.6	Low	42 Å²	42	66.9 Å²	66.9	23%	0.225	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	102.7	175.1	-53.3	-0.2	0	0	0	106.8	K772 A773 E774 G775	K772-D794 WeakPolarHBondContact CE-OD2 3.42Å; K772-D794 IonicContact NZ-OD2 2.64Å; K772-D794 PolarHBondContact NZ-OD2 3.41Å; A773-D794 PolarHBondContact O-N 3.28Å; E774-D794 HydrophobicContact CG-CB 4.05Å; G775-D794 PolarHBondContact N-O 2.85Å
795	A	53.8	Low	51.2	Low	33 Å²	33	70.1 Å²	70.1	27%	0.273	38%	0.376	S	S	.	.	P	Polyproline II helix	trans	-77.2	137	-170.6	0	0	0	0	0	112.5	S814 V816	A795-S814 PolarHBondContact N-O 3.15Å; A795-S814 VanDerWaalsContact N-O 3.17Å; A795-V816 WeakPolarHBondContact O-CB 3.47Å; A795-V816 VanDerWaalsContact O-CG2 3.32Å; A795-V816 WeakPolarHBondContact O-CG2 3.22Å
796	A	53	Low	51.4	Low	29 Å²	29	70.5 Å²	70.5	24%	0.24	38%	0.376	C	S	.	.	P	Polyproline II helix	trans	-100.9	152.8	175.8	0	0	0	0	0	112.3	N798	A796-N798 PolarHBondContact O-N 3.06Å
797	A	53	Low	51.4	Low	44 Å²	44	72.3 Å²	72.3	36%	0.364	39%	0.387	S	S	.	.	P	Polyproline II helix	trans	-65	131.4	-176.4	0	0	0	0	0	113.1	S818	A797-S818 WeakPolarHBondContact CA-OG 3.32Å
798	N	47.9	Very low	51.2	Low	60 Å²	60	72.1 Å²	72.1	32%	0.321	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.9	133.3	174	-73.2	-62.6	0	0	0	109.7	N778 A796 S818	N778-N798 WeakPolarHBondContact CB-OD1 3.33Å; A796-N798 PolarHBondContact O-N 3.06Å; N798-S818 PolarHBondContact N-OG 3.07Å; N798-S818 VanDerWaalsContact N-OG 3.14Å
799	Q	50.5	Low	51.5	Low	126 Å²	126	76.8 Å²	76.8	59%	0.589	41%	0.41	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-121.3	114.8	176.1	-71.1	-178.6	-7.1	0	0	109.9	Q779 G780	Q779-Q799 WeakPolarHBondContact CA-O 3.22Å; Q779-Q799 HydrophobicContact CG-CB 4.5Å; G780-Q799 PolarHBondContact N-O 3.38Å
800	G	49.2	Very low	51.2	Low	30 Å²	30	74.3 Å²	74.3	31%	0.309	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-172.9	157.2	174.2	0	0	0	0	0	114.5	G780 K802	G780-G800 WeakPolarHBondContact O-CA 3.33Å; G800-K802 VanDerWaalsContact C-N 3.31Å; G800-K802 PolarHBondContact O-N 2.99Å
801	K	51.2	Low	51.2	Low	165 Å²	165	80.8 Å²	80.8	72%	0.717	44%	0.437	S	S	*	.	S	Bend	trans	-73.8	-16.1	-173	-68.3	-149.7	170.9	-150.8	0	115.1
802	K	49.5	Very low	50.8	Low	149 Å²	149	82.5 Å²	82.5	65%	0.648	44%	0.444	S	S	*	.	S	Bend	trans	-150.1	125.5	162.8	-68.6	-157.3	174.3	-152.4	0	108.4	K781 K782 K783 G800	K781-K802 PolarHBondContact O-N 3.24Å; K782-K802 CarbonylContact C-O 3.52Å; K782-K802 WeakPolarHBondContact CA-O 3.39Å; K783-K802 PolarHBondContact N-O 3.21Å; K783-K802 VanDerWaalsContact N-O 3.07Å; G800-K802 VanDerWaalsContact C-N 3.31Å; G800-K802 PolarHBondContact O-N 2.99Å
803	S	44.9	Very low	50.5	Low	55 Å²	55	80 Å²	80	39%	0.385	44%	0.444	S	S	.	.	B	Isolated β-bridge	trans	-147.2	120	175.1	50.8	0	0	0	0	110.1
804	E	50.4	Low	50.1	Low	145 Å²	145	82.6 Å²	82.6	68%	0.678	46%	0.462	S	S	*	.	P	Polyproline II helix	trans	-85.5	135.8	167.6	-72.7	168	-160.8	0	0	109.2	K783 G785	K783-E804 PolarHBondContact O-N 3.35Å; K783-E804 VanDerWaalsContact O-N 3.15Å; G785-E804 VanDerWaalsContact CA-O 3.22Å; G785-E804 WeakPolarHBondContact CA-O 3.34Å
805	M	43.6	Very low	49.6	Very low	130 Å²	130	87.4 Å²	87.4	64%	0.64	49%	0.485	S	S	*	.	P	Polyproline II helix	trans	-92.8	117.5	174.8	-72.3	-179.2	59.9	0	0	109.3	M815	M805-M815 HydrophobicContact CE-CE 3.68Å
806	A	50.4	Low	49.1	Very low	29 Å²	29	90 Å²	90	24%	0.24	50%	0.497	C	S	.	.	P	Polyproline II helix	trans	-77.5	150	164.7	0	0	0	0	0	109.7	G785 P787	G785-A806 VanDerWaalsContact C-CB 3.5Å; P787-A806 HydrophobicContact CB-CB 4.01Å; P787-A806 HydrophobicContact CG-CB 4.43Å
807	P	50.8	Low	48.5	Very low	88 Å²	88	97 Å²	97	57%	0.571	53%	0.525	S	S	*	.	P	Polyproline II helix	trans	-63.4	137.6	-175.4	24.2	-34.4	0	0	0	112.8	Q809	P807-Q809 PolarHBondContact O-N 3.42Å
808	A	49.6	Very low	47.8	Very low	49 Å²	49	97.1 Å²	97.1	41%	0.405	52%	0.524	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.8	97.2	164	0	0	0	0	0	108.8	S788 V793 G810	S788-A808 CarbonylContact O-C 3.58Å; S788-A808 WeakPolarHBondContact O-CA 3.42Å; V793-A808 HydrophobicContact CB-CB 4.37Å; V793-A808 HydrophobicContact CG1-CB 4.03Å; V793-A808 HydrophobicContact CG2-CB 4.5Å; A808-G810 PolarHBondContact O-N 2.82Å
809	Q	54	Low	47.2	Very low	114 Å²	114	103.3 Å²	103.3	53%	0.533	55%	0.551	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-81.8	98.8	178.8	-74.6	179.6	-27.6	0	0	109.9	S788 Q789 A790 P807	S788-Q809 PolarHBondContact O-N 3.24Å; Q789-Q809 WeakPolarHBondContact CA-O 3.38Å; Q789-Q809 HydrophobicContact CG-CB 3.93Å; A790-Q809 PolarHBondContact N-O 2.9Å; A790-Q809 VanDerWaalsContact N-O 3.13Å; P807-Q809 PolarHBondContact O-N 3.42Å
810	G	49.7	Very low	46.5	Very low	33 Å²	33	103.3 Å²	103.3	34%	0.34	55%	0.551	S	S	.	*			trans	-151.3	147.4	-178.5	0	0	0	0	0	113.6	A790 A808 K812	A790-G810 WeakPolarHBondContact O-CA 3.5Å; A808-G810 PolarHBondContact O-N 2.82Å; G810-K812 PolarHBondContact O-N 3.44Å
811	Q	55.2	Low	45.7	Very low	141 Å²	141	105.9 Å²	105.9	66%	0.659	57%	0.568	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.1	-23	-179.4	-62.4	-169.6	-74.5	0	0	112.8	K791	K791-Q811 PolarHBondContact O-N 2.91Å
812	K	46.4	Very low	44.9	Very low	154 Å²	154	103.9 Å²	103.9	67%	0.67	57%	0.572	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-144.8	86.5	169.1	-64.5	-165.3	178.8	-161	0	109.7	K791 K792 V793 G810	K791-K812 PolarHBondContact O-N 3.14Å; K792-K812 WeakPolarHBondContact CA-O 3.48Å; K792-K812 HydrophobicContact CG-CB 4.08Å; V793-K812 PolarHBondContact N-O 3.3Å; G810-K812 PolarHBondContact O-N 3.44Å
813	A	46.6	Very low	44.2	Very low	56 Å²	56	102.9 Å²	102.9	46%	0.463	57%	0.568	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-89.8	136.4	171.1	0	0	0	0	0	110.6	V793	V793-A813 HydrophobicContact CB-CB 4.29Å; V793-A813 CarbonylContact O-C 3.59Å; V793-A813 WeakPolarHBondContact O-CA 3.22Å
814	S	47	Very low	43.7	Very low	63 Å²	63	109 Å²	109	44%	0.441	59%	0.591	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-110.5	116.6	169.3	58.9	0	0	0	0	109.7	V793 A795	V793-S814 PolarHBondContact O-N 3.21Å; A795-S814 PolarHBondContact N-O 3.15Å; A795-S814 VanDerWaalsContact N-O 3.17Å
815	M	45.6	Very low	42.8	Very low	142 Å²	142	109.5 Å²	109.5	70%	0.7	60%	0.598	S	S	*	*			trans	-96.3	99.9	-170.3	-168.8	175.7	-169.2	0	0	110.5	M805 Q817	M805-M815 HydrophobicContact CE-CE 3.68Å; M815-Q817 PolarHBondContact O-N 2.66Å
816	V	42.9	Very low	42.4	Very low	88 Å²	88	107.6 Å²	107.6	53%	0.533	60%	0.603	S	S	.	*			trans	-74.3	113.3	169.7	-176.5	0	0	0	0	108.2	A795 S818	A795-V816 WeakPolarHBondContact O-CB 3.47Å; A795-V816 VanDerWaalsContact O-CG2 3.32Å; A795-V816 WeakPolarHBondContact O-CG2 3.22Å; V816-S818 PolarHBondContact O-N 2.87Å
817	Q	40.9	Very low	41.7	Very low	175 Å²	175	112.2 Å²	112.2	82%	0.818	63%	0.63	S	S	*	*	P	Polyproline II helix	trans	-61.5	124.1	177.4	-71.9	178.5	-22.8	0	0	110.1	M815	M815-Q817 PolarHBondContact O-N 2.66Å
818	S	37	Very low	41	Very low	48 Å²	48	112.9 Å²	112.9	34%	0.336	64%	0.644	S	S	.	*	P	Polyproline II helix	trans	-83.1	116.4	171.4	-61.4	0	0	0	0	108.5	A797 N798 V816 E820	A797-S818 WeakPolarHBondContact CA-OG 3.32Å; N798-S818 PolarHBondContact N-OG 3.07Å; N798-S818 VanDerWaalsContact N-OG 3.14Å; V816-S818 PolarHBondContact O-N 2.87Å; S818-E820 PolarHBondContact O-N 3.38Å
819	Q	36.7	Very low	40.6	Very low	190 Å²	190	120.5 Å²	120.5	89%	0.888	67%	0.668	S	S	*	*	P	Polyproline II helix	trans	-63.6	118.7	171.3	-66.8	-176.7	4.7	0	0	109.2	A821	Q819-A821 PolarHBondContact O-N 3.5Å
820	E	34.7	Very low	39.6	Very low	126 Å²	126	124.8 Å²	124.8	59%	0.589	68%	0.684	S	S	*	*			trans	-78	115.4	177.8	-164.6	-178.9	-152.2	0	0	109.4	S818 K823	S818-E820 PolarHBondContact O-N 3.38Å; E820-K823 WeakPolarHBondContact OE1-CE 3.08Å; E820-K823 IonicContact OE1-NZ 2.72Å; E820-K823 PolarHBondContact OE1-NZ 3.38Å; E820-K823 IonicContact OE2-NZ 2.66Å; E820-K823 PolarHBondContact OE2-NZ 3.17Å
821	A	32.9	Very low	39.2	Very low	83 Å²	83	133.5 Å²	133.5	69%	0.686	71%	0.713	S	S	*	*			trans	-63.1	131.5	179.2	0	0	0	0	0	110.5	Q819 K823	Q819-A821 PolarHBondContact O-N 3.5Å; A821-K823 PolarHBondContact O-N 2.66Å
822	P	33.3	Very low	38.3	Very low	123 Å²	123	132.6 Å²	132.6	80%	0.799	72%	0.722	S	S	*	*			trans	-60.2	137.7	-165.4	19.8	-32.1	0	0	0	113.4	Q824	P822-Q824 PolarHBondContact O-N 3.09Å; P822-Q824 VanDerWaalsContact O-N 3.17Å
823	K	34.7	Very low	37.9	Very low	129 Å²	129	129 Å²	129	56%	0.561	73%	0.729	S	S	*	*			trans	-80.4	94.4	-179.8	-67.8	154.1	-176.8	147.9	0	109.1	E820 A821 D825	E820-K823 WeakPolarHBondContact OE1-CE 3.08Å; E820-K823 IonicContact OE1-NZ 2.72Å; E820-K823 PolarHBondContact OE1-NZ 3.38Å; E820-K823 IonicContact OE2-NZ 2.66Å; E820-K823 PolarHBondContact OE2-NZ 3.17Å; A821-K823 PolarHBondContact O-N 2.66Å; K823-D825 PolarHBondContact O-N 2.72Å; K823-D825 VanDerWaalsContact O-N 3.09Å
824	Q	34.3	Very low	37.7	Very low	184 Å²	184	132.2 Å²	132.2	86%	0.86	75%	0.748	S	S	*	*			trans	-71	97.1	162.4	-76.8	-176.1	-30.2	0	0	109.3	P822	P822-Q824 PolarHBondContact O-N 3.09Å; P822-Q824 VanDerWaalsContact O-N 3.17Å
825	D	32.9	Very low	37.4	Very low	154 Å²	154	141 Å²	141	82%	0.824	77%	0.771	S	S	*	*			trans	-75.1	142.1	163.5	-72.7	-53.2	0	0	0	110	K823	K823-D825 PolarHBondContact O-N 2.72Å; K823-D825 VanDerWaalsContact O-N 3.09Å
826	A	35.2	Very low	37	Very low	91 Å²	91	143 Å²	143	75%	0.752	78%	0.776	S	S	*	*			trans	-140.6	143.5	-179.9	0	0	0	0	0	110.5
827	P	35.3	Very low	36.9	Very low	125 Å²	125	148.2 Å²	148.2	81%	0.812	79%	0.792	S	S	*	*			trans	-82.6	154.9	-151.7	-16	33	0	0	0	115.2
828	A	36.7	Very low	37.1	Very low	103 Å²	103	143.4 Å²	143.4	85%	0.851	79%	0.789	S	S	*	*			trans	-69.4	127.7	178.6	0	0	0	0	0	112.5
829	K	40.1	Very low	37.3	Very low	209 Å²	209	150 Å²	150	91%	0.909	81%	0.814	S	S	*	*			trans	-96.9	114.8	170.3	-71.5	-171	175.1	-176.4	0	110.9
830	K	34.2	Very low	37.9	Very low	203 Å²	203	146.8 Å²	146.8	88%	0.883	81%	0.81	S	S	*	*			trans	-67.6	142	167.8	-60.1	176.7	-178.7	177.2	0	110.1
831	K	41.1	Very low	38.8	Very low	216 Å²	216	147.5 Å²	147.5	94%	0.939	82%	0.823	S	S	*	*			trans	-162.1	143.6	142.5	-114.6	174.4	-178	-175.3	0	110.4
832	S	35.9	Very low	39.1	Very low	123 Å²	123	153 Å²	153	86%	0.86	85%	0.854	S	S	*	*			trans	-120	170.9	-173.1	49.8	0	0	0	0	111.2
833	G	38.8	Very low	39.3	Very low	79 Å²	79	154.5 Å²	154.5	81%	0.814	86%	0.857	S	S	*	*			trans	92.7	80.6	161.8	0	0	0	0	0	116.6
834	S	41.1	Very low	39.6	Very low	122 Å²	122	155.8 Å²	155.8	85%	0.853	87%	0.873	S	S	*	*			trans	-91.6	115.7	156.1	-173	0	0	0	0	108.9
835	R	41.3	Very low	39.9	Very low	248 Å²	248	154.3 Å²	154.3	94%	0.936	87%	0.873	S	S	*	*			trans	-75.5	174.6	170.7	-84.7	-175.4	170.3	179.4	-3.2	111.3
836	K	37.8	Very low	40.3	Very low	184 Å²	184	154.3 Å²	154.3	80%	0.8	88%	0.876	S	S	*	*			trans	-135.3	133.6	-149.6	176.1	-175.8	-179.5	-175.5	0	111.4
837	K	40.9	Very low	40.6	Very low	197 Å²	197	158.3 Å²	158.3	86%	0.857	88%	0.884	S	S	*	*			trans	59	128.2	171.5	-73.9	-172.8	169	-166.8	0	117.5
838	G	44.4	Very low	41	Very low	74 Å²	74	160.5 Å²	160.5	76%	0.763	89%	0.889	S	S	*	*	P	Polyproline II helix	trans	-100.4	171	146.8	0	0	0	0	0	109.9
839	E	42.1	Very low	41.3	Very low	186 Å²	186	164.6 Å²	164.6	87%	0.869	89%	0.891	S	S	*	*	P	Polyproline II helix	trans	-88.2	162.8	-167.8	-74.5	164.3	116.5	0	0	114.7
840	P	48.1	Very low	41.4	Very low	123 Å²	123	161.2 Å²	161.2	80%	0.799	89%	0.89	S	S	*	*	P	Polyproline II helix	trans	-73.4	147.3	165.4	32.9	-34.5	0	0	0	111.1
841	V	53.7	Low	42	Very low	141 Å²	141	157.7 Å²	157.7	86%	0.855	89%	0.891	S	S	*	*	P	Polyproline II helix	trans	-100.3	134.5	168.9	178.8	0	0	0	0	108.4
842	C	38.4	Very low	42	Very low	199 Å²	199	152.4 Å²	152.4	100%	1.345	89%	0.886	S	S	*	*			trans	-105.8	0	158.9	-71.4	0	0	0	0	108.3

Retrieved 842 of 842 residues in 585.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).